Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00968g5.706ON1148114857460.0
Kwal_55.196785.706ON1178117943550.0
SAKL0E15004g5.706ON1196119334010.0
AFR290W5.706ON121796828890.0
ZYRO0B16412g5.706ON137299028220.0
TDEL0B021405.706ON114796627670.0
Ecym_40155.706ON125796427340.0
KAFR0H001805.706ON124198026500.0
KNAG0C066305.706ON1281100426470.0
KLLA0A00528g5.706ON122995226440.0
Kpol_1043.735.706ON126097525840.0
Smik_11.3605.706ON118096725690.0
Suva_11.3335.706ON118796925260.0
Skud_11.3365.706ON118897325030.0
YKR096W5.706ON119598124880.0
CAGL0G02541g5.706ON129596824700.0
TPHA0E001905.706ON136199723710.0
CAGL0H06611g5.706ON1282103223480.0
YIL151C5.706ON111896722800.0
Skud_9.175.706ON111896422760.0
Suva_9.375.706ON111796522690.0
Smik_9.185.706ON111897022410.0
NCAS0A031705.706ON131934413061e-158
NDAI0E050705.706ON155637112251e-145
TBLA0E017105.706ON152640110841e-125
TPHA0D046405.706ON9625883232e-29
TPHA0D044401.133ON658113781.6
TDEL0C057401.133ON58590744.8
Kpol_2001.581.133ON633113728.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00968g
         (1148 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  2217   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1682   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1314   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1117   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1091   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1070   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1057   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1025   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...  1024   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  1023   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   999   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   994   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   977   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   968   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   962   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   956   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   917   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   909   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   882   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   881   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   878   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   867   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   507   e-158
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   476   e-145
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   422   e-125
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   129   2e-29
TPHA0D04440 Chr4 (957641..959617) [1977 bp, 658 aa] {ON} Anc_1.1...    35   1.6  
TDEL0C05740 Chr3 (1030530..1032287) [1758 bp, 585 aa] {ON} Anc_1...    33   4.8  
Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa] ...    32   8.7  

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 2217 bits (5746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1081/1148 (94%), Positives = 1081/1148 (94%)

Query: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGXXXXXXXLFLD 60
            MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISG       LFLD
Sbjct: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLD 60

Query: 61   SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG 120
            SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG
Sbjct: 61   SGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICIDPRMDSSADHNCKMRG 120

Query: 121  CDLASKNQHQTFSNCIQTXXXXXXXXXXXXXXYSEHSVPNNAAQTESGEARAPVNSGGLT 180
            CDLASKNQHQTFSNCIQT              YSEHSVPNNAAQTESGEARAPVNSGGLT
Sbjct: 121  CDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAAQTESGEARAPVNSGGLT 180

Query: 181  GRXXXXXXXXXXXXXXXXXTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT 240
            GR                 TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT
Sbjct: 181  GRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLT 240

Query: 241  HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH 300
            HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH
Sbjct: 241  HSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVH 300

Query: 301  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA 360
            GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA
Sbjct: 301  GTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIA 360

Query: 361  LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP 420
            LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP
Sbjct: 361  LYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIP 420

Query: 421  SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ 480
            SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ
Sbjct: 421  SQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQ 480

Query: 481  NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXX 540
            NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNP       
Sbjct: 481  NKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFEL 540

Query: 541  XXXXXXXXXXXXXXXXXXXXXXTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL 600
                                  TSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL
Sbjct: 541  PKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSL 600

Query: 601  SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC 660
            SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC
Sbjct: 601  SHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALC 660

Query: 661  RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK 720
            RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK
Sbjct: 661  RQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWK 720

Query: 721  CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780
            CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF
Sbjct: 721  CWGALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780

Query: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840
            IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE
Sbjct: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840

Query: 841  NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP 900
            NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP
Sbjct: 841  NISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP 900

Query: 901  IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS 960
            IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS
Sbjct: 901  IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS 960

Query: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020
            CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA
Sbjct: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020

Query: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080
            TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF
Sbjct: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080

Query: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140
            EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG
Sbjct: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140

Query: 1141 LAHHACTN 1148
            LAHHACTN
Sbjct: 1141 LAHHACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1682 bits (4355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/1179 (70%), Positives = 931/1179 (78%), Gaps = 32/1179 (2%)

Query: 1    MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGSGISGXXXXXXXLFLD 60
            ME MRDIPT  SG    A+  QQKRQHSRS +YMGSGV+KRR+GSG+SG        FLD
Sbjct: 1    MEVMRDIPTETSGSVFGANTVQQKRQHSRSYEYMGSGVSKRRVGSGVSGTTAAAAASFLD 60

Query: 61   SGGSPVRRKD----------------------AQSPSYMPTTSSSNLEAAAVENENSSVR 98
              GSP+RR++                      A SPSY+PTTSSSNLEAA  ENEN SV 
Sbjct: 61   CEGSPLRRREVTPTLGRGPTIGMPHSVMSADNAYSPSYLPTTSSSNLEAAVTENENGSVN 120

Query: 99   LSDICI-----DP---RMDSSADHNCKMRGCDLASKNQHQTFSNCIQTXXXXXXXXXXXX 150
              DICI     DP   R   +   N + +  +  S +QH T  N IQ             
Sbjct: 121  FPDICIERQRTDPHSVRYTRTEQGNVRPQSHESLSNHQHHTLPNSIQ-GGSSSAGLPTGD 179

Query: 151  XXYSEHSVPNNAAQTES-GEARAPVNSGGLTGRXXXXXXXXXXXXXXXXXTPAAGQTSSQ 209
              + E S P N++++   G      + G                      + A   +SS 
Sbjct: 180  QDFREGSTPENSSRSSRHGPHDNQESKGYANSDERSNNNHENNNNNPNENSQAVSPSSSP 239

Query: 210  TSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFIT 269
            TSQALVQKLQDIYRNIVKQEVELQERC+QLT SQTTDLKNLWIIYK+N ELINNYVAFIT
Sbjct: 240  TSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNYVAFIT 299

Query: 270  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 329
            TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF
Sbjct: 300  TALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVF 359

Query: 330  ISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGK 389
            ISIS MLGDMPQKF+TPW ERLGDLSRMAIALYPSGFIDWKLSAEHWY+QALSHIFGHGK
Sbjct: 360  ISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHIFGHGK 419

Query: 390  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSL 449
            LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERNGGN RNSL
Sbjct: 420  LYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNGGNHRNSL 479

Query: 450  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYF 509
            MVEYLKHSEVMLLSSFLESPELQKVVLSFFQ+KFG+S++NTD+F+ + +FLQDGER KYF
Sbjct: 480  MVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQDGERVKYF 539

Query: 510  FRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSMEAPS 569
            FRHAPAFAESHILQ VGFG+PKNP                             TS+E  S
Sbjct: 540  FRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSFTSIETTS 599

Query: 570  PTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAH 629
              SP EYLE+VDSPR+ YEFP DLAIW++SLSHIN TS +CS++V QKFL GPLV A  H
Sbjct: 600  HLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKFLRGPLVVAVTH 659

Query: 630  LLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSS 689
            +LPW+YFLLSLA++ID LPS ELK FWI L RQ+FPWNSIV+FLNM++AF LDN WKTS 
Sbjct: 660  MLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSP 719

Query: 690  IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDH 749
            ID LCEQ DSVD R+LV+HFS++EDLPE+W+CWGALWFDVI+DKS+  D     +  +DH
Sbjct: 720  IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGEDGDVINSGSKDH 779

Query: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAG 809
             F D+P DGICFDEDDE G +FWKRACRL+FIFKGIAQEF++GLTL++   QSRR + AG
Sbjct: 780  PFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAG 839

Query: 810  HPLQNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGY 869
            HPLQNF F FE+ P  S+  + +  Q+P FE I+  NLDPN  PGQSMLEG+S+F+ PGY
Sbjct: 840  HPLQNFSFNFEEIPAQSQIQSFVRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGY 899

Query: 870  RQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKEL 929
            RQ++AD+TCFNK+G+LI+CSLYTSG LE+GPI GGDDFNTERY RS++ NK +N QI EL
Sbjct: 900  RQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITEL 959

Query: 930  DKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLAT 989
            +++ER WLD CMNPEFIEQ Y+MKFPFGDLSCNCDSGVSYFV DATSWLRHFAHV+KLAT
Sbjct: 960  ERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLAT 1019

Query: 990  NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHL 1049
            N VLRF ICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYS+K+LLPLRFTGNVATHL
Sbjct: 1020 NNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHL 1079

Query: 1050 EEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALV 1109
            EEHLEFEEQITWRSHVDEFVIEAVYKAQ KFEA+NAQAKE GHDFI TT+EEPFHF+ALV
Sbjct: 1080 EEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALV 1139

Query: 1110 SDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            SDDTNMR+KAH QRI+TFS+RFMFAVCNQIGLAH ACTN
Sbjct: 1140 SDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQACTN 1178

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1314 bits (3401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1193 (56%), Positives = 837/1193 (70%), Gaps = 72/1193 (6%)

Query: 12   SGVNVEASPA-QQKRQHSRSCDYMGSGVNKRR---LGSGIS--GXXXXXXXLFLDSGGSP 65
            S + + + P   QKR +S S DY  SG  KRR   L   +S           FLDS  +P
Sbjct: 20   SRIQMASHPTLHQKRHNSNSYDYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTP 79

Query: 66   VRRKDA----------------------QSPSYMPTTSSSNLEAAA--VENENSSVRLSD 101
             + ++                       QSP Y+PTTSSSNLEAA+  + N+NSSV+L D
Sbjct: 80   SKHQECTPSSFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPD 139

Query: 102  ICIDPR----------MDSSADHNCKMRGCDLASKNQHQTFSNCIQTXXXXXXXXXXXXX 151
            ICID +          ++   +H+ K    + A+  Q ++ ++ +Q              
Sbjct: 140  ICIDNKQQPERRQQQRLEKRVNHDDKKITRNAANGEQKESITDELQGTDNTPH------- 192

Query: 152  XYSEHSVPNNAAQTESGEARAPVNSGGLTGRXXXXXXXXXXXXXXXXXTPAAGQTSSQTS 211
               E S   +A   +  +    V  G   G                   P        TS
Sbjct: 193  ---EQSSNTHADTNQQSDQHNSVQQGSSGG------SDDGENNRENSGIPIVNVPPKHTS 243

Query: 212  QALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTA 271
            QALVQKLQDIYR+IVKQE+ELQERCSQLT+SQTTD+KNLW+IYKVN ELINNY++FITTA
Sbjct: 244  QALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTA 303

Query: 272  LLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 331
            LLPSQPEQDLLIGQEIV IYR+ERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI+HVF+S
Sbjct: 304  LLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMS 363

Query: 332  ISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLY 391
            ISNMLGD+P +++ PWLERLGDLSRMAIALYPSGFIDWKLSAEHWY+QAL + +GHGKLY
Sbjct: 364  ISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLY 423

Query: 392  YHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMV 451
            YHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAER+GG+ RN  +V
Sbjct: 424  YHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRNFPIV 483

Query: 452  EYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFR 511
            EYLKHSEVMLL SFLESPELQKVVL+FFQ +FG+  NN D+F H+ IF+QDGE+ +YFF 
Sbjct: 484  EYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFS 543

