Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00902g5.708ON54454429530.0
Kwal_55.196635.708ON54454426460.0
SAKL0E15048g5.708ON54254425160.0
KLLA0A00484g5.708ON54354524750.0
TDEL0B021205.708ON54854624490.0
AFR292W5.708ON54154424140.0
YKR097W (PCK1)5.708ON54954624070.0
Ecym_40135.708ON54254424010.0
Smik_11.3615.708ON54954623980.0
NCAS0A031605.708ON55254223940.0
KNAG0C066405.708ON54753523830.0
Suva_11.3345.708ON54854723780.0
Skud_11.3375.708ON54954623720.0
ZYRO0B16456g5.708ON54854623680.0
NDAI0E050805.708ON55154923550.0
KAFR0H001605.708ON54954423470.0
CAGL0H06633g5.708ON54453423400.0
TBLA0E017005.708ON57654922300.0
TPHA0E001705.708ON57852022250.0
Kpol_1043.755.708ON55855822110.0
Suva_7.275singletonON961111554e-12
TPHA0A052705.75ON152630732.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00902g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...  1142   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...  1023   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   973   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   957   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   947   0.0  
AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...   934   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   931   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...   929   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   928   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   926   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   922   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   920   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   918   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   916   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   911   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   908   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   905   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   863   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   861   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   856   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    64   4e-12
TPHA0A05270 Chr1 complement(1185683..1190263) [4581 bp, 1526 aa]...    33   2.7  

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/544 (100%), Positives = 544/544 (100%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
           TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 541 GPVL 544
           GPVL
Sbjct: 541 GPVL 544

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/544 (88%), Positives = 512/544 (94%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSP+K RN VS KD IR+ELALGEEVVTIRRNAPAALLYEDALKENKT I++SGALIAFS
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           GSKTGRSPKDKRIVDEPTS+ NIWWGPVNKKCSEKTWLVNRERAAD+LRTRDHLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIRVVCARAYHALFMTNMLI+PT +ELE FGEPDFTVWNAGQFPANTHTDG
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           MTSKTT+EINFQKMEMVILGTEYAGEMKKGIFTVMFYLMP+NH VLTLHSSANQGIRD D
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AI+FGSVLENVAYD  TR VD+E+CEITENTRCAYPIEYIPSAKIPCLA+ HPKNIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTP QVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLA+KMS H+A+AWLINTGWTG SFVDGG+RCPLKYTRAILDA+HDG+LA+E++ETLP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
           TF LH+P HVNNVP +ILNPA++W  GE KYK +V  LA LF ENFKKY+  AS +++ A
Sbjct: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540

Query: 541 GPVL 544
           GP+L
Sbjct: 541 GPLL 544

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/544 (83%), Positives = 494/544 (90%), Gaps = 2/544 (0%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSP+KT  + SA+  IR EL L +EVVTIRRNAPAALLYEDALKE KTTI+SSGALIA+S
Sbjct: 1   MSPSKT--YASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           G KTGRSP+DKRIVDE TST N+WWGPVNKKCSE+TW +NRERAADYLRTRDHLYIVDAY
Sbjct: 59  GEKTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIK+RVVCARAYHALFMTNMLIRPT++EL  FGEPDFTVWNAGQFPANTHT G
Sbjct: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTG 178

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           MTSKTTVEINF++MEM+ILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI D D
Sbjct: 179 MTSKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADND 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGL+  KEPEI+N
Sbjct: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYN 298

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AIKFGSVLENV Y+P TR VDYED  ITENTRCAYPI+YIPSAKIPCLA++HP NIVLLT
Sbjct: 299 AIKFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLT 358

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVS+LTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 359 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKM++H ANAWLINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA+E +ETLP
Sbjct: 419 ATMLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLP 478

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
           TF L +P  VNNVP  +LNPAKNW EGE KY   V  LA+LF ENFK YQDRA++ V+SA
Sbjct: 479 TFNLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSA 538

Query: 541 GPVL 544
           GP L
Sbjct: 539 GPQL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/545 (82%), Positives = 493/545 (90%), Gaps = 3/545 (0%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSPTKT+N  SA+++IR EL L  EVVTIRRNAPAALLYEDALKE  T I+++GALIA+S
Sbjct: 1   MSPTKTQN--SAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           G KTGRSP+DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTRDH+YIVDAY
Sbjct: 59  GDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIK+RVVCARAYHALFMTNMLIRP+KEELENFGEPDFTVWNAGQFPANTHT G
Sbjct: 119 AGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSG 178

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           MTSKTTVEINF++MEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI+D D
Sbjct: 179 MTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDND 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKC+GL+  KEPEIFN
Sbjct: 239 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFN 298

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AIKFGSVLEN+ YDP TR VDYED  ITENTRCAYPIEYIPSAKIPCLA+ HPKNIVLLT
Sbjct: 299 AIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLT 358

