Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00946g5.707ON2152159591e-133
Kwal_55.196755.707ON2322164736e-59
SAKL0E15026g5.707ON290103880.006
KLTH0B09262gsingletonON82061711.3
NOTE: 15 genes in the same pillar as KLTH0E00946g were not hit in these BLAST results
LIST: Kpol_1043.74 ZYRO0B16434g Skud_9.16 Smik_9.17 YIL152W NCAS0G00210 TBLA0I01690 KAFR0D02200 Suva_9.36 TDEL0B02130 KLLA0A00506g KNAG0L02160 TPHA0E00180 NDAI0F00270 Cgla_YGOB_Anc_5.707

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00946g
         (215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...   374   e-133
Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 1...   186   6e-59
SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa] ...    39   0.006
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    32   1.3  

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score =  374 bits (959), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 186/215 (86%), Positives = 186/215 (86%)

Query: 1   MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKLRSPPNTXXXXXXXXX 60
           MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKLRSPPNT         
Sbjct: 1   MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKLRSPPNTPASAKSPAS 60

Query: 61  XXXXXISRSRPKSHDGSLRSVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNRL 120
                ISRSRPKSHDGSLRSVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNRL
Sbjct: 61  LLSNAISRSRPKSHDGSLRSVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNRL 120

Query: 121 LKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLPS 180
           LKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLPS
Sbjct: 121 LKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLPS 180

Query: 181 TKDAEPKXXXXXXXXXXXXXXXYPGLRWYFEWRVI 215
           TKDAEPK               YPGLRWYFEWRVI
Sbjct: 181 TKDAEPKSGSQLLLSSNASALLYPGLRWYFEWRVI 215

>Kwal_55.19675 s55 (74607..75305) [699 bp, 232 aa] {ON} [contig 159]
           FULL
          Length = 232

 Score =  186 bits (473), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 133/216 (61%), Gaps = 3/216 (1%)

Query: 1   MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKLRSPPNTXXXXXXXXX 60
           M  +T+++D ASN+F+N++ L+S+ERKPLQP+ VNISQLVASQK  +   T         
Sbjct: 1   MNSDTQSRDHASNLFKNITALSSRERKPLQPKSVNISQLVASQKQDNAHKTVSVRAATPT 60

Query: 61  XXXXXISRSRPKSHDGSLR-SVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNR 119
                IS+SRPKS    +R SVA+VIGS +HL      Y  R KKRY+    A  AL+  
Sbjct: 61  SLSTLISKSRPKSGHSPMRFSVARVIGSRHHLAHAPAQYGIRPKKRYEQ--EASGALIRH 118

Query: 120 LLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLILHMLP 179
           L KCV++ ET+ RLQRHG++TH+YDR+L VQY K LSPTE LAVA+   G+E+LILH   
Sbjct: 119 LFKCVNSLETSWRLQRHGVATHQYDRRLRVQYFKSLSPTEDLAVASSSTGQEILILHRTS 178

Query: 180 STKDAEPKXXXXXXXXXXXXXXXYPGLRWYFEWRVI 215
                  +               YPGLRWYF+W+ +
Sbjct: 179 LRDSISLRAGSELMLDSSSSLLLYPGLRWYFQWQAV 214

>SAKL0E15026g Chr5 complement(1250249..1251121) [873 bp, 290 aa]
           {ON} conserved hypothetical protein
          Length = 290

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 43/103 (41%), Gaps = 11/103 (10%)

Query: 115 ALVNRLLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAVAAGPLGREVLI 174
           +++ RL K +  F T  +L  H +S   YD  L V  T+ LSP ELL +++       ++
Sbjct: 187 SMLFRLQKSLCDFNTVYKLSSH-VSKPNYDIVLTVDCTQQLSPDELLVISSE--CAHAIV 243

Query: 175 LH-----MLPSTKDAEPKXXXXXXXXXXXXXXXYPGLRWYFEW 212
           LH       P T   E                 YPGL WY  W
Sbjct: 244 LHRFKNKAFPRT---EKHRVLKLHLDSRSEIELYPGLYWYSNW 283

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 820

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 75  DGSLRSVAQVIGSDYHLTPTKPHYRARAKKRYDLAFPAGKALVNRLLKCVSAFETNRRLQ 134
           DG+L S  Q +G D  +T        R+     L+     AL++  L+C +A ET+ RL 
Sbjct: 283 DGNLHSFVQFVGMDQLITTACAELLTRSTLSEFLSIEYADALLS-FLECKTALETSDRLC 341

Query: 135 R 135
           +
Sbjct: 342 K 342

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,522,032
Number of extensions: 623296
Number of successful extensions: 1378
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1393
Number of HSP's successfully gapped: 8
Length of query: 215
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 110
Effective length of database: 41,441,469
Effective search space: 4558561590
Effective search space used: 4558561590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)