Query: 512  HAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-TSMEAPSP 570
            HAPAFAESHILQ+VGFG+P+NP                              T+++  + 
Sbjct: 544  HAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLDDGNG 603

Query: 571  TSPI---EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAA 627
            +S I    Y E++DS R  Y FP D+ IWQQSLS++N TS++CS  VL+KFLH PL++A 
Sbjct: 604  SSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTAL 663

Query: 628  AHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKT 687
             HLLPWA+FL+S+AIRI  L S  LK FW+   R++FPWNS+V+FLN ++AF LDN+   
Sbjct: 664  PHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNM 723

Query: 688  SSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQ 747
            SS++ LCE+++ +D+ TLV+HF+ +E+LPEVWKCWG LWFD IS+KS++         ++
Sbjct: 724  SSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIR 783

Query: 748  DHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLA 807
            DH+F D P+DGICFD+DDE+G +FWKRACR++F+FKG+A+EF+ G+ ++  P+ +RR + 
Sbjct: 784  DHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGIRVSDTPISTRRDVT 843

Query: 808  AGHPLQNFCFKFEDPPV--DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFE 865
              H L+ F FKFE+ P   D+E +      +  FE IS  N +  A P  SM++G+S+FE
Sbjct: 844  TLHALKRFSFKFEELPQEWDNEVFLQSDNFIKVFEPISPINSNFEAVPSLSMIDGESIFE 903

Query: 866  LPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQ 925
              GYR+++ D+ CFNK G LIT SLYTSG LE+  I GGDDFN +R+  +  L  A N  
Sbjct: 904  FQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSP 963

Query: 926  IK--------ELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSW 977
            +          ++  ER WL+ CM+P F+E   D +FP GDL+CN DS V+YFV DATSW
Sbjct: 964  VDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSNVTYFVLDATSW 1023

Query: 978  LRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLL 1037
            LRHFAHVYKLATN VL+FAICLTTFQELRFLRKSKDESVVEAATRAVIT RQLY E++LL
Sbjct: 1024 LRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLL 1083

Query: 1038 PLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPT 1097
            PLRFTGN+ATHLEEHLEFEEQITWRSHVDEFVIEAVYK+Q KF+ LN QA++ G ++IPT
Sbjct: 1084 PLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPT 1143

Query: 1098 --TEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
               +++ F+F+ LV+DD NMR KA A  I  FSSRFMFA CNQ+G     C N
Sbjct: 1144 DPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1117 bits (2889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/968 (58%), Positives = 701/968 (72%), Gaps = 40/968 (4%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P    T+ Q+SQAL++KLQ+IYRNIV+QE ELQ+RCSQLT SQTTDLKNLWIIYKVN E
Sbjct: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LI+NY  FITTALLP+QPE DLLIG+EI+ +YRIERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VCCQFI +VFISISNMLGD+P KF+  WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            AL + FGHGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510

Query: 440  RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
            RN G+ RN+ +VEYLKH+EVMLL SFLES ELQ VVL+FF+ KFG++SN  D+F  + +F
Sbjct: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVF 569

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXX---XXXXXXXXXXXXXXXXXX 556
            +QD ER K+FFRHA  +AESH+LQ+VGFG+P+NP                          
Sbjct: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSS 629

Query: 557  XXXXXXTSMEAPSP-TSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVL 615
                  TS++      +P E+ E++DS +++Y+FP D+ IW++SLS+ N T++KCS +VL
Sbjct: 630  TSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVL 689

Query: 616  QKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNM 675
            +KFLHGPL++A  HLLPW YFL +   R+  +P  E++ FW+AL RQ+FP+N+I+ FLN+
Sbjct: 690  RKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNV 749

Query: 676  IIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDK-- 733
            ++ +  +        D   EQF  + +  LV +F +NE+LPEVW+CWG LWFD ++ K  
Sbjct: 750  LLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHI 809

Query: 734  SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGL 793
            +++ D  +T   V+DHMF D P+DGI FD +DE+G +FWKR  R++ +F+ +A E  +GL
Sbjct: 810  TNLTDINST--GVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL 867

Query: 794  TLASVPLQSRRSLAAGHPLQNFCFKFEDPPVD-----SESYALISTQMPAFENISERNLD 848
                      R ++ G   ++  FKFE+PP +      E + L+      FE IS  NLD
Sbjct: 868  ----------REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLV---FDTFEQISPVNLD 914

Query: 849  PNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFN 908
              A P   M     +  L GYR L  D+ CFN+ G +IT SLYT G+LE   IHGGDDFN
Sbjct: 915  QRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFN 974

Query: 909  TERYSRSDELNKADNPQIKEL-DKMERMWLDTCMNPEFIEQT-------YDMKFPFGDLS 960
             +R   + EL   +      L D+ E+  +D     EF+  T       ++   P GDL 
Sbjct: 975  GKRLLENGELVSTERRDYNSLIDREEQPIMD-----EFLRHTHCKNDVRWEQMLPRGDLH 1029

Query: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020
            C  D+ V+YFV DAT+WLRHF HVYKLA N +L+FAICLTTFQELRFLRKSKDESV+EAA
Sbjct: 1030 CFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAA 1089

Query: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080
            TRAVITVRQLY E++LLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA++KAQ+KF
Sbjct: 1090 TRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF 1149

Query: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140
             ALN  AK    D IPT  ++ F+FIALV+DD NMR KA AQ I+ FS+RFMF+VCN++G
Sbjct: 1150 NALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELG 1209

Query: 1141 LAHHACTN 1148
             A + CTN
Sbjct: 1210 HAKNVCTN 1217

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 9/78 (11%)

Query: 21 AQQKRQHSRSCDYMGSGVNKRRLGSGISGXXXXXXXLFLDSGGSPVRRKDAQSPSYMPTT 80
          A  +++HS +      G+ KRR   G          L +D+ G+     +  SPSY+PTT
Sbjct: 18 ALHQKRHSSALGGCRDGLAKRRGPRG----GLTACGLVVDAIGA-----EPGSPSYLPTT 68

Query: 81 SSSNLEAAAVENENSSVR 98
          SSSNL+AAA   +NSS+R
Sbjct: 69 SSSNLDAAARAIDNSSLR 86

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/990 (54%), Positives = 684/990 (69%), Gaps = 61/990 (6%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P+    S ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+N++
Sbjct: 403  VPSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSD 462

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LINNYV F+TTALLPSQ EQD+LIG+EIV IYRIERRLWV+GTITFLD+ KNFSNFMDPE
Sbjct: 463  LINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPE 522

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VCCQFITHVFISISNMLGD+P K+  PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 523  VCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 582

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            A+   + HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF E
Sbjct: 583  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVE 642

Query: 440  RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
            RN GN RN+ ++EYLKHSEVMLL SFLES +LQ+VVL +F+ KFG  SNN + F  + +F
Sbjct: 643  RNNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMF 702

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ +  +YFFRHAPAFAESHILQ+VGFG+PKNP                          
Sbjct: 703  CQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKST 762

Query: 560  XXXTSM-----------EAPSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSI 608
                +            ++   ++P  +  ++++ RF Y  P++L IW +SL++IN TS+
Sbjct: 763  TVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSL 822

Query: 609  KCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNS 668
            KCS VVLQKFL GPLV A  H +PW YF++SLA +I +L     + FW+    ++FPWN+
Sbjct: 823  KCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNT 882

Query: 669  IVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFD 728
            IV+FLN++IA+ LDN+WK+S +D+LC Q+ S+ +  L+D+F+ NE LPEVWKCWG LWFD
Sbjct: 883  IVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFD 942

Query: 729  VISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQE 788
             I +K     E      +++HMF D P+DGI FD +DE+G  FWKRACR++F+FKG+A+ 
Sbjct: 943  TICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAEN 1002

Query: 789  FNMGLTLASV-PLQSRRS-LAAGHPLQNFCFKFE----------DPPVDSES---YALIS 833
            F +G+TL+ V P+  RR+ ++  H L++F FK            +PP  S +      + 
Sbjct: 1003 FPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLK 1062

Query: 834  TQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTS 893
              +  FE  S  N+  +  P  S++EG+S+F+  GYR+LH D+  ++K G  ++ SLYTS
Sbjct: 1063 NTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYTS 1122

Query: 894  GSLEKG-------PIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFI 946
                         P HG D                D+ +       E    +  M P + 
Sbjct: 1123 WYANNNTNNTGVIPAHGSD---------------VDSQRDAVQSVQEMHIFNQIMEPGYC 1167

Query: 947  EQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELR 1006
                D  F    L     S  +YFV D T+WLRHF H+YKLA++GVL+FAICLTTF ELR
Sbjct: 1168 GGFADDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELR 1227

Query: 1007 FLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVD 1066
            FLRK KDE+VVEAATRA+ITVRQLYSE +LLPLRFTGNVATH+EEHLEFEE+ITWRSHVD
Sbjct: 1228 FLRKPKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVD 1287

Query: 1067 EFVIEAVYKAQNKFEALNAQAKEG--------GHDFIPTTEEEPFHFIALVSDDTNMRLK 1118
            EFVIEAVYKAQ+KF+ +N    E          HD     +     F+ LV+DD+NMR K
Sbjct: 1288 EFVIEAVYKAQSKFQEMNQLQLEQEEQQHQLRAHD-----DRSGLKFVVLVTDDSNMRKK 1342

Query: 1119 AHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            A  Q +RTFS++F+F++CN IGL    CTN
Sbjct: 1343 AQDQDVRTFSTKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1070 bits (2767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/966 (55%), Positives = 665/966 (68%), Gaps = 61/966 (6%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P+    S ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT+SQTT+LK LW+IYKVN++
Sbjct: 226  VPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSD 285

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LINNYV FITTALLP Q +QDL IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 286  LINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 345

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VC QFITHVFISISNML D+P ++A PW +RLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 346  VCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 405

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            A+ +I+GHGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF E
Sbjct: 406  AMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVE 465

Query: 440  RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
            RN GN RNS ++EYLKHSEVMLL SFLES +LQ+VVL +F++KFG+ +N  + F  + +F
Sbjct: 466  RNNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMF 525

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ ++ KYFFRHAPAFAESHILQ+VGFG+PKNP                          
Sbjct: 526  DQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNP-FALLFELPRCLKDRRDKKEKRKTKS 584

Query: 560  XXXTSMEAPSPTSPIEYLES--------------VDSPRFVYEFPTDLAIWQQSLSHINT 605
               T   +       EY++S              +DS    Y FP  L +W  SL ++N 
Sbjct: 585  SVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNI 644

Query: 606  TSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFP 665
            TS+ CS +VL+KFL GP+V A  HLLPWAYF++++  ++  +     ++FW+ L  ++FP
Sbjct: 645  TSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFP 704

Query: 666  WNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGAL 725
            WN+IVNFLN++IA+ LDN   +  ID LCE+  ++ +  LV+HF+ NEDLPEVWKCWG L
Sbjct: 705  WNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLL 764

Query: 726  WFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGI 785
            WFD I DK  V  +      ++DHMF D+P+DGI FD DDE+G +FWKRACR++F+FK I
Sbjct: 765  WFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRI 824

