Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00968g5.706ON1148114862500.0
Kwal_55.196785.706ON1178117944940.0
SAKL0E15004g5.706ON1196119435460.0
AFR290W5.706ON121796830360.0
TDEL0B021405.706ON1147119929110.0
ZYRO0B16412g5.706ON137299329080.0
Ecym_40155.706ON1257100028410.0
KNAG0C066305.706ON1281100427820.0
KAFR0H001805.706ON124198127410.0
Kpol_1043.735.706ON126097527150.0
Smik_11.3605.706ON118098126530.0
Suva_11.3335.706ON118797326050.0
Skud_11.3365.706ON118898225870.0
YKR096W5.706ON119598425750.0
NCAS0A031705.706ON1319104325680.0
CAGL0H06611g5.706ON1282103224550.0
TPHA0E001905.706ON136199824440.0
Skud_9.175.706ON111896423830.0
YIL151C5.706ON111896723540.0
Suva_9.375.706ON111796523420.0
Smik_9.185.706ON111896523100.0
CAGL0G02541g5.706ON129573420510.0
NDAI0E050705.706ON155638212851e-153
TBLA0E017105.706ON152642611681e-137
TPHA0D046405.706ON9625803535e-33
KLLA0A00528g5.706ON12291221202e-05
KAFR0C036508.8ON21271790.61
TPHA0D044401.133ON658113791.2
TPHA0D001708.8ON21771734.2
TDEL0C057401.133ON58590744.5
Kpol_2001.581.133ON633113736.4
AFR165C8.160ON20384717.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00968g
         (1148 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  2412   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1735   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1370   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1174   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1125   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1124   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1098   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1076   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1060   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...  1050   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  1026   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1008   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1001   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   996   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   993   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   950   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   946   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   922   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   911   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   906   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   894   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   794   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   499   e-153
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   454   e-137
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   140   5e-33
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...    51   2e-05
KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON...    35   0.61 
TPHA0D04440 Chr4 (957641..959617) [1977 bp, 658 aa] {ON} Anc_1.1...    35   1.2  
TPHA0D00170 Chr4 (21311..21964) [654 bp, 217 aa] {ON} Anc_8.8 YF...    33   4.2  
TDEL0C05740 Chr3 (1030530..1032287) [1758 bp, 585 aa] {ON} Anc_1...    33   4.5  
Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa] ...    33   6.4  
AFR165C Chr6 complement(734202..734813) [612 bp, 203 aa] {ON} Sy...    32   7.2  

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 2412 bits (6250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1148/1148 (100%), Positives = 1148/1148 (100%)

Query: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD 60
            MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD
Sbjct: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD 60

Query: 61   SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG 120
            SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG
Sbjct: 61   SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG 120

Query: 121  CDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAAQTESGEARAPVNSGGLT 180
            CDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAAQTESGEARAPVNSGGLT
Sbjct: 121  CDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAAQTESGEARAPVNSGGLT 180

Query: 181  GRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT 240
            GRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT
Sbjct: 181  GRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT 240

Query: 241  HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH 300
            HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH
Sbjct: 241  HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH 300

Query: 301  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA 360
            GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA
Sbjct: 301  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA 360

Query: 361  LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP 420
            LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP
Sbjct: 361  LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP 420

Query: 421  SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ 480
            SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ
Sbjct: 421  SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ 480

Query: 481  NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFEL 540
            NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFEL
Sbjct: 481  NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFEL 540

Query: 541  PKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL 600
            PKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL
Sbjct: 541  PKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL 600

Query: 601  SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC 660
            SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC
Sbjct: 601  SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC 660

Query: 661  RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK 720
            RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK
Sbjct: 661  RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK 720

Query: 721  CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780
            CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF
Sbjct: 721  CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780

Query: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840
            IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE
Sbjct: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840

Query: 841  NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP 900
            NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP
Sbjct: 841  NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP 900

Query: 901  IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS 960
            IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS
Sbjct: 901  IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS 960

Query: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020
            CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA
Sbjct: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020

Query: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080
            TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF
Sbjct: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080

Query: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140
            EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG
Sbjct: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140

Query: 1141 LAHHACTN 1148
            LAHHACTN
Sbjct: 1141 LAHHACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1735 bits (4494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 873/1179 (74%), Positives = 980/1179 (83%), Gaps = 32/1179 (2%)

Query: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD 60
            ME MRDIPT  SG    A+  QQKRQHSRS +YMGSGV+KRR+GSG+SG  AAAAA FLD
Sbjct: 1    MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYMGSGVSKRRVGSGVSGTTAAAAASFLD 60

Query: 61   SGGSPVRRKD----------------------AQSPSYMPTTSSSNLEAAAVENENSSVR 98
              GSP+RR++                      A SPSY+PTTSSSNLEAA  ENEN SV 
Sbjct: 61   CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNAYSPSYLPTTSSSNLEAAVTENENGSVN 120

Query: 99   LSDICI-----DP---RMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNA 150
              DICI     DP   R   +   N + +  +  S +QH T  N IQ  S+  G P G+ 
Sbjct: 121  FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQGGSSSAGLPTGDQ 180

Query: 151  PAYSEHSVPNNAAQTESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNEN-TPAAGQTSSQ 209
              + E S P N++++          S G    ++R N++  NNNN     + A   +SS 
Sbjct: 181  -DFREGSTPENSSRSSRHGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSSSP 239

Query: 210  TSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFIT 269
            TSQALVQKLQDIYRNIVKQEVELQERC+QLT SQTTDLKNLWIIYK+N ELINNYVAFIT
Sbjct: 240  TSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFIT 299

Query: 270  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 329
            TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF
Sbjct: 300  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 359

Query: 330  ISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGK 389
            ISIS MLGDMPQKF+TPW ERLGDLSRMAIALYPSGFIDWKLSAEHWY+QALSHIFGHGK
Sbjct: 360  ISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGK 419

Query: 390  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSL 449
            LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERNGGN RNSL
Sbjct: 420  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSL 479

Query: 450  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYF 509
            MVEYLKHSEVMLLSSFLESPELQKVVLSFFQ+KFG+S++NTD+F+ + +FLQDGER KYF
Sbjct: 480  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYF 539

Query: 510  FRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPS 569
            FRHAPAFAESHILQ VGFG+PKNPFALLFELPKFLKERKERKERRKSKSS+SFTS+E  S
Sbjct: 540  FRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSIETTS 599

Query: 570  PTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAH 629
              SP EYLE+VDSPR+ YEFP DLAIW++SLSHIN TS +CS++V QKFL GPLV A  H
Sbjct: 600  HLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTH 659

Query: 630  LLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSS 689
            +LPW+YFLLSLA++ID LPS ELK FWI L RQ+FPWNSIV+FLNM++AF LDN WKTS 
Sbjct: 660  MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP 719

Query: 690  IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDH 749
            ID LCEQ DSVD R+LV+HFS++EDLPE+W+CWGALWFDVI+DKS+  D     +  +DH
Sbjct: 720  IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDH 779

Query: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAG 809
             F D+P DGICFDEDDE G +FWKRACRL+FIFKGIAQEF++GLTL++   QSRR + AG
Sbjct: 780  PFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAG 839

Query: 810  HPLQNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGY 869
            HPLQNF F FE+ P  S+  + +  Q+P FE I+  NLDPN  PGQSMLEG+S+F+ PGY
Sbjct: 840  HPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGY 899

Query: 870  RQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKEL 929
            RQ++AD+TCFNK+G+LI+CSLYTSG LE+GPI GGDDFNTERY RS++ NK +N QI EL
Sbjct: 900  RQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITEL 959

Query: 930  DKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLAT 989
            +++ER WLD CMNPEFIEQ Y+MKFPFGDLSCNCDSGVSYFV DATSWLRHFAHV+KLAT
Sbjct: 960  ERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLAT 1019

Query: 990  NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHL 1049
            N VLRF ICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYS+K+LLPLRFTGNVATHL
Sbjct: 1020 NNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHL 1079

Query: 1050 EEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALV 1109
            EEHLEFEEQITWRSHVDEFVIEAVYKAQ KFEA+NAQAKE GHDFI TT+EEPFHF+ALV
Sbjct: 1080 EEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALV 1139

Query: 1110 SDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            SDDTNMR+KAH QRI+TFS+RFMFAVCNQIGLAH ACTN
Sbjct: 1140 SDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1370 bits (3546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/1194 (59%), Positives = 876/1194 (73%), Gaps = 74/1194 (6%)

Query: 12   SGVNVEASPA-QQKRQHSRSCDYMGSGVNKRR---LGSGIS--GAAAAAAALFLDSGGSP 65
            S + + + P   QKR +S S DY  SG  KRR   L   +S     AA+AA FLDS  +P
Sbjct: 20   SRIQMASHPTLHQKRHNSNSYDYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTP 79

Query: 66   VRRKDA----------------------QSPSYMPTTSSSNLEAAA--VENENSSVRLSD 101
             + ++                       QSP Y+PTTSSSNLEAA+  + N+NSSV+L D
Sbjct: 80   SKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPD 139

Query: 102  ICIDPR----------MDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNAP 151
            ICID +          ++   +H+ K    + A+  Q ++ ++ +Q     P   + N  
Sbjct: 140  ICIDNKQQPERRQQQRLEKRVNHDDKKITRNAANGEQKESITDELQGTDNTPHEQSSNTH 199

Query: 152  A-YSEHSVPNNAAQTESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQT 210
            A  ++ S  +N+ Q  S                  G   D  NN  N   P        T
Sbjct: 200  ADTNQQSDQHNSVQQGSS-----------------GGSDDGENNRENSGIPIVNVPPKHT 242

Query: 211  SQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITT 270
            SQALVQKLQDIYR+IVKQE+ELQERCSQLT+SQTTD+KNLW+IYKVN ELINNY++FITT
Sbjct: 243  SQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITT 302

Query: 271  ALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFI 330
            ALLPSQPEQDLLIGQEIV IYR+ERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI+HVF+
Sbjct: 303  ALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFM 362

Query: 331  SISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKL 390
            SISNMLGD+P +++ PWLERLGDLSRMAIALYPSGFIDWKLSAEHWY+QAL + +GHGKL
Sbjct: 363  SISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKL 422

Query: 391  YYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLM 450
            YYHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAER+GG+ RN  +
Sbjct: 423  YYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPI 482

Query: 451  VEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFF 510
            VEYLKHSEVMLL SFLESPELQKVVL+FFQ +FG+  NN D+F H+ IF+QDGE+ +YFF
Sbjct: 483  VEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFF 542

Query: 511  RHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSF-TSMEAPS 569
             HAPAFAESHILQ+VGFG+P+NPFA+LFELPKFLKERKERKERR+SKSS    T+++  +
Sbjct: 543  SHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLDDGN 602

Query: 570  PTSPI---EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSA 626
             +S I    Y E++DS R  Y FP D+ IWQQSLS++N TS++CS  VL+KFLH PL++A
Sbjct: 603  GSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTA 662