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFL+LHP+KY
Sbjct: 359 CDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKY 418

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKM++H ANAWLINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLA+E++E LP
Sbjct: 419 ATMLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLP 478

Query: 481 TFRLHVPRHV-NNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVIS 539
            F L +P+ V + VP  +LNP+KNW EGE KY   V +LA LF ENFK YQD+A+  V++
Sbjct: 479 IFNLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLA 538

Query: 540 AGPVL 544
           AGP L
Sbjct: 539 AGPQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/546 (81%), Positives = 487/546 (89%), Gaps = 4/546 (0%)

Query: 1   MSPTKTRNHVS----AKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56
           MSP+K    V+     +  IR EL+L  EV+TIRRNAPAA+LYEDAL E KTTIASSGAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116
           IA+SG KTGRSPKDKRI++E TS  NIWWGPVNK   EKTW +NRERAADYLRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176
           VDA+AGWDPRYRIK+RVVCARAYHALFMTNMLIRPT EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236
           HT GM+SKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           +  DVTLFFGLSGTGKTTLSADP RKLIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356
           EI+NAIKFGS+LENV YDP TR VDYED  ITENTRCAYPIE+IPSAKIPCLA+SHP+N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           VLLTCDASGVLPP+SKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476
           P++YATMLA+KMS+HRANAWLINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLA+E +
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536
           ETLPTF LH+P  VN VP+ +LNP+KNW EGE KY   V  LAKLF ENFK YQDRA+ +
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 537 VISAGP 542
           V++AGP
Sbjct: 541 VLAAGP 546

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/544 (80%), Positives = 485/544 (89%), Gaps = 3/544 (0%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSP+K   + + ++ IR EL L   V+TIRRNAPAA+LYEDAL E KT I+S+GALIA+S
Sbjct: 1   MSPSKV--YQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           G KTGRSPKDKRIVDEPTS+ NIWWGPVN+K SEKTWL+NRERAAD+LRTR+HLYIVDAY
Sbjct: 59  GEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAY 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIR+VC RAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFPANTHT+G
Sbjct: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           M+SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  + D
Sbjct: 179 MSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNND 237

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSAD  RKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 238 VTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFN 297

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AIK+GSVLENV YDP+TRVVDYED  ITENTRCAYPIEYIPSA+IPCL+ +HP NIVLLT
Sbjct: 298 AIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLT 357

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVS+LTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 358 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 417

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKMSQH A+AWLINTGWTG+S+  GG RCPLKYTRAILD++HDG+LAQ ++ETLP
Sbjct: 418 ATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLP 477

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
            F L +P+ V  VP  +LNPAKNW EGE KY   V ALA  FTENFK YQD+A+ +V+ A
Sbjct: 478 VFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRA 537

Query: 541 GPVL 544
           GP +
Sbjct: 538 GPQI 541

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/546 (79%), Positives = 484/546 (88%), Gaps = 4/546 (0%)

Query: 1   MSPTKTRNHVSA----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56
           MSP+K    V +    +  IRQELAL +EV TIRRNAPAA+LYED LKENKT I+SSGAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236
           HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356
           EIF+AIKFGSVLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKNI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476
           P++YATMLA KMSQH+ANA+LINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA E +
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536
           ETLP F L VP  VN VP  +LNPAKNW +GE+KY+  V  LA LF +NFK YQDRA+ D
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 537 VISAGP 542
           V++AGP
Sbjct: 541 VLAAGP 546

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/544 (79%), Positives = 478/544 (87%), Gaps = 2/544 (0%)

Query: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60
           MSP+K     S ++ IR EL L   V+ IRRNAPAALLYEDAL E  T I+S+GALIA+S
Sbjct: 1   MSPSKVFQ--SPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYS 58

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           G KTGRSPKDKRIVDEPTS + +WWGPVN+K SE+TW +NRERA DYLRTR+HLYIVDA+
Sbjct: 59  GEKTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAF 118

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDPRYRIKIR+VC RAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFPANTHT+G
Sbjct: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           M+SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQGI   D
Sbjct: 179 MSSKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGD 238

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSAD  R LIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 239 VTLFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFN 298

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           AI++GSVLENV Y+P++RVVDY+D  ITENTRCAYPIEYIPSAKIPCL+NSHP NIVLLT
Sbjct: 299 AIRYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLT 358

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 359 CDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 418

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKMSQH ANAWLINTGWTGAS+V GG RCPLKYTRAILDA+H GSLA  D+ETLP
Sbjct: 419 ATMLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLP 478

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
            F L +PR V  VP  +LNP++NW EGE KY   V +LA LF +NFK YQD+A+ +V+ A
Sbjct: 479 VFGLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYA 538

Query: 541 GPVL 544
           GP L
Sbjct: 539 GPQL 542

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/546 (79%), Positives = 483/546 (88%), Gaps = 4/546 (0%)