Query: 786  AQEFNMGLTLAS-VPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFENISE 844
            A+ F   L ++S   +  RR+    H L++FCFK  D   +S S  ++   +  FE  S+
Sbjct: 825  AENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNS--VLQNTIEVFEEGSD 882

Query: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLE--KGPIH 902
             N D    P  S+LE +S+F   GY++L +D +C+++ G  ++ SLYTS   E  K  I 
Sbjct: 883  ANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETSKNEIP 942

Query: 903  GGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCN 962
              +    +  + +D   +  N  + E                     +++ FP     C 
Sbjct: 943  QSEPTQQQTANEADLFIEGINTSLTE---------------------FNIDFP----ECK 977

Query: 963  CDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATR 1022
             +   ++FV DATSWLRHFAHVYKLA+N VL+FAICLTTFQELRFLRKSKDE+VVEAATR
Sbjct: 978  MNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATR 1037

Query: 1023 AVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEA 1082
            AVITVRQLY+E R+LPLRFTGNVATH+EEHLEFEEQITWRSHVDEFV EA+ KAQ +   
Sbjct: 1038 AVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARL-- 1095

Query: 1083 LNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLA 1142
                          + E   FH + LV+DD NMR KA    I T S+RF+FA CN +G  
Sbjct: 1096 --------------SQENRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNR 1141

Query: 1143 HHACTN 1148
               CTN
Sbjct: 1142 LKICTN 1147

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1057 bits (2734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/964 (56%), Positives = 681/964 (70%), Gaps = 44/964 (4%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S  +SQ LV+KLQ+IY+NIVKQE ELQERCSQLT SQTTDLKNLW+IYK+N ELI+NY  
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLP+QP+ DLLIGQEI+ +YRIERRLW++GTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            +VFISISN+LG++P  F+  WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL + FG
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446
            HGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN G+ R
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555

Query: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506
             S +VEYLKH+EVMLL SFLE+ E Q VVL+FF  KFG ++ + ++F    IF+QD ER 
Sbjct: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFG-ATGSANFFDPSLIFVQDCERL 614

Query: 507  KYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSME 566
            K+FFRHA  +AESHILQ+VGFG+P+NP                              S  
Sbjct: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSDM 674

Query: 567  APSPT---SPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPL 623
            +   T    P+++ E+++S +  Y F  DL IW++SL+++N TS++CS VVL+KFL+  L
Sbjct: 675  SIDDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLRKFLNSSL 734

Query: 624  VSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDN 683
            ++A  HLLPWAYFL+++ +R+D + + + K FWI   RQ+FPW SI NFLN+++ +  D 
Sbjct: 735  LTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVLLLYINDQ 794

Query: 684  AWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDK--SDVVDEGA 741
                  ID     + ++ +  L+++F +NEDLPEVW CWG LWFDVI+ K  S++VD  +
Sbjct: 795  KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVSNLVDIHS 854

Query: 742  TYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQ 801
            T   V+DHMF D PVDGI FD  DE+G +FWKR  R++ +F+GIA +F  G T       
Sbjct: 855  T--GVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFT------- 905

Query: 802  SRRSLAAGHPLQNFCFKFEDPPVDSESYAL--ISTQMPAFENISERNLDPNAPPGQSMLE 859
                       ++  FKF +PP + +   L   S +   FE+IS  N D  +PP + M+ 
Sbjct: 906  ---EFNGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVL 962

Query: 860  GKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGP--IHGGDDFNT-------- 909
            G  +  L GY+QL  D+ CFNK G LIT SLYTSG  E G    +  +DF +        
Sbjct: 963  GTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENE 1022

Query: 910  -----ERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCD 964
                 ER   ++ L+K + P I E  K    W  +  N       ++   P GDL    D
Sbjct: 1023 LLVTSERRDYNNLLDKEETPIIDEFLK----WRYSSTNSR-----WEQCLPRGDLQYFTD 1073

Query: 965  SGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAV 1024
            + V+YFV DAT+WLRHF HVYKLAT+ +L+FAICLTTFQELRFLRKSKDESV+EAATRAV
Sbjct: 1074 THVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAV 1133

Query: 1025 ITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALN 1084
            ITVRQLY E++LLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA+ KAQ+KF  LN
Sbjct: 1134 ITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLN 1193

Query: 1085 AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHH 1144
              AK  G + I T ++  F+FIALV+DD NMR KA AQ IR FS++FMFA+C++IGL+  
Sbjct: 1194 KDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKK 1253

Query: 1145 ACTN 1148
             CT+
Sbjct: 1254 VCTD 1257

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 23/27 (85%)

Query: 72  QSPSYMPTTSSSNLEAAAVENENSSVR 98
           +SP Y+PTTSSSN+EAAA   ++SS++
Sbjct: 130 RSPYYLPTTSSSNMEAAAKAIDSSSIK 156

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/980 (52%), Positives = 682/980 (69%), Gaps = 53/980 (5%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            + +TS+ L++KLQ+IY+ IVKQE+ELQ+RCSQLT SQTT+LKNLW IYK+NT+LINNY+ 
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLPSQ  QD+ IG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            HVFIS+S ML D+P K + PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQ 445
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN  GN 
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNV 516

Query: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505
            RNS +++YLKHSEVMLL SFLE+ +LQ+VVL++F ++FG+  N+ + F  Q +F Q    
Sbjct: 517  RNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPAS 576

Query: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSM 565
             +++FRHAPAFAESHILQ+VGFGNPKNP                             ++M
Sbjct: 577  LRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTM 636

Query: 566  EAPSPTS--PI--------------EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIK 609
               +  S  PI              EY +++DS R   + P ++ +W +SL H+N TS+K
Sbjct: 637  SIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEHLNMTSLK 695

Query: 610  CSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSI 669
            CS +VL+KFL GPL+ A  H+LPW YF+++  ++     +     FW  + R++ PWN++
Sbjct: 696  CSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRILPWNTL 755

Query: 670  VNFLNMIIAFALDNAWKTSSIDNLCEQFDSVD-VRTLVDHFSQNEDLPEVWKCWGALWFD 728
             +FLN+++A+ LDN ++T SI  LCE + + +    L+D+F++NE+LPE+WKCWG LWFD
Sbjct: 756  TSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCWGTLWFD 815

Query: 729  VISDKSDVVDEGATYNS--VQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIA 786
            VIS+K  +     T+N   ++DHMF D P+DGI FDE DETG  FW RA R+VF+FKGIA
Sbjct: 816  VISNKRAL--NADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVFLFKGIA 873

Query: 787  QEFNMGLTLA-SVPLQSRRS-LAAGHPLQNFCFK---FEDPPVDSESYALISTQMPAFEN 841
            +    GL ++ + P+  RR  +   H L++F FK   F++     + ++ I+  +P FEN
Sbjct: 874  ENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINKLLPLFEN 933

Query: 842  ISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI 901
            I E NLD +A P  S+++G+++FE  GY++L  ++  F++ G L++ S+YT+  ++    
Sbjct: 934  IDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAWVIDND-- 991

Query: 902  HGGDDFNTERYSRSDELNKAD---------NPQIKEL----DKMERMWLDTCMNPEFIEQ 948
            +  ++    +Y+ + ++ +           N Q++      D  +    +  MNPE + +
Sbjct: 992  NSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNPEKLNK 1051

Query: 949  TYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFL 1008
              D    +   +   +  ++YFV DATSWLRHFAH+YKL+TN VL FA+CLTTFQELRFL
Sbjct: 1052 NMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQELRFL 1111

Query: 1009 RKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEF 1068
            RKSKDE+VV AA RA+IT+RQLYSE +LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEF
Sbjct: 1112 RKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEF 1171

Query: 1069 VIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFS 1128
            VIEAV KAQNKF + N             T  + F+ + LV+DD NM+ KA  Q I+TF+
Sbjct: 1172 VIEAVVKAQNKFISANESV----------TLRKGFNHVVLVTDDINMKRKAQEQGIKTFT 1221

Query: 1129 SRFMFAVCNQIGLAHHACTN 1148
            + F+F+VC ++G+  + CTN
Sbjct: 1222 THFIFSVCRKLGIQDNVCTN 1241

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1004 (52%), Positives = 674/1004 (67%), Gaps = 68/1004 (6%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            + ++SQALVQKLQDIY+ IVKQE+ELQERCSQLT SQTT+LKNLW IYK+NT+LINNY  
Sbjct: 284  TRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTT 343

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLPSQP QD+LIG+EIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 344  FITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 403

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            HVFIS+S +L D+P K A PWL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   + 
Sbjct: 404  HVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 463

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN-GGNQ 445
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN GGN 
Sbjct: 464  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNY 523

Query: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505
            RN  +++YLKHSEVMLL SFL S +LQ+VVL++FQ++FGI  +  + F  Q +F Q    
Sbjct: 524  RNPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSC 583

Query: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXTS 564
             ++FFRHAPAFAESHILQ+VGFGNPKNP                               S
Sbjct: 584  LRFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVS 643

Query: 565  MEAPSPT----------------------SPIEYLESVDSPRFVYEFPTDLAIWQQSLSH 602
              AP                         S  EYL+++++ ++  E P D+  W +SL  
Sbjct: 644  STAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDF 702

Query: 603  INTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQ 662
            IN TS+KCS +VL+KFLHGPL+ A  H LPW  F+++  I+++EL + +   FW  L ++
Sbjct: 703  INMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKR 762

Query: 663  VFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCW 722
            +FPW++I +FLN+++A+ LDN   T+ I+ LC Q+  +D+  ++ HF+++EDLPEVWKCW
Sbjct: 763  IFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCW 822

Query: 723  GALWFDVISDKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIF 782
            G LW+D I +K+ V  +      + DHMF D P+DGI FD +DETG++FWKRA R++F+F
Sbjct: 823  GTLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLF 882

Query: 783  KGIAQEFNMGLTLA-SVPLQSRRSLAAGHPLQNFCFKFE--DPPVDSESYALISTQMPAF 839
            KGI+++F+ GL ++    +  R   AA  PL+ F FK E  D P  S+    I    P  
Sbjct: 883  KGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDEPTSSKFNEFI----PLC 938

Query: 840  ENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKG 899
            E +S  N D  A P  S+++G+++FE  GYR L  D   F+K G +++ S+YTS  ++ G
Sbjct: 939  EEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTG 998

Query: 900  PIHGGDDFNTERYSRSD---ELNKADNP---QIKELDKMERMWLDTCMNPEFIEQTYDMK 953
                     T+  + S+   +L     P    +    K     +    +P   E     K
Sbjct: 999  EAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKK 1058

Query: 954  F-PFGD-----LSCNCDSGVSY-------------------FVPDATSWLRHFAHVYKLA 988
            F   GD     +  N  +G SY                   F+ DATSWLRHFAH+YK+A
Sbjct: 1059 FMSLGDPRDRNVYHNMITGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIA 1118

Query: 989  TNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH 1048
            TNGVL+F +CLTTFQELRFLRKSKDE+VVEAA RA+IT+RQLY E RLLPLRFTGNVA  
Sbjct: 1119 TNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVAND 1178