Query: 627  AAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWK 686
              HLLPWA+FL+S+AIRI  L S  LK FW+   R++FPWNS+V+FLN ++AF LDN+  
Sbjct: 663  LPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRN 722

Query: 687  TSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSV 746
             SS++ LCE+++ +D+ TLV+HF+ +E+LPEVWKCWG LWFD IS+KS++         +
Sbjct: 723  MSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGI 782

Query: 747  QDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSL 806
            +DH+F D P+DGICFD+DDE+G +FWKRACR++F+FKG+A+EF+ G+ ++  P+ +RR +
Sbjct: 783  RDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRRDV 842

Query: 807  AAGHPLQNFCFKFEDPPV--DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLF 864
               H L+ F FKFE+ P   D+E +      +  FE IS  N +  A P  SM++G+S+F
Sbjct: 843  TTLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIF 902

Query: 865  ELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNP 924
            E  GYR+++ D+ CFNK G LIT SLYTSG LE+  I GGDDFN +R+  +  L  A N 
Sbjct: 903  EFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNS 962

Query: 925  QI--------KELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATS 976
             +          ++  ER WL+ CM+P F+E   D +FP GDL+CN DS V+YFV DATS
Sbjct: 963  PVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATS 1022

Query: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036
            WLRHFAHVYKLATN VL+FAICLTTFQELRFLRKSKDESVVEAATRAVIT RQLY E++L
Sbjct: 1023 WLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKL 1082

Query: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIP 1096
            LPLRFTGN+ATHLEEHLEFEEQITWRSHVDEFVIEAVYK+Q KF+ LN QA++ G ++IP
Sbjct: 1083 LPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIP 1142

Query: 1097 T--TEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            T   +++ F+F+ LV+DD NMR KA A  I  FSSRFMFA CNQ+G     C N
Sbjct: 1143 TDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/968 (60%), Positives = 727/968 (75%), Gaps = 40/968 (4%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P    T+ Q+SQAL++KLQ+IYRNIV+QE ELQ+RCSQLT SQTTDLKNLWIIYKVN E
Sbjct: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LI+NY  FITTALLP+QPE DLLIG+EI+ +YRIERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VCCQFI +VFISISNMLGD+P KF+  WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            AL + FGHGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510

Query: 440  RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
            RN G+ RN+ +VEYLKH+EVMLL SFLES ELQ VVL+FF+ KFG++S N D+F  + +F
Sbjct: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTS-NVDFFDPRLVF 569

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559
            +QD ER K+FFRHA  +AESH+LQ+VGFG+P+NPFALLFELPK LKERK+R+E+RKSKSS
Sbjct: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS 629

Query: 560  NSF---TSMEAPSP-TSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVL 615
             S    TS++      +P E+ E++DS +++Y+FP D+ IW++SLS+ N T++KCS +VL
Sbjct: 630  TSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVL 689

Query: 616  QKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNM 675
            +KFLHGPL++A  HLLPW YFL +   R+  +P  E++ FW+AL RQ+FP+N+I+ FLN+
Sbjct: 690  RKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNV 749

Query: 676  IIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDK-- 733
            ++ +  +        D   EQF  + +  LV +F +NE+LPEVW+CWG LWFD ++ K  
Sbjct: 750  LLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHI 809

Query: 734  SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGL 793
            +++ D  +T   V+DHMF D P+DGI FD +DE+G +FWKR  R++ +F+ +A E  +GL
Sbjct: 810  TNLTDINST--GVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL 867

Query: 794  TLASVPLQSRRSLAAGHPLQNFCFKFEDPPVD-----SESYALISTQMPAFENISERNLD 848
                      R ++ G   ++  FKFE+PP +      E + L+      FE IS  NLD
Sbjct: 868  ----------REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLV---FDTFEQISPVNLD 914

Query: 849  PNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFN 908
              A P   M     +  L GYR L  D+ CFN+ G +IT SLYT G+LE   IHGGDDFN
Sbjct: 915  QRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFN 974

Query: 909  TERYSRSDELNKADNPQIKEL-DKMERMWLDTCMNPEFIEQT-------YDMKFPFGDLS 960
             +R   + EL   +      L D+ E+  +D     EF+  T       ++   P GDL 
Sbjct: 975  GKRLLENGELVSTERRDYNSLIDREEQPIMD-----EFLRHTHCKNDVRWEQMLPRGDLH 1029

Query: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020
            C  D+ V+YFV DAT+WLRHF HVYKLA N +L+FAICLTTFQELRFLRKSKDESV+EAA
Sbjct: 1030 CFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAA 1089

Query: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080
            TRAVITVRQLY E++LLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA++KAQ+KF
Sbjct: 1090 TRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF 1149

Query: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140
             ALN  AK    D IPT  ++ F+FIALV+DD NMR KA AQ I+ FS+RFMF+VCN++G
Sbjct: 1150 NALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELG 1209

Query: 1141 LAHHACTN 1148
             A + CTN
Sbjct: 1210 HAKNVCTN 1217

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 9/78 (11%)

Query: 21 AQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLDSGGSPVRRKDAQSPSYMPTT 80
          A  +++HS +      G+ KRR   G       A  L +D+ G+     +  SPSY+PTT
Sbjct: 18 ALHQKRHSSALGGCRDGLAKRRGPRG----GLTACGLVVDAIGA-----EPGSPSYLPTT 68

Query: 81 SSSNLEAAAVENENSSVR 98
          SSSNL+AAA   +NSS+R
Sbjct: 69 SSSNLDAAARAIDNSSLR 86

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1125 bits (2911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/1199 (49%), Positives = 759/1199 (63%), Gaps = 156/1199 (13%)

Query: 16   VEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLDSGGSP---------- 65
            + AS  +QKR  S   +   S   KRR+ +   G        FLD+G  P          
Sbjct: 39   IPASAGRQKRHSSNPYNSAESTGVKRRVANHDDGITQ-----FLDNGAIPNTPCKEPVSS 93

Query: 66   -----VRRKDAQSPS---------------YMPTTSSSNLEAAAVENENSSVRLSDICID 105
                  RR   ++P                Y P  S+  ++  +    +S V + ++C D
Sbjct: 94   RRPSATRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRD 153

Query: 106  PRMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAAQT 165
            P   S   H        + S  Q               G  + N+   ++ S  N+A   
Sbjct: 154  PSFLSKEAH--------IVSDGQDT-------------GTISINSGEVNDQSQDNSA--- 189

Query: 166  ESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNE-------------------NTPAAGQT 206
                             ND G D +N N++                      N P+    
Sbjct: 190  -----------------NDEGRDDNNENDSIRNKNSNNDNDNNRENNKDNNGNVPSVVVP 232

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT+SQTT+LK LW+IYKVN++LINNYV 
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLP Q +QDL IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            HVFISISNML D+P ++A PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+ +I+G
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF ERN GN R
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHR 472

Query: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506
            NS ++EYLKHSEVMLL SFLES +LQ+VVL +F++KFG+ +N  + F  + +F Q+ ++ 
Sbjct: 473  NSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQL 532

Query: 507  KYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSME 566
            KYFFRHAPAFAESHILQ+VGFG+PKNPFALLFELP+ LK+R+++KE+RK+KSS + T   
Sbjct: 533  KYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSSVT-TETS 591

Query: 567  APSPTSPIEYLES--------------VDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSA 612
            +       EY++S              +DS    Y FP  L +W  SL ++N TS+ CS 
Sbjct: 592  SAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNITSLHCSM 651

Query: 613  VVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNF 672
            +VL+KFL GP+V A  HLLPWAYF++++  ++  +     ++FW+ L  ++FPWN+IVNF
Sbjct: 652  IVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPWNTIVNF 711

Query: 673  LNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISD 732
            LN++IA+ LDN   +  ID LCE+  ++ +  LV+HF+ NEDLPEVWKCWG LWFD I D
Sbjct: 712  LNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLWFDAICD 771

Query: 733  KSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMG 792
            K  V  +      ++DHMF D+P+DGI FD DDE+G +FWKRACR++F+FK IA+ F   
Sbjct: 772  KDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIAENFQTR 831

Query: 793  LTLAS-VPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNA 851
            L ++S   +  RR+    H L++FCFK  D   +S S  ++   +  FE  S+ N D   
Sbjct: 832  LVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNS--VLQNTIEVFEEGSDANKDMQM 889

Query: 852  PPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLE--KGPIHGGDDFNT 909
             P  S+LE +S+F   GY++L +D +C+++ G  ++ SLYTS   E  K  I   +    
Sbjct: 890  TPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQ 949

Query: 910  ERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSY 969
            +  + +D   +  N  + E                     +++ FP     C  +   ++
Sbjct: 950  QTANEADLFIEGINTSLTE---------------------FNIDFP----ECKMNGKDTF 984

Query: 970  FVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQ 1029
            FV DATSWLRHFAHVYKLA+N VL+FAICLTTFQELRFLRKSKDE+VVEAATRAVITVRQ
Sbjct: 985  FVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQ 1044

Query: 1030 LYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKE 1089
            LY+E R+LPLRFTGNVATH+EEHLEFEEQITWRSHVDEFV EA+ KAQ +          
Sbjct: 1045 LYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL--------- 1095

Query: 1090 GGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
                   + E   FH + LV+DD NMR KA    I T S+RF+FA CN +G     CTN
Sbjct: 1096 -------SQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/993 (56%), Positives = 712/993 (71%), Gaps = 61/993 (6%)

Query: 197  NENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKV 256
            N   P+    S ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+
Sbjct: 400  NRAVPSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKI 459

Query: 257  NTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM 316
            N++LINNYV F+TTALLPSQ EQD+LIG+EIV IYRIERRLWV+GTITFLD+ KNFSNFM
Sbjct: 460  NSDLINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFM 519

Query: 317  DPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHW 376
            DPEVCCQFITHVFISISNMLGD+P K+  PWL+RLGDLSRMAIALYPSGFIDWKLSAEHW
Sbjct: 520  DPEVCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHW 579

Query: 377  YTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRA 436
            Y +A+   + HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRA
Sbjct: 580  YMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRA 639

Query: 437  FAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQ 496
            F ERN GN RN+ ++EYLKHSEVMLL SFLES +LQ+VVL +F+ KFG  SNN + F  +
Sbjct: 640  FVERNNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTR 699

Query: 497  AIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS 556
             +F Q+ +  +YFFRHAPAFAESHILQ+VGFG+PKNPFALLFELP+FLK+RK++KE+R++
Sbjct: 700  KMFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRT 759

Query: 557  KSS-----------NSFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINT 605
            KS+           +     ++   ++P  +  ++++ RF Y  P++L IW +SL++IN 
Sbjct: 760  KSTTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINM 819

Query: 606  TSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFP 665
            TS+KCS VVLQKFL GPLV A  H +PW YF++SLA +I +L     + FW+    ++FP
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 666  WNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGAL 725
            WN+IV+FLN++IA+ LDN+WK+S +D+LC Q+ S+ +  L+D+F+ NE LPEVWKCWG L
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTL 939