Query: 1049 LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF----EALNAQAKEGGHDFIPTTEEEPFH 1104
            +EEHLEFEEQITWRSHVDEFVIEAV KAQ+KF    E    + +  G   +P   +  FH
Sbjct: 1179 IEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKR-FH 1237

Query: 1105 FIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            ++ LV++D NM+ KA  Q I+TFS+ F+F++C+++G++   CTN
Sbjct: 1238 YVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/952 (54%), Positives = 660/952 (69%), Gaps = 23/952 (2%)

Query: 214  LVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTALL 273
            LV+KLQ+IY++IVKQE ELQERCS LT  QTTDLKNLW+ YK+N ELI+NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 274  PSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISIS 333
            PSQ E  L IGQEIV++YRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFI +VFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 334  NMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYH 393
            NML D+P K++ PWLERLGDLSRMAIALYPSGF+DWKLSAEHWY ++L   FGHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 394  MSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEY 453
            MSTVQQNTLEAFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+    R + +V+Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 454  LKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRHA 513
            LKH+EVMLL SFLES ELQ VV+ +FQ+KFG+SS+  ++F    IF+QD ER K+FFRH+
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 514  PAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSME-----AP 568
              F++SHILQ+ GFG+PKNP                              S++     + 
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQ 642

Query: 569  SPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAA 628
               S  ++  ++DSP+  YEFP DL +W++SL +IN TS+KC  +VL++FL+GP+V+A  
Sbjct: 643  QQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALP 702

Query: 629  HLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTS 688
            H+LPW  F++S+ IR+D++    LK FWI   R++FPW+S++ F+N +I + +    K  
Sbjct: 703  HVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNF 762

Query: 689  SIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQD 748
             ID     +  ++   L+    +NE+LPE W CWG+LWF+ IS KSD+         + D
Sbjct: 763  DIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSD 822

Query: 749  HMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQ-EFNMGLTLASVPLQSRRSLA 807
             +F D P +GICFD+DDE G ++W+R CR + +F  I + E   G       L    +  
Sbjct: 823  TLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEAT-- 880

Query: 808  AGHPLQNFCFKFEDPPVDSESYALI-----STQMPAFENISERNLDPNAPPG-QSMLEGK 861
                 +N  F+F D   D  S  L      S     FE IS  N   N   G +SM+ G 
Sbjct: 881  ---SWKNLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGV 937

Query: 862  SLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKA 921
            S+  L G++ ++ D+ CFNK G LIT SLYT G LE   I GGDDFN  +   +  L   
Sbjct: 938  SIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQ 997

Query: 922  DNPQIKE-LDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRH 980
            D  +    +DK+E+ WL+  MNP+F ++    +   G+L+C  D+ V++FV DAT+WLRH
Sbjct: 998  DRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRH 1057

Query: 981  FAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLR 1040
            FAH+YKLAT+ VL+FAICLTTFQELRFLRKSKDESV+EAATRAVI VRQLY E++LL LR
Sbjct: 1058 FAHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALR 1117

Query: 1041 FTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEE 1100
            FTGNVA HLEEHLE EEQ+TW+SHVDEFVI+A+ KAQ+KF  LN  A E G D IP +E+
Sbjct: 1118 FTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSED 1177

Query: 1101 ----EPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN 1148
                + F+F++LV+DD NMR KA    IRTFS+RF+FA+C ++G     CTN
Sbjct: 1178 GQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 48/122 (39%), Gaps = 39/122 (31%)

Query: 19  SPAQQKRQHSRSCDYMGSGVNKRRLGSGISGXXXXXXX-------LFLDSG----GSPVR 67
           S   QKR +S S DY  S + KRR G G+                 +LD+      S +R
Sbjct: 12  SGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIR 71

Query: 68  RKDA----------------------------QSPSYMPTTSSSNLEAAAVENENSSVRL 99
             +                             QSP Y+PTTS +N EAA   NENSS+R 
Sbjct: 72  HHEKTPSITKPHTLQMEQTPQPRGVDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRR 131

Query: 100 SD 101
           SD
Sbjct: 132 SD 133

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/975 (52%), Positives = 676/975 (69%), Gaps = 66/975 (6%)

Query: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259
             P+      ++SQALVQKLQDIY+ I+KQEVELQERCSQLT+SQTT++KNLW+IYK+N +
Sbjct: 304  VPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNAD 363

Query: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319
            LINNYV FITTAL PSQ + DLLIG+EIV+IY+IERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 364  LINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPE 423

Query: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379
            VCCQFITHVFISIS+ML D+PQK+A PWL++LGDLSRMA+AL+PSGFIDWKLSAE WY  
Sbjct: 424  VCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMA 483

Query: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439
            A+ + +G+GKLYYHMSTVQQNTLEAFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+
Sbjct: 484  AMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFAD 543

Query: 440  RN-GGNQRN-SLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI--SSNNTDYFSH 495
            RN   N RN  L+V+YLKHSEVMLL +F+ESP+LQ+VVL +F  KFGI  ++NN   F  
Sbjct: 544  RNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP 603

Query: 496  QAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXX--XXXXXXXXXXXXXX 553
            + +F+Q+ ++ K++FRHA AFAE+ ILQ+VG+GNPKNP                      
Sbjct: 604  RQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK 663

Query: 554  XXXXXXXXXTSMEAPSPTSPIEYLESVDSPRFVYE---------------FPTDLAIWQQ 598
                      S    S  S +EY+ ++++  F+                  P  +++W  
Sbjct: 664  PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWND 723

Query: 599  SLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIA 658
            SL + N T+ KCS +VLQKFL+GPL+ A  H+LPW YFL+S+A++I++     + +FW A
Sbjct: 724  SLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYA 783

Query: 659  LCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEV 718
              +++FPWNS+V FLN+++A+ +DN W  S ++ LC+Q+ S+++  L+ +F+ NEDLPEV
Sbjct: 784  FIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEV 843

Query: 719  WKCWGALWFDVISDKSDVVD-EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACR 777
            WKC G+LWFD+I +K +  + +  T   ++D+ F D PVDGI FDE+DE G +FWKR+ R
Sbjct: 844  WKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVR 903

Query: 778  LVFIFKGIAQEFNMGLTLA---SVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALIST 834
            ++F+F+GI + FN    LA   + P+ +RR L     L  + FK       S+       
Sbjct: 904  VIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLM---AKSDDIMFDDM 960

Query: 835  QMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSG 894
             +  FE I   N D NA P  SM+ G+++FE  GY+++HAD+  F+K G LI+ S Y + 
Sbjct: 961  LVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNTW 1020

Query: 895  SLEKGP-IHGG---------DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPE 944
            S+ +   ++GG         +  +++  +  +  NK  +P   E D ++  W     N E
Sbjct: 1021 SINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDP---EYDSVDEFW-----NKE 1072

Query: 945  FIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQE 1004
              +   D+   FG +    D   +YF+ DATSWLRHFAHVYK+ATN +L+F+ICLTTFQE
Sbjct: 1073 IYD---DIGRKFG-MELYED---TYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQE 1125

Query: 1005 LRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSH 1064
            LRFLRKSKDE+VVEAATRA+IT+RQL+SE +LLPLRFTGNVATH+EEHLEFEEQITWRSH
Sbjct: 1126 LRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSH 1185

Query: 1065 VDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRI 1124
            VDEFVIEAV KA+ K +       +G               I LV+DD+NM+ KA  +  
Sbjct: 1186 VDEFVIEAVIKAETKRKEQEMHNMKGFQ-------------IVLVTDDSNMKNKALEKGS 1232

Query: 1125 RTFSSRFMFAVCNQI 1139
            +TFS+RF+FA+ N +
Sbjct: 1233 KTFSTRFVFAISNYL 1247

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/967 (51%), Positives = 653/967 (67%), Gaps = 72/967 (7%)

Query: 213  ALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTAL 272
            AL+QKLQ++YR IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+NTEL+NNYV FITTAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 273  LPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 332
            LPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 333  SNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYY 392
            S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ + + HGKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 393  HMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVE 452
            HMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN RNSL++E
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494

Query: 453  YLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRH 512
            YLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  KYFFRH
Sbjct: 495  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRH 554

Query: 513  APAFAESHILQMVGFGNPKNP-----------------------XXXXXXXXXXXXXXXX 549
             P+FA+SHILQ+VGFG PKNP                                       
Sbjct: 555  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESSTGNSR 614

Query: 550  XXXXXXXXXXXXXTSMEAPSPTSPIEYLESVDSPRFVYEFPTDLA--IWQQSLSHINTTS 607
                         TSM  P     +E+   +D+ R     P+ L    W ++L  +N TS
Sbjct: 615  NGNEDDDETMSSTTSMSDPDLL--VEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTS 671

Query: 608  IKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWN 667
            +KC  +VL+KFLHGPL  A  H+LPW YF++S+ ++ ++L  P  K+FWI + +++FPW+
Sbjct: 672  LKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWD 731

Query: 668  SIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWF 727
            ++V F+N++IA+ LDN    S I +LC ++  +++  L++ F++NEDLPE+W CWG LWF
Sbjct: 732  TMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGTLWF 791

Query: 728  DVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKG 784
            D I  K   S   ++      ++D+M  D P DGI FD+ DE G +FWKRACR++F+F+ 
Sbjct: 792  DAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFRE 851

Query: 785  IAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAF---EN 841
            +++ F +G+ +   PL +  SL + + L++  +K E       S  ++ST    F   E 
Sbjct: 852  VSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDISEA 911

Query: 842  ISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI 901
             SE N D +A P  S++ G ++F   GY++L  D+TCF+K G  ++ SLYTS  +     
Sbjct: 912  RSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP---- 967

Query: 902  HGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSC 961
                + N    +     N+ +N         E ++L+ CM     E  Y           
Sbjct: 968  ----NCNNNLETNISYANEREN---------EALFLE-CMKSVHPEIAYP---------- 1003

Query: 962  NCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAAT 1021
              D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQELRFLRKSKDE+V+EAAT
Sbjct: 1004 EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1063

Query: 1022 RAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFE 1081
            R +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ K E
Sbjct: 1064 RGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123

Query: 1082 ALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGL 1141
                 AK+      P      F+++ L+SDD  M+ KA  ++IRT S+RF+F++C ++G 
Sbjct: 1124 ----NAKQ------PNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGE 1173

Query: 1142 AHHACTN 1148
              H CT+
Sbjct: 1174 QRHLCTD 1180

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/969 (50%), Positives = 655/969 (67%), Gaps = 73/969 (7%)

Query: 209  QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
            ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTEL+NNYV FI
Sbjct: 263  KSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFI 322

Query: 269  TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
            TTALLPSQP+ DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHV
Sbjct: 323  TTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 382

Query: 329  FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
            F+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +++ HG
Sbjct: 383  FVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHG 442

Query: 389  KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNS 448
            KLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN RNS
Sbjct: 443  KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNS 502

Query: 449  LMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKY 508
            L++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  KY
Sbjct: 503  LLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFKY 562

Query: 509  FFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSM--- 565
            FFRHAP+FA+SHILQ+VGFG PKNP                              +    
Sbjct: 563  FFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESST 622

Query: 566  -----------EAPSPTSPI-------EYLESVDSPR--FVYEFPTDLAIWQQSLSHINT 605
                       E  S T+ I       E+   +D+ R   V    T+ A W +SL  +N 
Sbjct: 623  SNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEA-WLESLKFLNM 681