Query: 726  WFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGI 785
            WFD I +K     E      +++HMF D P+DGI FD +DE+G  FWKRACR++F+FKG+
Sbjct: 940  WFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGL 999

Query: 786  AQEFNMGLTLASV-PLQSRRS-LAAGHPLQNFCFKFE----------DPPVDSES---YA 830
            A+ F +G+TL+ V P+  RR+ ++  H L++F FK            +PP  S +     
Sbjct: 1000 AENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLD 1059

Query: 831  LISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSL 890
             +   +  FE  S  N+  +  P  S++EG+S+F+  GYR+LH D+  ++K G  ++ SL
Sbjct: 1060 HLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASL 1119

Query: 891  YTSGSLEKG-------PIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNP 943
            YTS             P HG D       S+ D +       I           +  M P
Sbjct: 1120 YTSWYANNNTNNTGVIPAHGSD-----VDSQRDAVQSVQEMHI----------FNQIMEP 1164

Query: 944  EFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQ 1003
             +     D  F    L     S  +YFV D T+WLRHF H+YKLA++GVL+FAICLTTF 
Sbjct: 1165 GYCGGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFH 1224

Query: 1004 ELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRS 1063
            ELRFLRK KDE+VVEAATRA+ITVRQLYSE +LLPLRFTGNVATH+EEHLEFEE+ITWRS
Sbjct: 1225 ELRFLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRS 1284

Query: 1064 HVDEFVIEAVYKAQNKFEALNAQAKEG--------GHDFIPTTEEEPFHFIALVSDDTNM 1115
            HVDEFVIEAVYKAQ+KF+ +N    E          HD     +     F+ LV+DD+NM
Sbjct: 1285 HVDEFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHD-----DRSGLKFVVLVTDDSNM 1339

Query: 1116 RLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            R KA  Q +RTFS++F+F++CN IGL    CTN
Sbjct: 1340 RKKAQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1098 bits (2841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1000 (57%), Positives = 721/1000 (72%), Gaps = 46/1000 (4%)

Query: 171  RAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEV 230
            R   N+ G+   ++   D DN +NN N +T A    S  +SQ LV+KLQ+IY+NIVKQE 
Sbjct: 282  REGNNNVGINSSSESNEDGDNGDNNHNVSTVAV--PSKPSSQTLVEKLQEIYKNIVKQET 339

Query: 231  ELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNI 290
            ELQERCSQLT SQTTDLKNLW+IYK+N ELI+NY  FITTALLP+QP+ DLLIGQEI+ +
Sbjct: 340  ELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFTFITTALLPTQPKADLLIGQEIIEV 399

Query: 291  YRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLER 350
            YRIERRLW++GTITFLDVLKNFSNFMDPEVCCQFI +VFISISN+LG++P  F+  WLER
Sbjct: 400  YRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIVYVFISISNILGNIPPTFSVIWLER 459

Query: 351  LGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGK 410
            LGDLSRMAIALYPSGFIDWKLSAEHWY +AL + FGHGKLYYHMSTVQQNTL AFVNLGK
Sbjct: 460  LGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFGHGKLYYHMSTVQQNTLAAFVNLGK 519

Query: 411  SVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPE 470
            SVFCRDTFIPSQQYMQLVIDNIYQRAFAERN G+ R S +VEYLKH+EVMLL SFLE+ E
Sbjct: 520  SVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRYSHIVEYLKHTEVMLLPSFLENVE 579

Query: 471  LQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNP 530
             Q VVL+FF  KFG ++ + ++F    IF+QD ER K+FFRHA  +AESHILQ+VGFG+P
Sbjct: 580  SQGVVLAFFDQKFG-ATGSANFFDPSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDP 638

Query: 531  KNPFALLFELPKFL---KERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPRFVY 587
            +NPFALLFELPK +   KERKE+++ + + S+ S  S++      P+++ E+++S +  Y
Sbjct: 639  RNPFALLFELPKCIKERKERKEKRKSKSTASNQSDMSIDDTFLGDPVQFFETLNSTKTAY 698

Query: 588  EFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDEL 647
             F  DL IW++SL+++N TS++CS VVL+KFL+  L++A  HLLPWAYFL+++ +R+D +
Sbjct: 699  RFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAI 758

Query: 648  PSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVD 707
             + + K FWI   RQ+FPW SI NFLN+++ +  D       ID     + ++ +  L++
Sbjct: 759  RNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLE 818

Query: 708  HFSQNEDLPEVWKCWGALWFDVISDK--SDVVDEGATYNSVQDHMFGDMPVDGICFDEDD 765
            +F +NEDLPEVW CWG LWFDVI+ K  S++VD  +T   V+DHMF D PVDGI FD  D
Sbjct: 819  YFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHST--GVKDHMFLDAPVDGISFDHSD 876

Query: 766  ETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVD 825
            E+G +FWKR  R++ +F+GIA +F  G T                  ++  FKF +PP +
Sbjct: 877  ESGEKFWKRCVRVILLFRGIAYQFPFGFT----------EFNGSDDWKSLVFKFNEPPAE 926

Query: 826  SESYAL--ISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTG 883
             +   L   S +   FE+IS  N D  +PP + M+ G  +  L GY+QL  D+ CFNK G
Sbjct: 927  WKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNG 986

Query: 884  TLITCSLYTSGSLEKGP--IHGGDDF-------------NTERYSRSDELNKADNPQIKE 928
             LIT SLYTSG  E G    +  +DF              +ER   ++ L+K + P I E
Sbjct: 987  DLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDE 1046

Query: 929  LDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLA 988
              K    W  +  N       ++   P GDL    D+ V+YFV DAT+WLRHF HVYKLA
Sbjct: 1047 FLK----WRYSSTNSR-----WEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLA 1097

Query: 989  TNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH 1048
            T+ +L+FAICLTTFQELRFLRKSKDESV+EAATRAVITVRQLY E++LLPLRFTGNVA H
Sbjct: 1098 TSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGH 1157

Query: 1049 LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIAL 1108
            LEEHLE EEQ+TWRSHVDEFVIEA+ KAQ+KF  LN  AK  G + I T ++  F+FIAL
Sbjct: 1158 LEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIAL 1217

Query: 1109 VSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            V+DD NMR KA AQ IR FS++FMFA+C++IGL+   CT+
Sbjct: 1218 VTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1004 (54%), Positives = 700/1004 (69%), Gaps = 68/1004 (6%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            + ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+NT+LINNY  
Sbjct: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLPSQP QD+LIG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 344  FITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            HVFIS+S +L D+P K A PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQ 445
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN GGN 
Sbjct: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523

Query: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505
            RN  +++YLKHSEVMLL SFL S +LQ+VVL++FQ++FGI  +  + F  Q +F Q    
Sbjct: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583

Query: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKS-SNSFTS 564
             ++FFRHAPAFAESHILQ+VGFGNPKNPFALLFELPK+LKER+++KE+ KSKS S +  S
Sbjct: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVS 643

Query: 565  MEAPSPT----------------------SPIEYLESVDSPRFVYEFPTDLAIWQQSLSH 602
              AP                         S  EYL+++++ ++  E P D+  W +SL  
Sbjct: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDF 702

Query: 603  INTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQ 662
            IN TS+KCS +VL+KFLHGPL+ A  H LPW  F+++  I+++EL + +   FW  L ++
Sbjct: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762

Query: 663  VFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCW 722
            +FPW++I +FLN+++A+ LDN   T+ I+ LC Q+  +D+  ++ HF+++EDLPEVWKCW
Sbjct: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822

Query: 723  GALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIF 782
            G LW+D I +K+ V  +      + DHMF D P+DGI FD +DETG++FWKRA R++F+F
Sbjct: 823  GTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882

Query: 783  KGIAQEFNMGLTLA-SVPLQSRRSLAAGHPLQNFCFKFE--DPPVDSESYALISTQMPAF 839
            KGI+++F+ GL ++    +  R   AA  PL+ F FK E  D P  S+    I    P  
Sbjct: 883  KGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFI----PLC 938

Query: 840  ENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKG 899
            E +S  N D  A P  S+++G+++FE  GYR L  D   F+K G +++ S+YTS  ++ G
Sbjct: 939  EEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTG 998

Query: 900  PIHGGDDFNTERYSRSD---ELNKADNP---QIKELDKMERMWLDTCMNPEFIEQTYDMK 953
                     T+  + S+   +L     P    +    K     +    +P   E     K
Sbjct: 999  EAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKK 1058

Query: 954  F-PFGD-----LSCNCDSGVSY-------------------FVPDATSWLRHFAHVYKLA 988
            F   GD     +  N  +G SY                   F+ DATSWLRHFAH+YK+A
Sbjct: 1059 FMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIA 1118

Query: 989  TNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH 1048
            TNGVL+F +CLTTFQELRFLRKSKDE+VVEAA RA+IT+RQLY E RLLPLRFTGNVA  
Sbjct: 1119 TNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVAND 1178

Query: 1049 LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF----EALNAQAKEGGHDFIPTTEEEPFH 1104
            +EEHLEFEEQITWRSHVDEFVIEAV KAQ+KF    E    + +  G   +P   +  FH
Sbjct: 1179 IEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKR-FH 1237

Query: 1105 FIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            ++ LV++D NM+ KA  Q I+TFS+ F+F++C+++G++   CTN
Sbjct: 1238 YVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/981 (54%), Positives = 706/981 (71%), Gaps = 53/981 (5%)

Query: 206  TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265
             + +TS+ L++KLQ+IY+ IVKQE+ELQ+RCSQLT SQTT+LKNLW IYK+NT+LINNY+
Sbjct: 276  VTKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYI 335

Query: 266  AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325
             FITTALLPSQ  QD+ IG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFI
Sbjct: 336  TFITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFI 395

Query: 326  THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385
            THVFIS+S ML D+P K + PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   +
Sbjct: 396  THVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTY 455

Query: 386  GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGN 444
             HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN  GN
Sbjct: 456  SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN 515

Query: 445  QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGE 504
             RNS +++YLKHSEVMLL SFLE+ +LQ+VVL++F ++FG+  N+ + F  Q +F Q   
Sbjct: 516  VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPA 575

Query: 505  RTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTS 564
              +++FRHAPAFAESHILQ+VGFGNPKNPFALLF+LP FLKERK++KE+ KSKSS   ++
Sbjct: 576  SLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEIST 635

Query: 565  MEAPSPTS--PI--------------EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSI 608
            M   +  S  PI              EY +++DS R   + P ++ +W +SL H+N TS+
Sbjct: 636  MSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSL 694

Query: 609  KCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNS 668
            KCS +VL+KFL GPL+ A  H+LPW YF+++  ++     +     FW  + R++ PWN+
Sbjct: 695  KCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNT 754

Query: 669  IVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVD-VRTLVDHFSQNEDLPEVWKCWGALWF 727
            + +FLN+++A+ LDN ++T SI  LCE + + +    L+D+F++NE+LPE+WKCWG LWF
Sbjct: 755  LTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWF 814

Query: 728  DVISDKSDVVDEGATYN--SVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGI 785
            DVIS+K  +     T+N   ++DHMF D P+DGI FDE DETG  FW RA R+VF+FKGI
Sbjct: 815  DVISNKRAL--NADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGI 872

Query: 786  AQEFNMGLTLA-SVPLQSRR-SLAAGHPLQNFCFK---FEDPPVDSESYALISTQMPAFE 840
            A+    GL ++ + P+  RR  +   H L++F FK   F++     + ++ I+  +P FE
Sbjct: 873  AENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFE 932

Query: 841  NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP 900
            NI E NLD +A P  S+++G+++FE  GY++L  ++  F++ G L++ S+YT+  ++   
Sbjct: 933  NIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDND- 991

Query: 901  IHGGDDFNTERYSRSDELNK---------ADNPQIKEL----DKMERMWLDTCMNPEFIE 947
             +  ++    +Y+ + ++ +           N Q++      D  +    +  MNPE + 
Sbjct: 992  -NSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLN 1050

Query: 948  QTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRF 1007
            +  D    +   +   +  ++YFV DATSWLRHFAH+YKL+TN VL FA+CLTTFQELRF
Sbjct: 1051 KNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRF 1110

Query: 1008 LRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDE 1067
            LRKSKDE+VV AA RA+IT+RQLYSE +LLPLRFTGNVAT +EEHLEFEEQITWRSHVDE
Sbjct: 1111 LRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDE 1170

Query: 1068 FVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTF 1127
            FVIEAV KAQNKF + N             T  + F+ + LV+DD NM+ KA  Q I+TF
Sbjct: 1171 FVIEAVVKAQNKFISANESV----------TLRKGFNHVVLVTDDINMKRKAQEQGIKTF 1220

Query: 1128 SSRFMFAVCNQIGLAHHACTN 1148
            ++ F+F+VC ++G+  + CTN
Sbjct: 1221 TTHFIFSVCRKLGIQDNVCTN 1241

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/975 (53%), Positives = 698/975 (71%), Gaps = 66/975 (6%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P+      ++SQALVQKLQDIY+ I+KQEVELQERCSQLT+SQTT++KNLW+IYK+N +
Sbjct: 304  VPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNAD 363

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LINNYV FITTAL PSQ + DLLIG+EIV+IY+IERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 364  LINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPE 423

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VCCQFITHVFISIS+ML D+PQK+A PWL++LGDLSRMA+AL+PSGFIDWKLSAE WY  
Sbjct: 424  VCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMA 483

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            A+ + +G+GKLYYHMSTVQQNTLEAFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+
Sbjct: 484  AMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFAD 543

Query: 440  RN-GGNQRN-SLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI--SSNNTDYFSH 495
            RN   N RN  L+V+YLKHSEVMLL +F+ESP+LQ+VVL +F  KFGI  ++NN   F  
Sbjct: 544  RNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP 603

Query: 496  QAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRK 555
            + +F+Q+ ++ K++FRHA AFAE+ ILQ+VG+GNPKNPFALLF LPK+LKER+++KE+RK
Sbjct: 604  RQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK 663

Query: 556  SK--------SSNSFTS---------MEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQ 598
             K        SS +F+S         ME        ++  ++D        P  +++W  
Sbjct: 664  PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWND 723

Query: 599  SLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIA 658
            SL + N T+ KCS +VLQKFL+GPL+ A  H+LPW YFL+S+A++I++     + +FW A
Sbjct: 724  SLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYA 783

Query: 659  LCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEV 718
              +++FPWNS+V FLN+++A+ +DN W  S ++ LC+Q+ S+++  L+ +F+ NEDLPEV
Sbjct: 784  FIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEV 843

Query: 719  WKCWGALWFDVISDKSDVVD-EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACR 777
            WKC G+LWFD+I +K +  + +  T   ++D+ F D PVDGI FDE+DE G +FWKR+ R
Sbjct: 844  WKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVR 903

Query: 778  LVFIFKGIAQEFNMGLTLA---SVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALIST 834
            ++F+F+GI + FN    LA   + P+ +RR L     L  + FK       S+       
Sbjct: 904  VIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLM---AKSDDIMFDDM 960

Query: 835  QMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSG 894
             +  FE I   N D NA P  SM+ G+++FE  GY+++HAD+  F+K G LI+ S Y + 
Sbjct: 961  LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020

Query: 895  SLEKGP-IHGG---------DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPE 944
            S+ +   ++GG         +  +++  +  +  NK  +P   E D ++  W     N E
Sbjct: 1021 SINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDP---EYDSVDEFW-----NKE 1072

Query: 945  FIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQE 1004
              +   D+   FG +    D   +YF+ DATSWLRHFAHVYK+ATN +L+F+ICLTTFQE
Sbjct: 1073 IYD---DIGRKFG-MELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQE 1125

Query: 1005 LRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSH 1064
            LRFLRKSKDE+VVEAATRA+IT+RQL+SE +LLPLRFTGNVATH+EEHLEFEEQITWRSH
Sbjct: 1126 LRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSH 1185

Query: 1065 VDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRI 1124
            VDEFVIEAV KA+ K +       +G               I LV+DD+NM+ KA  +  
Sbjct: 1186 VDEFVIEAVIKAETKRKEQEMHNMKGFQ-------------IVLVTDDSNMKNKALEKGS 1232

Query: 1125 RTFSSRFMFAVCNQI 1139
            +TFS+RF+FA+ N +
Sbjct: 1233 KTFSTRFVFAISNYL 1247

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/981 (52%), Positives = 685/981 (69%), Gaps = 68/981 (6%)

Query: 197  NENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKV 256
            +EN       + ++  AL+QKLQ++YR IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+
Sbjct: 239  DENDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKI 298

Query: 257  NTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFM 316
            NTEL+NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFM
Sbjct: 299  NTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFM 358

Query: 317  DPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHW 376
            DPEVCCQFITHVFIS+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHW
Sbjct: 359  DPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHW 418

Query: 377  YTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRA 436
            YT+A+ + + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRA
Sbjct: 419  YTEAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRA 478

Query: 437  FAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQ 496
            F ERN GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ +
Sbjct: 479  FVERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCE 538

Query: 497  AIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS 556
             +F+Q+ +  KYFFRH P+FA+SHILQ+VGFG PKNPFA+LFELPK+LKERK++KER+K+
Sbjct: 539  DMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKT 598

Query: 557  KSSNSFTSMEAPSPTS---------PIEYLESVDSPRFVYEFPTDL-------------- 593
             S+N  +  E+ +  S          +    S+  P  + EF  D+              
Sbjct: 599  -SNNDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTN 657

Query: 594  AIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELK 653
              W ++L  +N TS+KC  +VL+KFLHGPL  A  H+LPW YF++S+ ++ ++L  P  K
Sbjct: 658  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISK 717

Query: 654  DFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNE 713
            +FWI + +++FPW+++V F+N++IA+ LDN    S I +LC ++  +++  L++ F++NE
Sbjct: 718  EFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENE 777

Query: 714  DLPEVWKCWGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSR 770
            DLPE+W CWG LWFD I  K   S   ++      ++D+M  D P DGI FD+ DE G +
Sbjct: 778  DLPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEK 837

Query: 771  FWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYA 830
            FWKRACR++F+F+ +++ F +G+ +   PL +  SL + + L++  +K E       S  
Sbjct: 838  FWKRACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVP 897

Query: 831  LISTQMPAF---ENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLIT 887
            ++ST    F   E  SE N D +A P  S++ G ++F   GY++L  D+TCF+K G  ++
Sbjct: 898  VLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLS 957

Query: 888  CSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIE 947
             SLYTS  +         + N    +     N+ +N         E ++L+ CM     E
Sbjct: 958  ASLYTSWYVP--------NCNNNLETNISYANEREN---------EALFLE-CMKSVHPE 999

Query: 948  QTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRF 1007
              Y             D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQELRF
Sbjct: 1000 IAYP----------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRF 1049

Query: 1008 LRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDE 1067
            LRKSKDE+V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDE
Sbjct: 1050 LRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1109

Query: 1068 FVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTF 1127
            FVIE++ KAQ K E     AK+      P      F+++ L+SDD  M+ KA  ++IRT 
Sbjct: 1110 FVIESIMKAQEKLE----NAKQ------PNISSHRFNYVVLISDDDTMKKKAEEKKIRTL 1159

Query: 1128 SSRFMFAVCNQIGLAHHACTN 1148
            S+RF+F++C ++G   H CT+
Sbjct: 1160 STRFVFSLCTKLGEQRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/973 (52%), Positives = 671/973 (68%), Gaps = 81/973 (8%)

Query: 209  QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
            ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTEL+NNYV FI
Sbjct: 263  KSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFI 322

Query: 269  TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
            TTALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHV
Sbjct: 323  TTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 382

Query: 329  FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
            F+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +++ HG
Sbjct: 383  FVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHG 442

Query: 389  KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNS 448
            KLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN RNS
Sbjct: 443  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNS 502

Query: 449  LMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKY 508
            L++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  KY
Sbjct: 503  LLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKY 562

Query: 509  FFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKE---------------------- 546
            FFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK LKE                      
Sbjct: 563  FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESST 622

Query: 547  ---RKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPR--FVYEFPTDLAIWQQSLS 601
               R E  +  +  SS +  S       S IE+   +D+ R   V    T+ A W +SL 
Sbjct: 623  SNSRNENDDNDEIMSSTTSISER----DSLIEFFNDIDTLRRPIVSSMLTNEA-WLESLK 677

Query: 602  HINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCR 661
             +N TS+KC  +VL+KFLHGPL  A  H LPW YF++S+ ++  +L  P  K+FWI + +
Sbjct: 678  FLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVK 737

Query: 662  QVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKC 721
            ++FPW+++V F+N++IA  LDN   +  I +LC+++  +++  L+D F + E+LPE+W C
Sbjct: 738  RIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGC 797

Query: 722  WGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778
            WG LWFD I  K   S   D+      ++D+M  D P+DGI FD +DE G +FWKRACR 
Sbjct: 798  WGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRT 857

Query: 779  VFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ--- 835
            +F+F+ +++ F +G+ + +    +R SL + + L N  +K E       S   ++T    
Sbjct: 858  IFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGI 917

Query: 836  MPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS 895
            +  FE  SE N+D +A P  S+++G S+F   GY++L  ++TCF+K G  ++ SLYTS  
Sbjct: 918  IDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWY 977

Query: 896  LEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFP 955
            +  G  +   + N+          K +  Q  E           C+  +  E        
Sbjct: 978  VPNGSNNPETNINSN-------CEKENEGQFLE-----------CLKSDDRE-------- 1011

Query: 956  FGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDES 1015
                    D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 1012 -------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064

Query: 1016 VVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1075
            V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ K
Sbjct: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124

Query: 1076 AQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAV 1135
            AQ K E  N          +P +    F+++ L+SDD  M+ KA  ++I+T S+RF+F++
Sbjct: 1125 AQEKLENANQ---------LPVSSCR-FNYVILISDDDTMKKKAEEKKIKTLSTRFVFSL 1174