Query: 606  TSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFP 665
            TS+KC  +VL+KFLHGPL  A  H LPW YF++S+ ++  +L  P  K+FWI + +++FP
Sbjct: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741

Query: 666  WNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGAL 725
            W+++V F+N++IA  LDN   +  I +LC+++  +++  L+D F + E+LPE+W CWG L
Sbjct: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801

Query: 726  WFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIF 782
            WFD I  K   S   D+      ++D+M  D P+DGI FD +DE G +FWKRACR +F+F
Sbjct: 802  WFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861

Query: 783  KGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQ---MPAF 839
            + +++ F +G+ + +    +R SL + + L N  +K E       S   ++T    +  F
Sbjct: 862  RELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVF 921

Query: 840  ENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKG 899
            E  SE N+D +A P  S+++G S+F   GY++L  ++TCF+K G  ++ SLYTS  +  G
Sbjct: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNG 981

Query: 900  PIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDL 959
              +   + N+          K +  Q  E           C+  +  E            
Sbjct: 982  SNNPETNINS-------NCEKENEGQFLE-----------CLKSDDRE------------ 1011

Query: 960  SCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEA 1019
                D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+V+EA
Sbjct: 1012 ---IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEA 1068

Query: 1020 ATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK 1079
            ATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ K
Sbjct: 1069 ATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEK 1128

Query: 1080 FEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQI 1139
             E  N          +P +    F+++ L+SDD  M+ KA  ++I+T S+RF+F++C ++
Sbjct: 1129 LENANQ---------LPVSSCR-FNYVILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKL 1178

Query: 1140 GLAHHACTN 1148
            G   H CT+
Sbjct: 1179 GEQRHLCTD 1187

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/973 (50%), Positives = 653/973 (67%), Gaps = 77/973 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S ++S AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IY++NTELINNYV 
Sbjct: 262  SKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINNYVT 321

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FITTALLPSQP  DLLIGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFIT
Sbjct: 322  FITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 381

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            HVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ +I+ 
Sbjct: 382  HVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYN 441

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR 446
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN R
Sbjct: 442  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 501

Query: 447  NSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERT 506
            NSL++EYLKHSE MLL SFLESP+LQ VV+S+F  KFGI +N  + F+ + +F+Q+ +  
Sbjct: 502  NSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNPDFF 561

Query: 507  KYFFRHAPAFAESHILQMVGFGNPKNP--------------XXXXXXXXXXXXXXXXXXX 552
            KYFFRHAP+FA+SHILQ+VGFG PKNP                                 
Sbjct: 562  KYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTES 621

Query: 553  XXXXXXXXXXTSMEAPSPTSPI-------EYLESVDSPRFVYEFPTDLA--IWQQSLSHI 603
                         E  S T+ I       E+   +D+ R     P+ L    W ++L  +
Sbjct: 622  STGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPI-LPSMLTSEAWLETLKFL 680

Query: 604  NTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQV 663
            N TS+KC  +VL+KFLHGPL  A  H+LPW YF+++  ++ ++L  P  KDFW+ + ++V
Sbjct: 681  NMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMIIVKRV 740

Query: 664  FPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWG 723
            FPW++IV F+N++IA+ LDN      I  LC ++ ++++  L++ F+++E+LPE+W CWG
Sbjct: 741  FPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIWNCWG 800

Query: 724  ALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVF 780
             LWFD I  K   S   D+      ++D+M  D P DGI FD+ DE+G +FWKRACR++F
Sbjct: 801  TLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRACRIIF 860

Query: 781  IFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFE 840
            +F+ +++ F +G+ +++ PL    S  +   L+N  +K E P  +  S   I T +    
Sbjct: 861  LFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLE-PLSNIRSNTPILTALENSV 919

Query: 841  NISE----RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSL 896
            +ISE     N+D  A P  S+  G ++F   GY++L  D+TCF++ G  ++ SLYT   L
Sbjct: 920  DISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYTRWYL 979

Query: 897  EKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPF 956
              G        N      + ++ K D          E ++L+ CM P+            
Sbjct: 980  PNGN-------NISEALVNSDIEKGD----------EDLFLE-CMKPD------------ 1009

Query: 957  GDLSC-NCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDES 1015
                C   D   +YFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 1010 ----CPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1065

Query: 1016 VVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYK 1075
            V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ K
Sbjct: 1066 VMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKK 1125

Query: 1076 AQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAV 1135
            AQ K E         G    P       +++ L+SDD  M+ KA  + I+T S++F+F++
Sbjct: 1126 AQEKLE-------NAGQ---PHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLSTKFVFSL 1175

Query: 1136 CNQIGLAHHACTN 1148
            C ++G   H CT+
Sbjct: 1176 CTKLGEKRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/981 (50%), Positives = 652/981 (66%), Gaps = 83/981 (8%)

Query: 201  PAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTEL 260
            PA+ + S     AL+QKLQ++Y+ IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+NT+L
Sbjct: 265  PASNKRSGI---ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321

Query: 261  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 320
            +NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEV
Sbjct: 322  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381

Query: 321  CCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQA 380
            CCQFITHVF+S+S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A
Sbjct: 382  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441

Query: 381  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 440
            + +I+ HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ER
Sbjct: 442  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501

Query: 441  NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFL 500
            N GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+
Sbjct: 502  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561

Query: 501  QDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXX 560
            Q+ +  KYFFRH P+FA+SHILQ+VGFG PKNP                           
Sbjct: 562  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND 621

Query: 561  XXTSM--------------EAPSPTSPI-------EYLESVDSPRFVYEFPTDLA--IWQ 597
               +               E  S T+ I       E+   +D+ R     P+ L    W 
Sbjct: 622  SSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWL 680

Query: 598  QSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWI 657
            ++L  +N TS+KC  +VL+KFLHGPL  A  H+LPW YF++S+ ++  +L  P  K+FW+
Sbjct: 681  ETLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWM 740

Query: 658  ALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPE 717
             + ++ FPW+++V F+N++I + LDN    S I +LC+ +D + +  L++ F++ E+LPE
Sbjct: 741  IIVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPE 800

Query: 718  VWKCWGALWFDVISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKR 774
            +  CWG LWFD I +K   S   ++      ++D+M  D P DGI FDE DE G +FWKR
Sbjct: 801  ILGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKR 860

Query: 775  ACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFE-------DPPVDSE 827
            ACR +F+F+ +++ F +G+ + + PL  R S    + L +  FK E       + PV   
Sbjct: 861  ACRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGA 920

Query: 828  SYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLIT 887
              ++I       E  SE N D +A P  S+ EG ++F   GY++L AD+TCF+K G  ++
Sbjct: 921  LESIIDIS----EARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLS 976

Query: 888  CSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIE 947
             SLYT                T     S+  N  DN       + E ++L+ C+  ++ E
Sbjct: 977  ASLYT----------------TWYVPNSNNTNIEDNINYNSEKENEGLFLE-CIKSDYPE 1019

Query: 948  QTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRF 1007
                            D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQELRF
Sbjct: 1020 ---------------IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRF 1064

Query: 1008 LRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDE 1067
            LRKSKDE+V+EAATR +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDE
Sbjct: 1065 LRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1124

Query: 1068 FVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTF 1127
            FVIE+V KAQ K E+    A E      P      F+++ L+SDD  M+ KA  + I+T 
Sbjct: 1125 FVIESVMKAQEKLES----ASE------PRLSPRRFNYVVLISDDDAMKKKAEEKEIKTL 1174

Query: 1128 SSRFMFAVCNQIGLAHHACTN 1148
            S+RF+F++C ++G   H CT+
Sbjct: 1175 STRFVFSLCTKLGEQRHLCTD 1195

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/968 (51%), Positives = 653/968 (67%), Gaps = 55/968 (5%)

Query: 204  GQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINN 263
               S++ +QALVQKLQDIY+NIV+QEVELQE+C+QLT SQTTDL ++W IY++N EL+ N
Sbjct: 360  ANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTN 419

Query: 264  YVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQ 323
            YV FI+TALL SQ + DL+IGQEIV  YRI RRLWV+GTITFLDVLKNFS+FMDPEVC Q
Sbjct: 420  YVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQ 479

Query: 324  FITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSH 383
            FITHVFISIS ML D+P K++ PW++RLGDLSRMAIALYPSGFIDWKLS+E+WY QAL +
Sbjct: 480  FITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKY 539

Query: 384  IFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGG 443
             +G+GKLYYHMST+QQNTLEAFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ER   
Sbjct: 540  TYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSN 599

Query: 444  NQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDG 503
            N RNS ++EYLKHSEVMLL +F+ +  LQKVV+++F++KFG   ++ + F  + IFLQ+ 
Sbjct: 600  NTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNP 659

Query: 504  ERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 563
            E  KYFFRHAPAFAESHILQ VGFG+ KNP                             T
Sbjct: 660  ENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPT 719

Query: 564  SMEA---------PSPTSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVV 614
            S E+          S  S  +Y  +++S +  Y  P    IW +SLS++N T+++C  +V
Sbjct: 720  SNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIV 779

Query: 615  LQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLN 674
            L+KFLHGP V A  HL+ W YF++S+ ++ + L   E + FW +  R++ P NSIV+FLN
Sbjct: 780  LRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLN 839

Query: 675  MIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKS 734
            ++IA+ALDN++ ++ I ++ E+ DS+D++ L+  F+ NE+LPEVWKCWG LWFD I+DKS
Sbjct: 840  VLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKS 899

Query: 735  DVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLT 794
            +          V DH+F D P+DGI FD  DE G +FWKRA R++F+FK IA+ F++G+T
Sbjct: 900  NTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGIT 959

Query: 795  LA-SVPLQSRR-SLAAGHPLQNFCFKFEDPPVDSESY---------ALIS-TQMPAFENI 842
            L+ + P+  RR  +   H L +F FK E   ++  +          A+I  T+MP     
Sbjct: 960  LSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMP----- 1014

Query: 843  SERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTS--GSLEKGP 900
            +E N+  +A P  S+ E +++FE  GY+++  +   F+K G L + + YTS   + E  P
Sbjct: 1015 NEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVP 1074

Query: 901  IHGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLS 960
                   N+   S       +     +  D  E ++        F  +  +       L+
Sbjct: 1075 KSAASPENSVAGS-------SPGRSFQSQDVEENIF------SVFTNEEENSTSLLDGLN 1121

Query: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020
                S    FV DATSWLRH AH+YKLA+N  L F+ICLTTFQELRFLRKSKDE+V+EAA
Sbjct: 1122 LETTS----FVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAA 1177

Query: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080
             RA+I +RQLYS+ +++PLRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIE++ KAQ KF
Sbjct: 1178 ARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF 1237

Query: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140
                         F+    +    F  LVSDD NM+ KAH + IRTF++RF+FA+C+++G
Sbjct: 1238 ----------LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMG 1287

Query: 1141 LAHHACTN 1148
                 CTN
Sbjct: 1288 KGRLICTN 1295

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/997 (47%), Positives = 647/997 (64%), Gaps = 77/997 (7%)