Query: 1136 CNQIGLAHHACTN 1148
            C ++G   H CT+
Sbjct: 1175 CTKLGEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1001 bits (2587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/982 (52%), Positives = 683/982 (69%), Gaps = 77/982 (7%)

Query: 198  ENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVN 257
            E+       S ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++N
Sbjct: 253  EDDACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRIN 312

Query: 258  TELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMD 317
            TELINNYV FITTALLPSQP  DLLIGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMD
Sbjct: 313  TELINNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMD 372

Query: 318  PEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY 377
            PEVCCQFITHVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWY
Sbjct: 373  PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY 432

Query: 378  TQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF 437
            T+A+ +I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF
Sbjct: 433  TEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAF 492

Query: 438  AERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQA 497
             ERN GN RNSL++EYLKHSE MLL SFLESP+LQ VV+S+F  KFGI +N  + F+ + 
Sbjct: 493  VERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPED 552

Query: 498  IFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSK 557
            +F+Q+ +  KYFFRHAP+FA+SHILQ+VGFG PKNPFA+LFELPK+LKERK++KER+KS 
Sbjct: 553  MFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSS 612

Query: 558  SSNSFTS--------------MEAPSPTSPI-------EYLESVDSPRFVYEFPTDLA-- 594
            +++S  +               E  S T+ I       E+   +D+ R     P+ L   
Sbjct: 613  NNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSE 671

Query: 595  IWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKD 654
             W ++L  +N TS+KC  +VL+KFLHGPL  A  H+LPW YF+++  ++ ++L  P  KD
Sbjct: 672  AWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKD 731

Query: 655  FWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNED 714
            FW+ + ++VFPW++IV F+N++IA+ LDN      I  LC ++ ++++  L++ F+++E+
Sbjct: 732  FWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEE 791

Query: 715  LPEVWKCWGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRF 771
            LPE+W CWG LWFD I  K   S   D+      ++D+M  D P DGI FD+ DE+G +F
Sbjct: 792  LPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKF 851

Query: 772  WKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYAL 831
            WKRACR++F+F+ +++ F +G+ +++ PL    S  +   L+N  +K E P  +  S   
Sbjct: 852  WKRACRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE-PLSNIRSNTP 910

Query: 832  ISTQMPAFENISE----RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLIT 887
            I T +    +ISE     N+D  A P  S+  G ++F   GY++L  D+TCF++ G  ++
Sbjct: 911  ILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLS 970

Query: 888  CSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIE 947
             SLYT   L  G        N      + ++ K D          E ++L+ CM P+   
Sbjct: 971  ASLYTRWYLPNGN-------NISEALVNSDIEKGD----------EDLFLE-CMKPD--- 1009

Query: 948  QTYDMKFPFGDLSC-NCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELR 1006
                         C   D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELR
Sbjct: 1010 -------------CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELR 1056

Query: 1007 FLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVD 1066
            FLRKSKDE+V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVD
Sbjct: 1057 FLRKSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVD 1116

Query: 1067 EFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRT 1126
            EFVIE++ KAQ K E         G    P       +++ L+SDD  M+ KA  + I+T
Sbjct: 1117 EFVIESIKKAQEKLE-------NAGQ---PHVTPRHSNYVVLISDDDTMKKKAEEKEIKT 1166

Query: 1127 FSSRFMFAVCNQIGLAHHACTN 1148
             S++F+F++C ++G   H CT+
Sbjct: 1167 LSTKFVFSLCTKLGEKRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  996 bits (2575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/984 (52%), Positives = 680/984 (69%), Gaps = 80/984 (8%)

Query: 198  ENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVN 257
            EN      ++ ++  AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+N
Sbjct: 259  ENDSCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKIN 318

Query: 258  TELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMD 317
            T+L+NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMD
Sbjct: 319  TDLVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMD 378

Query: 318  PEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWY 377
            PEVCCQFITHVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWY
Sbjct: 379  PEVCCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWY 438

Query: 378  TQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF 437
            T+A+ +I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF
Sbjct: 439  TEAMKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAF 498

Query: 438  AERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQA 497
             ERN GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + 
Sbjct: 499  VERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAED 558

Query: 498  IFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSK 557
            +F+Q+ +  KYFFRH P+FA+SHILQ+VGFG PKNPFA+LFELPK+LKERK++KER+KS 
Sbjct: 559  MFVQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSS 618

Query: 558  SSNSFTSM--------------EAPSPTSPI-------EYLESVDSPRFVYEFPTDLA-- 594
            +++S  +               E  S T+ I       E+   +D+ R     P+ L   
Sbjct: 619  NNDSSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNE 677

Query: 595  IWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKD 654
             W ++L  +N TS+KC  +VL+KFLHGPL  A  H+LPW YF++S+ ++  +L  P  K+
Sbjct: 678  AWLETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKE 737

Query: 655  FWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNED 714
            FW+ + ++ FPW+++V F+N++I + LDN    S I +LC+ +D + +  L++ F++ E+
Sbjct: 738  FWMIIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEE 797

Query: 715  LPEVWKCWGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRF 771
            LPE+  CWG LWFD I +K   S   ++      ++D+M  D P DGI FDE DE G +F
Sbjct: 798  LPEILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKF 857

Query: 772  WKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFE-------DPPV 824
            WKRACR +F+F+ +++ F +G+ + + PL  R S    + L +  FK E       + PV
Sbjct: 858  WKRACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPV 917

Query: 825  DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGT 884
                 ++I       E  SE N D +A P  S+ EG ++F   GY++L AD+TCF+K G 
Sbjct: 918  LGALESIIDIS----EARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGE 973

Query: 885  LITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPE 944
             ++ SLYT                T     S+  N  DN       + E ++L+ C+  +
Sbjct: 974  FLSASLYT----------------TWYVPNSNNTNIEDNINYNSEKENEGLFLE-CIKSD 1016

Query: 945  FIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQE 1004
            + E                D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQE
Sbjct: 1017 YPE---------------IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQE 1061

Query: 1005 LRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSH 1064
            LRFLRKSKDE+V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+H
Sbjct: 1062 LRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTH 1121

Query: 1065 VDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRI 1124
            VDEFVIE+V KAQ K E+    A E      P      F+++ L+SDD  M+ KA  + I
Sbjct: 1122 VDEFVIESVMKAQEKLES----ASE------PRLSPRRFNYVVLISDDDAMKKKAEEKEI 1171

Query: 1125 RTFSSRFMFAVCNQIGLAHHACTN 1148
            +T S+RF+F++C ++G   H CT+
Sbjct: 1172 KTLSTRFVFSLCTKLGEQRHLCTD 1195

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/1043 (51%), Positives = 687/1043 (65%), Gaps = 121/1043 (11%)

Query: 209  QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
            +T +ALV+KLQDIY+ IVKQE+ELQERCSQLT SQTTDLKNLW IYKVN +LINNYV FI
Sbjct: 295  KTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFI 354

Query: 269  TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
            TTALL SQ +QDL IG+EI+ IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHV
Sbjct: 355  TTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 414

Query: 329  FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
            FIS+S ML D+P K++ PWL+RLGDLSRMAIALYPSGFIDWKLSAE WY +A+   + HG
Sbjct: 415  FISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHG 474

Query: 389  KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNS 448
            KLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN RN 
Sbjct: 475  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNL 534

Query: 449  LMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI----------------SSNNT-- 490
             ++EYLKHSEVMLL +FLE+ ELQ+VVL +FQ KFGI                 +NNT  
Sbjct: 535  QLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594

Query: 491  -DYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERK- 548
             D F  + +F+Q+ E+ KYFFRHAPAFAESHILQ+VGFG+PKNPFALLFELPK+LKERK 
Sbjct: 595  IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERKD 654

Query: 549  ------------------------------ERKERRKSKSSNSFTSMEAPSPTSPIEYLE 578
                                          +  E  +   +N F+       TS  E+ +
Sbjct: 655  KKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSE-EFFQ 713

Query: 579  SVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLL 638
            +++  RF Y  P  L IW  SL+HIN  S+KCS +VL+KFLHGPL+ A  HLLPW YF++
Sbjct: 714  NIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFII 773

Query: 639  SLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDN-AWKTSS-------- 689
            S+ ++ + L   + K FWI + + +FPWN I+NFLN+++ + LDN    T S        
Sbjct: 774  SILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQK 833

Query: 690  -----IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYN 744
                 I +LC ++ ++    L+ HF++NEDLPEVWKCWG LWFD IS+K+ +  +     
Sbjct: 834  DMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENL 893

Query: 745  SVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN-MGLTLASVPLQSR 803
             ++DHMF D P+DGI +  +DETG  FWKR  R++F+FKGIA+ F+ +GL ++       
Sbjct: 894  GIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEY 953

Query: 804  RS--LAAGHPLQNFCFKFEDPPVDSESYAL----------ISTQMPAF----ENISERNL 847
            R+  +   + L+ F FK+     D     L          I  ++  F    E I E NL
Sbjct: 954  RNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNL 1013

Query: 848  DPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI------ 901
            +   PP +SM+  + +F+  GY++L  +   F+K G   + S+YT+  ++   +      
Sbjct: 1014 NFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLILAQNN 1073

Query: 902  ---HGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGD 958
                   D  T+ ++ +  +++    Q+K  +  ++  L +  + E          PF  
Sbjct: 1074 NNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTE----------PFNR 1123

Query: 959  LSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVE 1018
                     +YFV DATSWLRHFAH+YKLA+N VL+FA+CLTTFQELRFLRKSKD +VVE
Sbjct: 1124 YK-------TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVE 1176

Query: 1019 AATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQN 1078
            A+TRA+IT+RQLYS+  LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEAV KAQ 
Sbjct: 1177 ASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQE 1236

Query: 1079 KF------EALNAQAKEGGHDFIPTT----EEEP---FHFIALVSDDTNMRLKAHAQRIR 1125
            KF      E +   +  G  D   TT    EEE    F ++ L++DD +MR+KA  + I 
Sbjct: 1237 KFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGIS 1296

Query: 1126 TFSSRFMFAVCNQIGLAHHACTN 1148
            TF ++ +F+VC+ +G+    CTN
Sbjct: 1297 TFGTQVVFSVCSMMGIDEGVCTN 1319

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1032 (46%), Positives = 682/1032 (66%), Gaps = 106/1032 (10%)

Query: 206  TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265
            T ++++QAL+ KLQDIY++I+ QEVELQ  CS +T SQTTDLK +W +YK+N EL+NNYV
Sbjct: 268  TWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYV 327

Query: 266  AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325
             FITTALLPSQ + DLLIGQEI+++Y+IERRLWV+GTITFLDVLK+FSNFMDPE+CCQFI
Sbjct: 328  IFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFI 387

Query: 326  THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385
             HVFISI+NM   +P+KF+ PW  RLGDLSRMA ALYP G  DWKLSAE+WY +A+ + +
Sbjct: 388  IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTY 447

Query: 386  GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQ 445
            G GKLYYHM+TVQQN+L AF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R   + 
Sbjct: 448  GVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS 507

Query: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505
             N  +++YLKH+E+M+L +F+E+ ELQ++   +F  KFG      ++F  +++F+Q+ E 
Sbjct: 508  SNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLES 567

Query: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSM 565
             K++FRH+P FA++HILQ+VG+GN  N FALL+ELPKF+K+ +  ++R+KSK+     S+
Sbjct: 568  VKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSI 627

Query: 566  EAPS---PTSPI----EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKF 618
            +  S     + I    EY  S+++    +  P ++ IW QSL + NTT I C  +VLQKF
Sbjct: 628  DTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKF 687

Query: 619  LHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIA 678
            L GP V+A  HLLPW YFL+S+A +I+ L     + FW    R++FPWN+I+NFLN++IA
Sbjct: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747

Query: 679  FALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVD 738
            F  DN+   S ++ LCE +  + +  ++ +FS+NE+LPEVW CWG+LWFD I +KS+   
Sbjct: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807

Query: 739  EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASV 798
             G     ++D  F D P DGI FDE+D+ G++FWKRACR++F+FKG A++F+ GL L ++
Sbjct: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNI 867

Query: 799  ------------PLQSRRSLAAGHPLQNFCFKFEDP-----PVDSES------YALISTQ 835
                          Q +R++       +F FKF DP     P+D  S      Y+L + +
Sbjct: 868  NSLNSEEENIFTKKQEKRNI-------DFLFKF-DPTYDLLPIDEASNKYFQVYSLFTEK 919

Query: 836  MPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTS-- 893
            +PAFE+ISE N+  +A P  S+++G+S+F+  GY++L   +  ++K G +   ++Y++  
Sbjct: 920  LPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWE 979

Query: 894  -----GSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKE-------------------L 929
                 G+  K  +  G  F        D L+ + N +I+E                   L
Sbjct: 980  AFNQLGNGLKPRMENGSSFII------DGLDDSKNFEIREKRLFAKYLECDESQESSDHL 1033

Query: 930  DKMER-----MWLDTCMNPEFIEQTY----DMKFPFGDLSCNCDSGV----SYFVPDATS 976
             ++ER            N   +++ Y    D+   F  +  N +  V    +YF+ DAT+
Sbjct: 1034 AEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATT 1093

Query: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036
            WLRHFAH+YK+A +G+L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  K++
Sbjct: 1094 WLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKV 1153

Query: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK--------------FEA 1082
            +PLRF G +A+H+EEHLEFEEQITWRSHV+EFVIEAV K+Q                F+A
Sbjct: 1154 IPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDA 1213

Query: 1083 LN------AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVC 1136
             N      A  K+ G+    T  +       LV+DD NM  KA  + IRT S+RF+F++C
Sbjct: 1214 ENMDTADSADTKQRGNSNASTNSKV---LSVLVTDDRNMDSKAKERGIRTCSTRFIFSIC 1270

Query: 1137 NQIGLAHHACTN 1148
            +Q+G+ +  CTN
Sbjct: 1271 SQLGMKYGICTN 1282

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/998 (49%), Positives = 672/998 (67%), Gaps = 79/998 (7%)

Query: 201  PAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTEL 260
            P+      ++SQ LVQKLQDIY+ IVKQE+ELQERC +LT+SQTT+LKNLW IY+VN+EL
Sbjct: 371  PSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSEL 430

Query: 261  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 320
            ++NY+ FITTA+ P+QPE D  IG+EI+ IY+IERRLWV+GTITFLD+LKNFSNFMDPEV
Sbjct: 431  VDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEV 490

Query: 321  CCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQA 380
            CCQFI HVFISISNML D+PQK+   W ++LGDLSRMAIALYPS FIDWKLSAE WY  A
Sbjct: 491  CCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAA 550

Query: 381  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 440
            +   +GHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+ 
Sbjct: 551  MEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADS 610

Query: 441  NGGN--QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNT--DYFSHQ 496
            N  N  + + L+V+Y+KH EV LL +F ES ELQ+VVL +F +KFG+  NN+  + F  +
Sbjct: 611  NNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISR 670

Query: 497  AIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKS 556
             +F+Q+ ++ K F+R++ AFAES ILQ+VG+GN K+PF+LLFELPK+LK+RKE+KE+RK 
Sbjct: 671  KMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKP 730

Query: 557  KSSNSFTSMEAPS----------PTSPI--------EYLESVDSPRFVYEFPTDLAIWQQ 598
            K+      +  P           PT P         E+ E++D+  +    P  + IW  
Sbjct: 731  KTM-LILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNH 789

Query: 599  SLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIA 658
            SL + N  SIKCS +V +KFLH P + A  H LPW YF++S+ +++D+  +  + +FW+ 
Sbjct: 790  SLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVE 849

Query: 659  LCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEV 718
              R++FPWNSIV FLN+++A+ +DN W+ S ++ LC  ++S+ +  L+ +F++NE+LPEV
Sbjct: 850  FVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEV 909

Query: 719  WKCWGALWFDVISDKSDV-------VDEGATY-------NSVQDHMFGDMPVDGICFDED 764
            WKC G+LWFD I +KS++       V  G+ +       N V+D+ F D P+DG  FDE 
Sbjct: 910  WKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDES 969

Query: 765  DETGSRFWKRACRLVFIFKGIAQEFN--MGLTLA-SVPLQSRRS-----LAAGHPLQNFC 816
            DE G RFWKRA R++F+FK +A+ +    GL L+   P+ +RR            L  F 
Sbjct: 970  DEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFS 1029

Query: 817  FKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADH 876
            FK       S    ++   + +FE   E N D +  P  SM++G S+F+  GY+++  + 
Sbjct: 1030 FKLN----ASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNF 1085

Query: 877  TCFNKTGTLITCSLYTSGS-------LEKGPIHGGDDFNTERYSRSDELNKADNPQIKEL 929
              F+K G  I+ S + S S       L +       D      S +D    + N      
Sbjct: 1086 YSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNN----- 1140

Query: 930  DKM-ERMWLDTCMNPEF--IEQTYDMKFPFGDLSCNCD-SGVSYFVPDATSWLRHFAHVY 985
            D M E +  + C +P++  +E+ +  +  + D   N    G +YF+ DATSWLRHFAH+Y
Sbjct: 1141 DPMNELLVFNECFDPKYKTLEEFWSQEI-YPDSQTNISLQGKTYFILDATSWLRHFAHIY 1199

Query: 986  KLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNV 1045
            K+AT+ +L+FAICLTTFQELR+LRKSKD +VVEAATRA+IT+RQLY E  LLPLRFTGNV
Sbjct: 1200 KIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNV 1259

Query: 1046 ATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK----FEALNAQAKEGGHDFIPTTEEE 1101
            ATH+EEHLEFEEQITWRSHVDEFVIEAV KA+ K       +N    E         +E+
Sbjct: 1260 ATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDE---------KEK 1310

Query: 1102 PFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQI 1139
                I LV+DD  M+ KA  ++I+TFS+RF+F++ N I
Sbjct: 1311 SIFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/964 (48%), Positives = 652/964 (67%), Gaps = 67/964 (6%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IYR IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+S+ML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439

Query: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
             N    RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+LPK+LK ++ ++E++KS ++
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSGAT 559

Query: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                  E P    P +       Y +++DS    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 560  ------EVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PLV A  H L W +F++++  +++ + S  +  FWI   R+  PWNS+VN
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVN 673

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
              N+++ + LDN      ++   E+F S+++  L+++F++NE+LPE+WKCWG+LWFD I 
Sbjct: 674  LANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIK 731

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FDE DE G RFW R+ R + I KG+A++F +
Sbjct: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPD 786

Query: 791  MGLTLA-SVPLQSRRS-LAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENISE 844
            +GL +    P+  RR+ ++  + L+NF FK     E+   D+     +   +   E I  
Sbjct: 787  LGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIER 846

Query: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGG 904
             N D  A P  S++ G+++FE  GY +L  D+ CF+K G   +  +Y+  S     +  G
Sbjct: 847  VNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWS----NVGNG 902

Query: 905  DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCD 964
               +    S  D  N   +P        E+++ D                  GD + NC 
Sbjct: 903  MVLDVSSESMYDAANNNLSPH------WEKIFFDRITTAGH----------NGDKNGNCS 946

Query: 965  SGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAV 1024
                YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+V
Sbjct: 947  ---VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSV 1003

Query: 1025 ITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALN 1084
            IT+RQLY EK+++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K    F+   
Sbjct: 1004 ITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQT-- 1061

Query: 1085 AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHH 1144
                      I   + +   +  LV+DD NM  KA  + I+T +++++F++ ++IG+   
Sbjct: 1062 -------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSG 1114

Query: 1145 ACTN 1148
             CTN
Sbjct: 1115 LCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/967 (48%), Positives = 658/967 (68%), Gaps = 73/967 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ G+  
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439

Query: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+LPK+LK +K+++E+++S+++
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEAT 559

Query: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                  E  S T P +       Y +++D+    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 560  ------ETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PLV A  H L W +F++++  +++ + S ++  FWI   R+  PWNSIV 
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVT 673

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
              N+++ + LDN      +    E+F S+++  L++++++NE+LPE+WKCWG LWFD I 
Sbjct: 674  LGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIK 731

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FDE DE G +FW R+ R V + KGIA++F +
Sbjct: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPD 786

Query: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENIS 843
            +GL +   ASV    R  +   + L+N  FK     ED   D+     +   +   E I 
Sbjct: 787  LGLKVSFQASV-FCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEIE 845

Query: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903
              N+DP A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S     +  
Sbjct: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWS----NVGN 901

Query: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963
            G   +    S  D  N  +N  +      E+++ D                   D + NC
Sbjct: 902  GVTLDVSGESIYDVAN--NNLSL----HWEKIFFDKIAAAS----------KGSDENYNC 945

Query: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023
                 YFV DATSWLRHFAH++KLA N  L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 946  ---TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRS 1002

Query: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEA- 1082
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K   +F+A 
Sbjct: 1003 VITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAE 1062

Query: 1083 -LNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGL 1141
             L  + K  G +           F  LV+DD NM  KA  + I+T +++++F++ +++G+
Sbjct: 1063 RLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGI 1111

Query: 1142 AHHACTN 1148
                CTN
Sbjct: 1112 NSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/965 (48%), Positives = 653/965 (67%), Gaps = 69/965 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IYK+NTELI NY+ 
Sbjct: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLK+FSNFMDPEVCCQFIT
Sbjct: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FI ISNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444
             GKLYYH++T+QQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ GN  
Sbjct: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438

Query: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D FS + +F
Sbjct: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559
             Q+ E  +Y+FRHAPAFAES ILQ++GFGNPKNPFALLF+LPK LK +K+++E++KS ++
Sbjct: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGAA 558

Query: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                  E P    P +       Y +++D+    + + PT++ IW  SL++IN TSI+CS
Sbjct: 559  ------EIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCS 612

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PL  A  H L W +F++++  +++ + S ++  FWI   R+  PWNS+V 
Sbjct: 613  IQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVT 672