Query: 201  PAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTEL 260
            P+      ++SQ LVQKLQDIY+ IVKQE+ELQERC +LT+SQTT+LKNLW IY+VN+EL
Sbjct: 371  PSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSEL 430

Query: 261  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 320
            ++NY+ FITTA+ P+QPE D  IG+EI+ IY+IERRLWV+GTITFLD+LKNFSNFMDPEV
Sbjct: 431  VDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEV 490

Query: 321  CCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQA 380
            CCQFI HVFISISNML D+PQK+   W ++LGDLSRMAIALYPS FIDWKLSAE WY  A
Sbjct: 491  CCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAA 550

Query: 381  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER 440
            +   +GHGKLYYHMSTVQQNTLEAFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+ 
Sbjct: 551  MEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADS 610

Query: 441  NGGN--QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNT--DYFSHQ 496
            N  N  + + L+V+Y+KH EV LL +F ES ELQ+VVL +F +KFG+  NN+  + F  +
Sbjct: 611  NNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISR 670

Query: 497  AIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXX 556
             +F+Q+ ++ K F+R++ AFAES ILQ+VG+GN K+P                       
Sbjct: 671  KMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKP 730

Query: 557  XXXXXXTSME---------APSPTSPI--------EYLESVDSPRFVYEFPTDLAIWQQS 599
                     +            PT P         E+ E++D+  +    P  + IW  S
Sbjct: 731  KTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNHS 790

Query: 600  LSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIAL 659
            L + N  SIKCS +V +KFLH P + A  H LPW YF++S+ +++D+  +  + +FW+  
Sbjct: 791  LQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEF 850

Query: 660  CRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVW 719
             R++FPWNSIV FLN+++A+ +DN W+ S ++ LC  ++S+ +  L+ +F++NE+LPEVW
Sbjct: 851  VRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVW 910

Query: 720  KCWGALWFDVISDKSDV-------VDEGATY-------NSVQDHMFGDMPVDGICFDEDD 765
            KC G+LWFD I +KS++       V  G+ +       N V+D+ F D P+DG  FDE D
Sbjct: 911  KCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESD 970

Query: 766  ETGSRFWKRACRLVFIFKGIAQEFN--MGLTLA-SVPLQSRRS-----LAAGHPLQNFCF 817
            E G RFWKRA R++F+FK +A+ +    GL L+   P+ +RR            L  F F
Sbjct: 971  EIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSF 1030

Query: 818  KFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHT 877
            K       S    ++   + +FE   E N D +  P  SM++G S+F+  GY+++  +  
Sbjct: 1031 KLN----ASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCPNFY 1086

Query: 878  CFNKTGTLITCSLYTSGS-------LEKGPIHGGDDFNTERYSRSDELNKADNPQIKELD 930
             F+K G  I+ S + S S       L +       D      S +D    + N      D
Sbjct: 1087 SFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNN-----D 1141

Query: 931  KM-ERMWLDTCMNPEF--IEQTYDMKFPFGDLSCNCD-SGVSYFVPDATSWLRHFAHVYK 986
             M E +  + C +P++  +E+ +  +  + D   N    G +YF+ DATSWLRHFAH+YK
Sbjct: 1142 PMNELLVFNECFDPKYKTLEEFWSQEI-YPDSQTNISLQGKTYFILDATSWLRHFAHIYK 1200

Query: 987  LATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVA 1046
            +AT+ +L+FAICLTTFQELR+LRKSKD +VVEAATRA+IT+RQLY E  LLPLRFTGNVA
Sbjct: 1201 IATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVA 1260

Query: 1047 THLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK----FEALNAQAKEGGHDFIPTTEEEP 1102
            TH+EEHLEFEEQITWRSHVDEFVIEAV KA+ K       +N    E         +E+ 
Sbjct: 1261 THIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDE---------KEKS 1311

Query: 1103 FHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQI 1139
               I LV+DD  M+ KA  ++I+TFS+RF+F++ N I
Sbjct: 1312 IFGIILVTDDITMKNKAMDRKIKTFSTRFIFSMANYI 1348

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/1032 (45%), Positives = 660/1032 (63%), Gaps = 106/1032 (10%)

Query: 206  TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265
            T ++++QAL+ KLQDIY++I+ QEVELQ  CS +T SQTTDLK +W +YK+N EL+NNYV
Sbjct: 268  TWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYV 327

Query: 266  AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325
             FITTALLPSQ + DLLIGQEI+++Y+IERRLWV+GTITFLDVLK+FSNFMDPE+CCQFI
Sbjct: 328  IFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFI 387

Query: 326  THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385
             HVFISI+NM   +P+KF+ PW  RLGDLSRMA ALYP G  DWKLSAE+WY +A+ + +
Sbjct: 388  IHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTY 447

Query: 386  GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQ 445
            G GKLYYHM+TVQQN+L AF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R   + 
Sbjct: 448  GVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESS 507

Query: 446  RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGER 505
             N  +++YLKH+E+M+L +F+E+ ELQ++   +F  KFG      ++F  +++F+Q+ E 
Sbjct: 508  SNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLES 567

Query: 506  TKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSM 565
             K++FRH+P FA++HILQ+VG+GN  N                               S+
Sbjct: 568  VKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSI 627

Query: 566  EAPS---PTSPI----EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKF 618
            +  S     + I    EY  S+++    +  P ++ IW QSL + NTT I C  +VLQKF
Sbjct: 628  DTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMMVLQKF 687

Query: 619  LHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIA 678
            L GP V+A  HLLPW YFL+S+A +I+ L     + FW    R++FPWN+I+NFLN++IA
Sbjct: 688  LQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIA 747

Query: 679  FALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVD 738
            F  DN+   S ++ LCE +  + +  ++ +FS+NE+LPEVW CWG+LWFD I +KS+   
Sbjct: 748  FLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSY 807

Query: 739  EGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASV 798
             G     ++D  F D P DGI FDE+D+ G++FWKRACR++F+FKG A++F+ GL L ++
Sbjct: 808  SGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKFDQGLRLTNI 867

Query: 799  ------------PLQSRRSLAAGHPLQNFCFKFEDP-----PVDSES------YALISTQ 835
                          Q +R++       +F FKF DP     P+D  S      Y+L + +
Sbjct: 868  NSLNSEEENIFTKKQEKRNI-------DFLFKF-DPTYDLLPIDEASNKYFQVYSLFTEK 919

Query: 836  MPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTS-- 893
            +PAFE+ISE N+  +A P  S+++G+S+F+  GY++L   +  ++K G +   ++Y++  
Sbjct: 920  LPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWE 979

Query: 894  -----GSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKE-------------------L 929
                 G+  K  +  G  F        D L+ + N +I+E                   L
Sbjct: 980  AFNQLGNGLKPRMENGSSFII------DGLDDSKNFEIREKRLFAKYLECDESQESSDHL 1033

Query: 930  DKMER-----MWLDTCMNPEFIEQTY----DMKFPFGDLSCNCDSGV----SYFVPDATS 976
             ++ER            N   +++ Y    D+   F  +  N +  V    +YF+ DAT+
Sbjct: 1034 AEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFIFDATT 1093

Query: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036
            WLRHFAH+YK+A +G+L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  K++
Sbjct: 1094 WLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKKV 1153

Query: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNK--------------FEA 1082
            +PLRF G +A+H+EEHLEFEEQITWRSHV+EFVIEAV K+Q                F+A
Sbjct: 1154 IPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFDA 1213

Query: 1083 LN------AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVC 1136
             N      A  K+ G+    T  +       LV+DD NM  KA  + IRT S+RF+F++C
Sbjct: 1214 ENMDTADSADTKQRGNSNASTNSKV---LSVLVTDDRNMDSKAKERGIRTCSTRFIFSIC 1270

Query: 1137 NQIGLAHHACTN 1148
            +Q+G+ +  CTN
Sbjct: 1271 SQLGMKYGICTN 1282

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/967 (47%), Positives = 634/967 (65%), Gaps = 73/967 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ G+  
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439

Query: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNP                          
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSE-- 557

Query: 560  XXXTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                + E  S T P +       Y +++D+    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 558  ----ATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PLV A  H L W +F++++  +++ + S ++  FWI   R+  PWNSIV 
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVT 673

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
              N+++ + LDN      +    E+F S+++  L++++++NE+LPE+WKCWG LWFD I 
Sbjct: 674  LGNVLVCYMLDNL--HPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIK 731

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FDE DE G +FW R+ R V + KGIA++F +
Sbjct: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPD 786

Query: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENIS 843
            +GL +   ASV    R  +   + L+N  FK     ED   D+     +   +   E I 
Sbjct: 787  LGLKVSFQASV-FCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEINEEIE 845

Query: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903
              N+DP A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S     +  
Sbjct: 846  AVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWS----NVGN 901

Query: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963
            G   +    S  D  N  +N  +      E+++ D                   D + NC
Sbjct: 902  GVTLDVSGESIYDVAN--NNLSL----HWEKIFFDKIAAAS----------KGSDENYNC 945

Query: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023
                 YFV DATSWLRHFAH++KLA N  L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 946  ---TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRS 1002

Query: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEA- 1082
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K   +F+A 
Sbjct: 1003 VITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAE 1062

Query: 1083 -LNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGL 1141
             L  + K  G +           F  LV+DD NM  KA  + I+T +++++F++ +++G+
Sbjct: 1063 RLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGI 1111

Query: 1142 AHHACTN 1148
                CTN
Sbjct: 1112 NSGLCTN 1118

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/964 (47%), Positives = 630/964 (65%), Gaps = 67/964 (6%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IYR IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+S+ML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439

Query: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
             N    RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNP                          
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKKKSG-- 557

Query: 560  XXXTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                + E P    P +       Y +++DS    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 558  ----ATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCS 613

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PLV A  H L W +F++++  +++ + S  +  FWI   R+  PWNS+VN
Sbjct: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVN 673

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
              N+++ + LDN      ++   E+F S+++  L+++F++NE+LPE+WKCWG+LWFD I 
Sbjct: 674  LANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIK 731

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FDE DE G RFW R+ R + I KG+A++F +
Sbjct: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPD 786

Query: 791  MGLTLA-SVPLQSRRS-LAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENISE 844
            +GL +    P+  RR+ ++  + L+NF FK     E+   D+     +   +   E I  
Sbjct: 787  LGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEINEKIER 846

Query: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGG 904
             N D  A P  S++ G+++FE  GY +L  D+ CF+K G   +  +Y+  S     +  G
Sbjct: 847  VNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWS----NVGNG 902

Query: 905  DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCD 964
               +    S  D  N   +P        E+++ D                  GD + NC 
Sbjct: 903  MVLDVSSESMYDAANNNLSPH------WEKIFFDRITTAGH----------NGDKNGNCS 946

Query: 965  SGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAV 1024
                YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+V
Sbjct: 947  ---VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSV 1003

Query: 1025 ITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALN 1084
            IT+RQLY EK+++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K    F+   
Sbjct: 1004 ITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQT-- 1061

Query: 1085 AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHH 1144
                      I   + +   +  LV+DD NM  KA  + I+T +++++F++ ++IG+   
Sbjct: 1062 -------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSG 1114

Query: 1145 ACTN 1148
             CTN
Sbjct: 1115 LCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/965 (47%), Positives = 631/965 (65%), Gaps = 69/965 (7%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IYK+NTELI NY+ 
Sbjct: 199  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYIN 258

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLK+FSNFMDPEVCCQFIT
Sbjct: 259  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFIT 318

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FI ISNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 319  YAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 378

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGN-- 444
             GKLYYH++T+QQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+ GN  
Sbjct: 379  CGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTN 438

Query: 445  -----QRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
                  RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D FS + +F
Sbjct: 439  NNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMF 498

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ E  +Y+FRHAPAFAES ILQ++GFGNPKNP                          
Sbjct: 499  CQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSG-- 556

Query: 560  XXXTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
                + E P    P +       Y +++D+    + + PT++ IW  SL++IN TSI+CS
Sbjct: 557  ----AAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINMTSIQCS 612

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH PL  A  H L W +F++++  +++ + S ++  FWI   R+  PWNS+V 
Sbjct: 613  IQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMPWNSMVT 672

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
            F N+++ + LDN      ++   E+F S+++  L+++F++NE+LPEVWKCWG+LWFD + 
Sbjct: 673  FSNVLVCYMLDNL--HPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGSLWFDAVK 730

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FD+ DE G +FW R+ R +   KGIA++F +
Sbjct: 731  -KCDVMEIPG----VQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGIAKKFPD 785

Query: 791  MGLTL---ASVPLQSRRSLAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENIS 843
            +GL +   ASV    R  ++  + L+N  FK     ED   D+     +   +   E I 
Sbjct: 786  LGLKVNFQASV-FCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEINELIE 844

Query: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903
              N+D  A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +YT  S     +  
Sbjct: 845  TVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWS----NVGN 900

Query: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963
            G   +    S  D             + +   W             +D  F  G  + + 
Sbjct: 901  GVTLDVSSESLYDSTT----------NDLSLHWAKIL---------FDKVFTIGKNTDDD 941

Query: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023
             S   YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+
Sbjct: 942  GSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRS 1001

Query: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEAL 1083
            VIT+RQLY EK+++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K    F+  
Sbjct: 1002 VITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTE 1061

Query: 1084 NAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAH 1143
                K  G      ++E    F  LV+DD NM  KA  + I+T +++++F++ +++G+  
Sbjct: 1062 RTIDKNKGR-----SKE----FAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINS 1112

Query: 1144 HACTN 1148
              CTN
Sbjct: 1113 GLCTN 1117

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/970 (47%), Positives = 629/970 (64%), Gaps = 79/970 (8%)

Query: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266
            S+Q +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326
            FI TALL +QP  DL++GQEI++IY +E+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386
            + FIS+SNML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439

Query: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499
             N    +NS +++YLKH+EVMLL SFLE+ +LQ VVL +F+NKFG   N  D F  + +F
Sbjct: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499

Query: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXX 559
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNP                          
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNP------FALLFQLPKYLKLKKDKREK 553

Query: 560  XXXTSMEAP-------SPTSPIEYLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611
               ++ E P          SP  Y +++D+    + + PT+L IW +SL+HIN TSI+CS
Sbjct: 554  KRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCS 613

Query: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671
              VL KFLH P V A  H L W YFL+++  R++ + S ++  FWI   R+  PWNS+V+
Sbjct: 614  IHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVS 673

Query: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731
              N+++ + LDN      +    E F S ++  L++HF++NE+LPE+WKCWG+LWFD I 
Sbjct: 674  LANVLVCYMLDNL--HPFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIK 731

Query: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790
             K DV++       VQDH+F D P+DGI FDE DE G RFW R+ R + + KGIA++F +
Sbjct: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPD 786

Query: 791  MGLTLA-SVPLQSRRS-LAAGHPLQNFCFKF----EDPPVDSESYALISTQMPAFENISE 844
            +GL +    P+  RR+ +   + L+ F FK     E    D+     +   +   E I  
Sbjct: 787  LGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEINEKIDN 846

Query: 845  RNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGS-LEKG-PIH 902
             NLD  A P  S++ G+S+FE  GY +L  D+ CF+K G   +  +Y+  S +  G PI 
Sbjct: 847  VNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVGNGVPI- 905

Query: 903  GGDDFNTERYSRSDELNKADNPQIKELD-KMERMWLDTCMNPEFIEQTYDMKFPFGDLSC 961
              D  N   Y  +D           +L    E+++ D       I   Y           
Sbjct: 906  --DVSNEPIYDVTD----------NDLSLHWEKIFFDR------IAAAYK---------- 937

Query: 962  NCDSG---VSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVE 1018
            NCD       YFV DATSWLRHFAH++KLA N +L FAICLTTFQELR+LR SKD++VVE
Sbjct: 938  NCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVE 997

Query: 1019 AATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQN 1078
            AATR+VIT+RQLY E++++P+RFTGN+ATH+EE+LEFEEQITW++HVDEFVI+A+ K   
Sbjct: 998  AATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQ 1057

Query: 1079 KFEALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQ 1138
             F+             I   + +   F  LV+DD NM  KA  + I+T +++++F++ ++
Sbjct: 1058 NFQT---------ERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSK 1108

Query: 1139 IGLAHHACTN 1148
            +G+    CTN
Sbjct: 1109 LGINSGLCTN 1118

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1319

 Score =  507 bits (1306), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 254/344 (73%), Positives = 288/344 (83%), Gaps = 19/344 (5%)

Query: 209 QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
           +T +ALV+KLQDIY+ IVKQE+ELQERCSQLT SQTTDLKNLW IYKVN +LINNYV FI
Sbjct: 295 KTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFI 354

Query: 269 TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
           TTALL SQ +QDL IG+EI+ IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHV
Sbjct: 355 TTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHV 414

Query: 329 FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
           FIS+S ML D+P K++ PWL+RLGDLSRMAIALYPSGFIDWKLSAE WY +A+   + HG
Sbjct: 415 FISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHG 474

Query: 389 KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNS 448
           KLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN RN 
Sbjct: 475 KLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRNL 534

Query: 449 LMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI----------------SSNNT-- 490
            ++EYLKHSEVMLL +FLE+ ELQ+VVL +FQ KFGI                 +NNT  
Sbjct: 535 QLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTRT 594

Query: 491 -DYFSHQAIFLQDGERTKYFFRHAPAFAESHILQMVGFGNPKNP 533
            D F  + +F+Q+ E+ KYFFRHAPAFAESHILQ+VGFG+PKNP
Sbjct: 595 IDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNP 638

 Score =  481 bits (1237), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/627 (41%), Positives = 375/627 (59%), Gaps = 70/627 (11%)

Query: 575  EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWA 634
            E+ ++++  RF Y  P  L IW  SL+HIN  S+KCS +VL+KFLHGPL+ A  HLLPW 
Sbjct: 710  EFFQNIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 635  YFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDN-AWKTSS---- 689
            YF++S+ ++ + L   + K FWI + + +FPWN I+NFLN+++ + LDN    T S    
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 690  ---------IDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEG 740
                     I +LC ++ ++    L+ HF++NEDLPEVWKCWG LWFD IS+K+ +  + 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 741  ATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN-MGLTLASVP 799
                 ++DHMF D P+DGI +  +DETG  FWKR  R++F+FKGIA+ F+ +GL ++   
Sbjct: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949

Query: 800  LQSRRS--LAAGHPLQNFCFKFEDPPVDSESYAL----------ISTQMPAF----ENIS 843
                R+  +   + L+ F FK+     D     L          I  ++  F    E I 
Sbjct: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009

Query: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI-- 901
            E NL+   PP +SM+  + +F+  GY++L  +   F+K G   + S+YT+  ++   +  
Sbjct: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069

Query: 902  -------HGGDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKF 954
                       D  T+ ++ +  +++    Q+K  +  ++  L +  + E          
Sbjct: 1070 AQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTE---------- 1119

Query: 955  PFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDE 1014
            PF           +YFV DATSWLRHFAH+YKLA+N VL+FA+CLTTFQELRFLRKSKD 
Sbjct: 1120 PFNRYK-------TYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDA 1172

Query: 1015 SVVEAATRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVY 1074
            +VVEA+TRA+IT+RQLYS+  LLPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEAV 
Sbjct: 1173 NVVEASTRAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVM 1232

Query: 1075 KAQNKF------EALNAQAKEGGHDFIPTT----EEEP---FHFIALVSDDTNMRLKAHA 1121
            KAQ KF      E +   +  G  D   TT    EEE    F ++ L++DD +MR+KA  
Sbjct: 1233 KAQEKFVKSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQL 1292

Query: 1122 QRIRTFSSRFMFAVCNQIGLAHHACTN 1148
            + I TF ++ +F+VC+ +G+    CTN
Sbjct: 1293 KGISTFGTQVVFSVCSMMGIDEGVCTN 1319

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  476 bits (1225), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 240/371 (64%), Positives = 283/371 (76%), Gaps = 43/371 (11%)

Query: 206 TSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYV 265
           T+  +SQAL+QKLQDIY+ IVKQE++LQ+RCSQLT SQTTDLKNLW IYK+N +LINNY+
Sbjct: 390 TTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYI 449

Query: 266 AFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFI 325
            FIT ALLP+Q + DL IG+EI+ IYRIERRLWV+GTITFLDVLK+FSNFMDPEVCCQFI
Sbjct: 450 NFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFI 509

Query: 326 THVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIF 385
           +HVFI+IS +L D+P K++  WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY +A+   +
Sbjct: 510 SHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTY 569

Query: 386 GHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQ 445
            HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN GN 
Sbjct: 570 SHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNH 629

Query: 446 RNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGI-------------------- 485
           RN  ++EYLKH+EVMLL +FLES +LQ VVL +FQ KFGI                    
Sbjct: 630 RNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGAN 689

Query: 486 -----------------------SSNNTDYFSHQAIFLQDGERTKYFFRHAPAFAESHIL 522
                                  S    D F +Q +F+Q+ +  KYFFRH+  FA+SHIL
Sbjct: 690 VNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHIL 749

Query: 523 QMVGFGNPKNP 533
           Q+VGFG+PKNP
Sbjct: 750 QLVGFGDPKNP 760

 Score =  379 bits (973), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/590 (38%), Positives = 333/590 (56%), Gaps = 85/590 (14%)

Query: 575  EYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWA 634
            E+ E++D  +F Y+ P  + IW +SL +IN  S+KCS +VL+KFL+GP++ A  HLL W 
Sbjct: 867  EFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLTWI 926

Query: 635  YFLLSLAIRIDE-LPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTS----- 688
            +F++S+ ++I+  +   + K FW +  + + PWNSIVNFLN+++ + LDN    +     
Sbjct: 927  HFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKLII 986

Query: 689  SIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKS-------------- 734
            S+ N      S  +  ++  F+QNE+LPE+WKCWG LWFDVI +K+              
Sbjct: 987  SLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNNNN 1046

Query: 735  --------------DVVDEGATYNS--VQDHMFGDMPVDGICFDEDDETGSRFWKRACRL 778
                          D  D   T  +  ++DH   D P+DGI F  +DE G  F+KR+ RL
Sbjct: 1047 TTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSIRL 1106