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
            F N+++ + LDN      ++   E+F S+++  L+++F++NE+LPEVWKCWG+LWFD + 
Sbjct: 673  FSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK 730

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FD+ DE G +FW R+ R +   KGIA++F +
Sbjct: 731  -KCDVMEIPG----VQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPD 785

Query: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENIS 843
            +GL +   ASV    R  ++  + L+N  FK     ED   D+     +   +   E I 
Sbjct: 786  LGLKVNFQASV-FCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844

Query: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903
              N+D  A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +YT  S     +  
Sbjct: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWS----NVGN 900

Query: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963
            G   +    S  D             + +   W             +D  F  G  + + 
Sbjct: 901  GVTLDVSSESLYDSTT----------NDLSLHWAKIL---------FDKVFTIGKNTDDD 941

Query: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023
             S   YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 942  GSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRS 1001

Query: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEAL 1083
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K    F+  
Sbjct: 1002 VITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1061

Query: 1084 NAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAH 1143
                K  G      ++E    F  LV+DD NM  KA  + I+T +++++F++ +++G+  
Sbjct: 1062 RTIDKNKGR-----SKE----FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINS 1112

Query: 1144 HACTN 1148
              CTN
Sbjct: 1113 GLCTN 1117

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/965 (48%), Positives = 651/965 (67%), Gaps = 69/965 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IY +E+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439

Query: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
             N    +NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+NKFG   N  D F  + +F
Sbjct: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+LPK+LK +K+++E+++S ++
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSAT 559

Query: 560  NSFTSMEAP--SPTSPIEYLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCSAVVLQ 616
             +      P     SP  Y +++D+    + + PT+L IW +SL+HIN TSI+CS  VL 
Sbjct: 560  ET-PQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHVLT 618

Query: 617  KFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMI 676
            KFLH P V A  H L W YFL+++  R++ + S ++  FWI   R+  PWNS+V+  N++
Sbjct: 619  KFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLANVL 678

Query: 677  IAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDV 736
            + + LDN      +    E F S ++  L++HF++NE+LPE+WKCWG+LWFD I  K DV
Sbjct: 679  VCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIK-KCDV 735

Query: 737  VDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-NMGLTL 795
            ++       VQDH+F D P+DGI FDE DE G RFW R+ R + + KGIA++F ++GL +
Sbjct: 736  MEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLGLKV 791

Query: 796  A-SVPLQSRRS-LAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENISERNLDP 849
                P+  RR+ +   + L+ F FK     E    D+     +   +   E I   NLD 
Sbjct: 792  NFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINEKIDNVNLDL 851

Query: 850  NAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS-LEKG-PIHGGDDF 907
             A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S +  G PI   D  
Sbjct: 852  RATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI---DVS 908

Query: 908  NTERYSRSDELNKADNPQIKELD-KMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSG 966
            N   Y  +D           +L    E+++ D       I   Y           NCD  
Sbjct: 909  NEPIYDVTD----------NDLSLHWEKIFFDR------IAAAYK----------NCDEN 942

Query: 967  ---VSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023
                 YFV DATSWLRHFAH++KLA N +L FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 943  DNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRS 1002

Query: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEAL 1083
            VIT+RQLY E++++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K    F+  
Sbjct: 1003 VITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQT- 1061

Query: 1084 NAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAH 1143
                       I   + +   F  LV+DD NM  KA  + I+T +++++F++ +++G+  
Sbjct: 1062 --------ERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINS 1113

Query: 1144 HACTN 1148
              CTN
Sbjct: 1114 GLCTN 1118

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/734 (54%), Positives = 530/734 (72%), Gaps = 40/734 (5%)

Query: 181  GRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT 240
            G N   ND  NN+N P              +QALVQKLQDIY+NIV+QEVELQE+C+QLT
Sbjct: 351  GNNSNSNDKANNSNKP--------------TQALVQKLQDIYKNIVRQEVELQEKCAQLT 396

Query: 241  HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH 300
             SQTTDL ++W IY++N EL+ NYV FI+TALL SQ + DL+IGQEIV  YRI RRLWV+
Sbjct: 397  SSQTTDLNSIWSIYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVY 456

Query: 301  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA 360
            GTITFLDVLKNFS+FMDPEVC QFITHVFISIS ML D+P K++ PW++RLGDLSRMAIA
Sbjct: 457  GTITFLDVLKNFSSFMDPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIA 516

Query: 361  LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP 420
            LYPSGFIDWKLS+E+WY QAL + +G+GKLYYHMST+QQNTLEAFVNLGKSVFC+DTFIP
Sbjct: 517  LYPSGFIDWKLSSEYWYNQALKYTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIP 576

Query: 421  SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ 480
            S QYMQLVIDNIYQRAF ER   N RNS ++EYLKHSEVMLL +F+ +  LQKVV+++F+
Sbjct: 577  SPQYMQLVIDNIYQRAFIERGSNNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFE 636

Query: 481  NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFEL 540
            +KFG   ++ + F  + IFLQ+ E  KYFFRHAPAFAESHILQ VGFG+ KNPFALLF+L
Sbjct: 637  HKFGTDLHDLNIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDL 696

Query: 541  PKFLKERKERKERRKSKSSNSFTSMEA---------PSPTSPIEYLESVDSPRFVYEFPT 591
            PKFLKE+K++K+R+K+KSS   TS E+          S  S  +Y  +++S +  Y  P 
Sbjct: 697  PKFLKEKKDKKDRKKTKSSGEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPP 756

Query: 592  DLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPE 651
               IW +SLS++N T+++C  +VL+KFLHGP V A  HL+ W YF++S+ ++ + L   E
Sbjct: 757  RYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEE 816

Query: 652  LKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQ 711
             + FW +  R++ P NSIV+FLN++IA+ALDN++ ++ I ++ E+ DS+D++ L+  F+ 
Sbjct: 817  SRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNN 876

Query: 712  NEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRF 771
            NE+LPEVWKCWG LWFD I+DKS+          V DH+F D P+DGI FD  DE G +F
Sbjct: 877  NEELPEVWKCWGTLWFDAITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKF 936

Query: 772  WKRACRLVFIFKGIAQEFNMGLTLA-SVPLQSRR-SLAAGHPLQNFCFKFEDPPVDSESY 829
            WKRA R++F+FK IA+ F++G+TL+ + P+  RR  +   H L +F FK E   ++  + 
Sbjct: 937  WKRALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTV 996

Query: 830  ---------ALIS-TQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCF 879
                     A+I  T+MP     +E N+  +A P  S+ E +++FE  GY+++  +   F
Sbjct: 997  QVEIENCLGAIIEMTEMP-----NEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNF 1051

Query: 880  NKTGTLITCSLYTS 893
            +K G L + + YTS
Sbjct: 1052 DKNGELRSAANYTS 1065

 Score =  219 bits (559), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 137/179 (76%), Gaps = 10/179 (5%)

Query: 970  FVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQ 1029
            FV DATSWLRH AH+YKLA+N  L F+ICLTTFQELRFLRKSKDE+V+EAA RA+I +RQ
Sbjct: 1127 FVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQ 1186

Query: 1030 LYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKE 1089
            LYS+ +++PLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIE++ KAQ KF         
Sbjct: 1187 LYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF--------- 1237

Query: 1090 GGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
                F+    +    F  LVSDD NM+ KAH + IRTF++RF+FA+C+++G     CTN
Sbjct: 1238 -LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  499 bits (1285), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 251/382 (65%), Positives = 294/382 (76%), Gaps = 43/382 (11%)

Query: 206 TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265
           T+  +SQAL+QKLQDIY+ IVKQE++LQ+RCSQLT SQTTDLKNLW IYK+N +LINNY+
Sbjct: 390 TTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYI 449

Query: 266 AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325
            FIT ALLP+Q + DL IG+EI+ IYRIERRLWV+GTITFLDVLK+FSNFMDPEVCCQFI
Sbjct: 450 NFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFI 509

Query: 326 THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385
           +HVFI+IS +L D+P K++  WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   +
Sbjct: 510 SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTY 569

Query: 386 GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQ 445
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN 
Sbjct: 570 SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH 629

Query: 446 RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI-------------------- 485
           RN  ++EYLKH+EVMLL +FLES +LQ VVL +FQ KFGI                    
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 486 -----------------------SSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHIL 522
                                  S    D F +Q +F+Q+ +  KYFFRH+  FA+SHIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 523 QMVGFGNPKNPFALLFELPKFL 544
           Q+VGFG+PKNPFALLFELPKFL
Sbjct: 750 QLVGFGDPKNPFALLFELPKFL 771

 Score =  379 bits (974), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/590 (38%), Positives = 333/590 (56%), Gaps = 85/590 (14%)

Query: 575  EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWA 634
            E+ E++D  +F Y+ P  + IW +SL +IN  S+KCS +VL+KFL+GP++ A  HLL W 
Sbjct: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926

Query: 635  YFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTS----- 688
            +F++S+ ++I+  +   + K FW +  + + PWNSIVNFLN+++ + LDN    +     
Sbjct: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986

Query: 689  SIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKS-------------- 734
            S+ N      S  +  ++  F+QNE+LPE+WKCWG LWFDVI +K+              
Sbjct: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046

Query: 735  --------------DVVDEGATYNS--VQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778
                          D  D   T  +  ++DH   D P+DGI F  +DE G  F+KR+ RL
Sbjct: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106

Query: 779  VFIFKGIAQEF-NMGLTLASVPLQSRRS--LAAGHPLQNFCFKFE---DPPV-------- 824
            +F+ K + + F N+GL ++       R+  +     L NF FK     DP +        
Sbjct: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQ 1166

Query: 825  -----------DSE-SYALISTQMPAF---ENISERNLDPNAPPGQSMLEG-KSLFELPG 868
                       D E + +++S  M  F   E I E NL+    P  S+L G +++F   G
Sbjct: 1167 NIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226

Query: 869  YRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI-----------HGGDDFNTERYSRSDE 917
            Y++L+ +   F++ G +I+ S+Y+S  ++               H  +D   +  + +  
Sbjct: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVG 1286

Query: 918  LNKADNPQIKELDKME-RMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATS 976
                ++   KE  K+   + L T  N    + T+ M         + +   ++FV DATS
Sbjct: 1287 DITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM-------GVSINKHRTFFVFDATS 1339

Query: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036
            WLRHFAH+YKL+ NG L+FA+CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY E +L
Sbjct: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399

Query: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQ 1086
            LPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q +F+  + Q
Sbjct: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  454 bits (1168), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/426 (54%), Positives = 289/426 (67%), Gaps = 79/426 (18%)

Query: 209 QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
           +++Q L+QKLQ+IY+ IV QE+ELQ++C++L+ SQ+T LK LW IYK+N +LINNY+ FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 269 TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
            T+L PSQ   D LIG+EI+ IY+IERRLW++GTITFLD+LKNF+NFMDPE+  QFITHV
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 329 FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
           F SISNM+ D+P  F  PW +RLGDLSRMAIALYPS FIDWKLS+E+WY +++   F HG
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 389 KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------- 441
           KLYYH+STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ERN       
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 442 ----------------GGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFG- 484
                             N +   ++EYLKHSEVMLL +FLE+  L+ VVL++F N FG 
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 485 --ISSNNTD-------------------------------------------------YF 493
             I SN +D                                                  F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 494 SHQAIFLQ-DGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKE 552
           + + IF Q + +  KYFF+++  FAESHILQ++GFG+PKNPFALLF+LPK+L   KERK 
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL---KERKT 680