Query: 779  VFIFKGIAQEF-NMGLTLASVPLQSRRS--LAAGHPLQNFCFKFE---DPPV-------- 824
            +F+ K + + F N+GL ++       R+  +     L NF FK     DP +        
Sbjct: 1107 IFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQTEQ 1166

Query: 825  -----------DSE-SYALISTQMPAF---ENISERNLDPNAPPGQSMLEG-KSLFELPG 868
                       D E + +++S  M  F   E I E NL+    P  S+L G +++F   G
Sbjct: 1167 NIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNYLG 1226

Query: 869  YRQLHADHTCFNKTGTLITCSLYTSGSLEKGPI-----------HGGDDFNTERYSRSDE 917
            Y++L+ +   F++ G +I+ S+Y+S  ++               H  +D   +  + +  
Sbjct: 1227 YKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVTVG 1286

Query: 918  LNKADNPQIKELDKME-RMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATS 976
                ++   KE  K+   + L T  N    + T+ M         + +   ++FV DATS
Sbjct: 1287 DITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKM-------GVSINKHRTFFVFDATS 1339

Query: 977  WLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRL 1036
            WLRHFAH+YKL+ NG L+FA+CLTTFQELRFLRKSKD +VVEA+TRA+IT+RQLY E +L
Sbjct: 1340 WLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKL 1399

Query: 1037 LPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQ 1086
            LPLRFTGNVAT +EEHLEFEEQITWRSHVDEFVIEA+ ++Q +F+  + Q
Sbjct: 1400 LPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQ 1449

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  422 bits (1084), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 268/401 (66%), Gaps = 76/401 (18%)

Query: 209 QTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFI 268
           +++Q L+QKLQ+IY+ IV QE+ELQ++C++L+ SQ+T LK LW IYK+N +LINNY+ FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 269 TTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHV 328
            T+L PSQ   D LIG+EI+ IY+IERRLW++GTITFLD+LKNF+NFMDPE+  QFITHV
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 329 FISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHG 388
           F SISNM+ D+P  F  PW +RLGDLSRMAIALYPS FIDWKLS+E+WY +++   F HG
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 389 KLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------- 441
           KLYYH+STVQQN LEAFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ERN       
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 442 ----------------GGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFG- 484
                             N +   ++EYLKHSEVMLL +FLE+  L+ VVL++F N FG 
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 485 --ISSNNTD-------------------------------------------------YF 493
             I SN +D                                                  F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 494 SHQAIFLQ-DGERTKYFFRHAPAFAESHILQMVGFGNPKNP 533
           + + IF Q + +  KYFF+++  FAESHILQ++GFG+PKNP
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNP 664

 Score =  271 bits (693), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 163/360 (45%), Positives = 210/360 (58%), Gaps = 60/360 (16%)

Query: 825  DSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGT 884
            DS +   I T +P FE  S +N D N  PG S++E +SLFE  GY++   D + F+K G 
Sbjct: 1137 DSNTERNIDTWIP-FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGE 1195

Query: 885  LITCSLYTS-------GSLEKGPI-----HGGDDFNTERYSRS------DELNKADNPQI 926
            LI+ SLYTS       GS     I     +  D+ N +  + +      +  N   N   
Sbjct: 1196 LISTSLYTSTIIDTINGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDN 1255

Query: 927  KELDKMERMWLDTCMNPEFI--------EQTYDMKFPFGDLSCNCDSGVSYFVPDATSWL 978
            KEL  ME+   +  ++P++         E  +D    F D         +YFV DATSWL
Sbjct: 1256 KELFLMEKEIFNKILDPDYKNIDEIWRGEMFHDTSIQFSD---------TYFVLDATSWL 1306

Query: 979  RHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLP 1038
            RHFAHVYKLATNG+L+FAICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQLYSEKRLLP
Sbjct: 1307 RHFAHVYKLATNGILKFAICLTTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLP 1366

Query: 1039 LRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTT 1098
            LRFTGN+ATH+EEHLEFEEQITWRSHVDEFVIEA+ +AQ     L  +      D   T+
Sbjct: 1367 LRFTGNIATHIEEHLEFEEQITWRSHVDEFVIEAIKRAQ-----LKRRDNRNQEDSNVTS 1421

Query: 1099 EEEPFH---------------FIALVSDDTNMRLKAHAQR----IRTFSSRFMFAVCNQI 1139
                                    LV+DD +M  K   ++    I TFS++F+F++CN +
Sbjct: 1422 SNNNPIINNNENNGNLNVTDMIFVLVTDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  228 bits (582), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 167/254 (65%), Gaps = 6/254 (2%)

Query: 572  SPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLL 631
            SP ++  +++S +  +  P  L IW +SL +IN  S+ CS +VL+KFL+GPL  +  H+L
Sbjct: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846

Query: 632  PWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSID 691
            PW+YF++SLA+RI+ L + E + FW+   R++FPWNSIV++LN+II+  LDN ++ S I 
Sbjct: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906

Query: 692  NLCEQFDSVDVRTLVDHFSQNE-DLPEVWKCWGALWFDVISDKSDVVDEGATYN-SVQDH 749
             L   + + ++  L+  F++NE +LPEVWKC+G+LWFDVI++   +     + N S++D 
Sbjct: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966

Query: 750  MFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFN--MGLTLASVP--LQSRRS 805
               + P+DG+ FDE +E G+ FWKR+CRL+F+FK +   FN   GLT++S      +R  
Sbjct: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRSD 1026

Query: 806  LAAGHPLQNFCFKF 819
            +   H L+ F FK 
Sbjct: 1027 IPNNHILRTFAFKL 1040

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON}
           Anc_5.706 YIL151C
          Length = 962

 Score =  129 bits (323), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 120/588 (20%), Positives = 246/588 (41%), Gaps = 112/588 (19%)

Query: 253 IYKVNTELINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNF 312
           ++K++T++++ Y  FI  AL  +  ++DL+ G+E V   R+  RL  H     L++++N+
Sbjct: 147 LFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENY 206

Query: 313 SNFM----------DPEVCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALY 362
            N M          + +   +FI    I I++ML ++P KF   W   +GDL+R+ + L 
Sbjct: 207 KNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLS 266

Query: 363 PSGFIDWKLSAEHWY-----TQALSHIFGHGK----------LYYHMSTVQQNTLEAFVN 407
                 ++L++ H Y       A+++   +GK           Y+++S VQ ++L   V 
Sbjct: 267 VKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVT 326

Query: 408 LGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQR---NSLMVEYLKHSEVMLLSS 464
           L K +   +T +  +   QL ID I  +   ++    Q     +++++Y       LLS 
Sbjct: 327 LSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQVNLKQSMGGTTILMKYFT-----LLSL 381

Query: 465 FLESPE------LQKVVLSFFQNKFGISSNNTDYFSHQAIFL--------QDGERTKYFF 510
           F  S        +++  L +F N+F     N  + ++ ++          ++   + ++F
Sbjct: 382 FFGSTSSSQLSGMERSSLHYFWNEFA----NEYHLNYSSLRKPVNCKYRQKEINYSMFYF 437

Query: 511 RHAPAFAESHILQMVGFGNPKNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSMEAPSP 570
            +AP F+   I++ +      N                                      
Sbjct: 438 NNAPLFSLISIVETIIMNKKLN-------------------------------------- 459

Query: 571 TSPIEYLESVDSPRF-VYEFPTDLAI-------WQQSLSHINTTSIKCSAVVLQKFLHGP 622
                       P F VY+   D  I       W+  +  ++ T +  + ++ +KFL   
Sbjct: 460 ------------PFFCVYKSSDDFEIKSVSLSNWKILIEQMDDTLLHSNKLLFKKFLMLN 507

Query: 623 LVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALD 682
           +  +   +LPW  F +S+A  +  +    +   W  L + + PW+ IV +LN  I     
Sbjct: 508 VAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLNESIDMVNK 567

Query: 683 NAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGAT 742
           ++  + ++  L +   S  +  L+ +     +  E+  C G +WFD ++ K  +     T
Sbjct: 568 HSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLASK--IKQASIT 625

Query: 743 YN-SVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF 789
            N S+      +   D + +D+DD+  ++ W RA  ++ + K +  ++
Sbjct: 626 TNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDY 673

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 968  SYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRK-SKDESVVEAATRAVIT 1026
            +YF+ D  +WL+H   + +      ++  + ++   +L  L+  S+ ESV  +A+R +I 
Sbjct: 802  NYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIV 861

Query: 1027 VRQLYSEKRLLPLR 1040
            +  LY+  ++  L+
Sbjct: 862  INYLYAMNQINILK 875

>TPHA0D04440 Chr4 (957641..959617) [1977 bp, 658 aa] {ON} Anc_1.133
           YJL201W
          Length = 658

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 56/113 (49%), Gaps = 11/113 (9%)

Query: 380 ALSHIFGHGKLYYHMST-VQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 438
           ALSH+    +L   ++  +    +  ++++    F R T I ++QY QL+ D I++R   
Sbjct: 169 ALSHLIDITRLRISLNVYLHDYDISEYIDVPDEYFGRMTTIGTKQYKQLIFDKIFKRLRV 228

Query: 439 E---------RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
           E         + G  ++ +++++ ++ S  + LS + +   L  V  +F +NK
Sbjct: 229 ESVANELVFQKPGSYKKVNILLDIIERSNYIDLSQW-DIYSLASVFFNFLKNK 280

>TDEL0C05740 Chr3 (1030530..1032287) [1758 bp, 585 aa] {ON}
           Anc_1.133 YJL201W
          Length = 585

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 48/90 (53%), Gaps = 10/90 (11%)

Query: 402 LEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE---------RNGGNQRNSLMVE 452
           ++ ++++ +  F R + + S+QY QLV D I++R   E         R G  +R +++++
Sbjct: 174 IDDYIDVPQEYFSRLSPLGSRQYRQLVFDRIFKRLELEAPTTELVFQRPGSYKRVNILLD 233

Query: 453 YLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
            ++ +  + LS + +   L  + L F +NK
Sbjct: 234 IIERNNYIDLSQW-DIYSLASIFLHFLKNK 262

>Kpol_2001.58 s2001 complement(162456..164357) [1902 bp, 633 aa]
           {ON} complement(162456..164357) [1902 nt, 634 aa]
          Length = 633

 Score = 32.3 bits (72), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 55/113 (48%), Gaps = 11/113 (9%)

Query: 380 ALSHIFGHGKLYYHMSTVQQN-TLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFA 438
            LSH+    +L   ++    +  L  ++++    F R T + ++QY QL+ D +++R   
Sbjct: 153 GLSHLIDITRLRISLNVYMHDYELSEYIDVPSEYFGRLTTLGNRQYRQLIFDKVFKRLQL 212

Query: 439 E---------RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNK 482
           E         + G  ++ +++++ ++ S  + LS + +   L  + L F +NK
Sbjct: 213 EGINYPMVFQKPGSYKKVNILLDIIERSNYIDLSQW-DIYSLASIFLHFLKNK 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,362,756
Number of extensions: 4974513
Number of successful extensions: 12631
Number of sequences better than 10.0: 32
Number of HSP's gapped: 12757
Number of HSP's successfully gapped: 69
Length of query: 1148
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1027
Effective length of database: 39,606,813
Effective search space: 40676196951
Effective search space used: 40676196951
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)