Query: 553 RRKSKS 558
           +RKSK+
Sbjct: 681 KRKSKA 686

 Score =  271 bits (694), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 210/360 (58%), Gaps = 60/360 (16%)

Query: 825  DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGT 884
            DS +   I T +P FE  S +N D N  PG S++E +SLFE  GY++   D + F+K G 
Sbjct: 1137 DSNTERNIDTWIP-FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGE 1195

Query: 885  LITCSLYTS-------GSLEKGPI-----HGGDDFNTERYSRS------DELNKADNPQI 926
            LI+ SLYTS       GS     I     +  D+ N +  + +      +  N   N   
Sbjct: 1196 LISTSLYTSTIIDTINGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDN 1255

Query: 927  KELDKMERMWLDTCMNPEFI--------EQTYDMKFPFGDLSCNCDSGVSYFVPDATSWL 978
            KEL  ME+   +  ++P++         E  +D    F D         +YFV DATSWL
Sbjct: 1256 KELFLMEKEIFNKILDPDYKNIDEIWRGEMFHDTSIQFSD---------TYFVLDATSWL 1306

Query: 979  RHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLP 1038
            RHFAHVYKLATNG+L+FAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLYSEKRLLP
Sbjct: 1307 RHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLP 1366

Query: 1039 LRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTT 1098
            LRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIEA+ +AQ     L  +      D   T+
Sbjct: 1367 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQ-----LKRRDNRNQEDSNVTS 1421

Query: 1099 EEEPFH---------------FIALVSDDTNMRLKAHAQR----IRTFSSRFMFAVCNQI 1139
                                    LV+DD +M  K   ++    I TFS++F+F++CN +
Sbjct: 1422 SNNNPIINNNENNGNLNVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  229 bits (584), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 167/254 (65%), Gaps = 6/254 (2%)

Query: 572  SPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLL 631
            SP ++  +++S +  +  P  L IW +SL +IN  S+ CS +VL+KFL+GPL  +  H+L
Sbjct: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846

Query: 632  PWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSID 691
            PW+YF++SLA+RI+ L + E + FW+   R++FPWNSIV++LN+II+  LDN ++ S I 
Sbjct: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906

Query: 692  NLCEQFDSVDVRTLVDHFSQNE-DLPEVWKCWGALWFDVISDKSDVVDEGATYN-SVQDH 749
             L   + + ++  L+  F++NE +LPEVWKC+G+LWFDVI++   +     + N S++D 
Sbjct: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966

Query: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN--MGLTLASVP--LQSRRS 805
               + P+DG+ FDE +E G+ FWKR+CRL+F+FK +   FN   GLT++S      +R  
Sbjct: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSD 1026

Query: 806  LAAGHPLQNFCFKF 819
            +   H L+ F FK 
Sbjct: 1027 IPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score =  140 bits (353), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 123/580 (21%), Positives = 254/580 (43%), Gaps = 96/580 (16%)

Query: 253 IYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNF 312
           ++K++T++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  H     L++++N+
Sbjct: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206

Query: 313 SNFM----------DPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALY 362
            N M          + +   +FI    I I++ML ++P KF   W   +GDL+R+ + L 
Sbjct: 207 KNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266

Query: 363 PSGFIDWKLSAEHWY-----TQALSHIFGHGK----------LYYHMSTVQQNTLEAFVN 407
                 ++L++ H Y       A+++   +GK           Y+++S VQ ++L   V 
Sbjct: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326

Query: 408 LGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR---NSLMVEYLKHSEVMLLSS 464
           L K +   +T +  +   QL ID I  +   ++    Q     +++++Y       LLS 
Sbjct: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYFT-----LLSL 381

Query: 465 FLESPE------LQKVVLSFFQNKFGISSNNTDYFSHQAIFL--------QDGERTKYFF 510
           F  S        +++  L +F N+F     N  + ++ ++          ++   + ++F
Sbjct: 382 FFGSTSSSQLSGMERSSLHYFWNEFA----NEYHLNYSSLRKPVNCKYRQKEINYSMFYF 437

Query: 511 RHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPSP 570
            +AP F+   I++ +      NPF  ++                  KSS+ F        
Sbjct: 438 NNAPLFSLISIVETIIMNKKLNPFFCVY------------------KSSDDFE------- 472

Query: 571 TSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHL 630
                 ++SV            L+ W+  +  ++ T +  + ++ +KFL   +  +   +
Sbjct: 473 ------IKSV-----------SLSNWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFI 515

Query: 631 LPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSI 690
           LPW  F +S+A  +  +    +   W  L + + PW+ IV +LN  I     ++  + ++
Sbjct: 516 LPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTL 575

Query: 691 DNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYN-SVQDH 749
             L +   S  +  L+ +     +  E+  C G +WFD ++ K  +     T N S+   
Sbjct: 576 RALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASK--IKQASITTNESLMKF 633

Query: 750 MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF 789
              +   D + +D+DD+  ++ W RA  ++ + K +  ++
Sbjct: 634 KSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDY 673

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 968  SYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRK-SKDESVVEAATRAVIT 1026
            +YF+ D  +WL+H   + +      ++  + ++   +L  L+  S+ ESV  +A+R +I 
Sbjct: 802  NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIV 861

Query: 1027 VRQLYSEKRLLPLR 1040
            +  LY+  ++  L+
Sbjct: 862  INYLYAMNQINILK 875

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
           similar to uniprot|P36168 Saccharomyces cerevisiae
           YKR096W
          Length = 1229

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 50/122 (40%), Gaps = 39/122 (31%)

Query: 19  SPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAA-------LFLDSG----GSPVR 67
           S   QKR +S S DY  S + KRR G G+      + A        +LD+      S +R
Sbjct: 12  SGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIR 71

Query: 68  RKDA----------------------------QSPSYMPTTSSSNLEAAAVENENSSVRL 99
             +                             QSP Y+PTTS +N EAA   NENSS+R 
Sbjct: 72  HHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRR 131

Query: 100 SD 101
           SD
Sbjct: 132 SD 133

>KAFR0C03650 Chr3 complement(744293..744931) [639 bp, 212 aa] {ON}
           Anc_8.8 YFL046W
          Length = 212

 Score = 35.0 bits (79), Expect = 0.61,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 183 NDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQD-IYRNIV--KQEVELQERCSQL 239
           ++RG  H  + N+  E     G  +S+ SQ L+  + D I+  IV   +++  +ER  QL
Sbjct: 28  SNRGVTHIKDTNSVQEKLKKDGHFTSEQSQVLIDIMTDAIHSGIVHVSKDLAKRERLIQL 87

Query: 240 THSQTTDLKNL 250
           T+ Q  D   L
Sbjct: 88  TYQQRVDFAKL 98

>TPHA0D04440 Chr4 (957641..959617) [1977 bp, 658 aa] {ON} Anc_1.133
           YJL201W
          Length = 658

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 56/113 (49%), Gaps = 11/113 (9%)

Query: 380 ALSHIFGHGKLYYHMST-VQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 438
           ALSH+    +L   ++  +    +  ++++    F R T I ++QY QL+ D I++R   
Sbjct: 169 ALSHLIDITRLRISLNVYLHDYDISEYIDVPDEYFGRMTTIGTKQYKQLIFDKIFKRLRV 228

Query: 439 E---------RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
           E         + G  ++ +++++ ++ S  + LS + +   L  V  +F +NK
Sbjct: 229 ESVANELVFQKPGSYKKVNILLDIIERSNYIDLSQW-DIYSLASVFFNFLKNK 280

>TPHA0D00170 Chr4 (21311..21964) [654 bp, 217 aa] {ON} Anc_8.8
           YFL046W
          Length = 217

 Score = 32.7 bits (73), Expect = 4.2,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 183 NDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYR---NIVKQEVELQERCSQL 239
           ND    H  N +   +     G+ SSQ +  +V  + D  +   N V Q++  +ER +QL
Sbjct: 33  NDFDTVHIRNTSKYRQLLIERGKFSSQQAATIVNLMSDAMKGGVNHVSQDLAKRERLTQL 92

Query: 240 THSQTTDLKNL 250
           T+ Q  D   L
Sbjct: 93  TYQQRVDFAKL 103

>TDEL0C05740 Chr3 (1030530..1032287) [1758 bp, 585 aa] {ON}
           Anc_1.133 YJL201W
          Length = 585

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 48/90 (53%), Gaps = 10/90 (11%)

Query: 402 LEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE---------RNGGNQRNSLMVE 452
           ++ ++++ +  F R + + S+QY QLV D I++R   E         R G  +R +++++
Sbjct: 174 IDDYIDVPQEYFSRLSPLGSRQYRQLVFDRIFKRLELEAPTTELVFQRPGSYKRVNILLD 233

Query: 453 YLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
            ++ +  + LS + +   L  + L F +NK
Sbjct: 234 IIERNNYIDLSQW-DIYSLASIFLHFLKNK 262

>Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa]
           {ON} complement(162456..164357) [1902 nt, 634 aa]
          Length = 633

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 55/113 (48%), Gaps = 11/113 (9%)

Query: 380 ALSHIFGHGKLYYHMSTVQQN-TLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 438
            LSH+    +L   ++    +  L  ++++    F R T + ++QY QL+ D +++R   
Sbjct: 153 GLSHLIDITRLRISLNVYMHDYELSEYIDVPSEYFGRLTTLGNRQYRQLIFDKVFKRLQL 212

Query: 439 E---------RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
           E         + G  ++ +++++ ++ S  + LS + +   L  + L F +NK
Sbjct: 213 EGINYPMVFQKPGSYKKVNILLDIIERSNYIDLSQW-DIYSLASIFLHFLKNK 264

>AFR165C Chr6 complement(734202..734813) [612 bp, 203 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL200C
           (EMP24)
          Length = 203

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 10/84 (11%)

Query: 175 NSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIV--KQEVEL 232
           NSG LT         D   N     +P A  +SS+T +  V+KL  +   ++  +Q +E+
Sbjct: 104 NSGYLT--------KDVTFNTYGVLSPDAADSSSETLEGAVRKLSMLTMEVMNEQQYIEI 155

Query: 233 QERCSQLTHSQTTDLKNLWIIYKV 256
           +ER  + T   T D    W I+++
Sbjct: 156 RERTHRNTAESTNDRVKWWSIFQL 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,457,696
Number of extensions: 5812561
Number of successful extensions: 38593
Number of sequences better than 10.0: 354
Number of HSP's gapped: 37069
Number of HSP's successfully gapped: 429
Length of query: 1148
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1027
Effective length of database: 39,606,813
Effective search space: 40676196951
Effective search space used: 40676196951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)