Query: 1   MSPTKTRNHVSA----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56
           MSP+K    V +    +  IRQELAL +EV TIRRNAPAA+LYED LKE KT I+SSGAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236
           HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356
           EIF+AIKFG+VLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476
           P++YATMLA KMSQH+ANA+LINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA E +
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536
           E+LP F L VP  V  VP  +LNPAKNW +GETKYK  V +LA LF ENFK YQDRA+ D
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 537 VISAGP 542
           V++AGP
Sbjct: 541 VLAAGP 546

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/542 (78%), Positives = 477/542 (88%)

Query: 3   PTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGS 62
           P    +    +  IR+EL L E+V TIRRNAPAA+LYEDAL E KT IASSGALIA+SGS
Sbjct: 11  PIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIASSGALIAYSGS 70

Query: 63  KTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAG 122
           KTGRSP+DKRIV+E TS  N+WWGPVNK CSEKTW +NRERAADYLRTRDHLYIVDA+AG
Sbjct: 71  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRDHLYIVDAFAG 130

Query: 123 WDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMT 182
           WDP+YRIK+RVVCARAYHA+FMTNMLIRPT+EEL  FGEPDFT+WNAGQFPAN +T  M+
Sbjct: 131 WDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQFPANKNTQDMS 190

Query: 183 SKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVT 242
           SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV HN+LTLHSSANQGI++ DVT
Sbjct: 191 SKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSANQGIQNGDVT 250

Query: 243 LFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAI 302
           LFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFNAI
Sbjct: 251 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSAEKEPEIFNAI 310

Query: 303 KFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCD 362
           K+GS+LENV YD  TRVVDY+D  ITENTRCAYPIEYIPSAKIPCLA+SHPKNI+LLTCD
Sbjct: 311 KYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCD 370

Query: 363 ASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYAT 422
           ASGVLPPVSKLTP QVMYHFISGYTSK+AGTEEGVTEPE+TFSSCFGQPFLALHP++YAT
Sbjct: 371 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPFLALHPIRYAT 430

Query: 423 MLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTF 482
           MLAEK+S H A+AWLINTGWTG+S+V+GG RCPLKYTRAILD++HDGSLA++ +ETLP F
Sbjct: 431 MLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLAKQSYETLPIF 490

Query: 483 RLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGP 542
            L VP  VN VP+ ILNPAKNW EGE KY   V  L  LF ENFK YQDRA+ DV++AGP
Sbjct: 491 NLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDRATPDVLAAGP 550

Query: 543 VL 544
            +
Sbjct: 551 QI 552

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  922 bits (2383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/535 (79%), Positives = 477/535 (89%)

Query: 10  VSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPK 69
           +S +  IR+EL L +EV+TIRRNAPAA+LYEDAL E KT IASSGALIA+SG KTGRSPK
Sbjct: 13  ISVEQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPK 72

Query: 70  DKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRI 129
           DKRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTRDHLYIVDA+AGWDP+YRI
Sbjct: 73  DKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRI 132

Query: 130 KIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEI 189
           K+RVVCARAYHALFMTNMLIRP+KEEL NFGEPDFTVWNAGQFPAN HT  M+SK+T+EI
Sbjct: 133 KVRVVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEI 192

Query: 190 NFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSG 249
           NF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI++ DVTLFFGLSG
Sbjct: 193 NFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSG 252

Query: 250 TGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLE 309
           TGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AI+FGSVLE
Sbjct: 253 TGKTTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLE 312

Query: 310 NVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPP 369
           NVAYD  +  VDY+D  ITENTRCAYPIEYIPSAKIPCLA+SHPKNI+LLTCDASGVLPP
Sbjct: 313 NVAYDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPP 372

Query: 370 VSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMS 429
           V+KL+P QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALHP++YA MLA KMS
Sbjct: 373 VAKLSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMS 432

Query: 430 QHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRH 489
           +H+ANA+LINTGWTG+S+V GG RCPLKYTRAILDA+HDGSLAQ ++E+LP F L VP  
Sbjct: 433 EHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTA 492

Query: 490 VNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544
           VN VP  +LNPAKNW +GE KY   V  LA LF ENFK YQD+A+ DV++AGP+L
Sbjct: 493 VNGVPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGPIL 547

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  920 bits (2378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/547 (78%), Positives = 483/547 (88%), Gaps = 6/547 (1%)

Query: 1   MSPTKTRNHVSA-----KDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGA 55
           MSP+K  N V+      +  IRQELAL +EV TIRRNAPAA+LYED LKE KT I+SSGA
Sbjct: 1   MSPSKM-NAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGA 59

Query: 56  LIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLY 115
           LIA+SG KTGRSPKDKRIV+EPTS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+Y
Sbjct: 60  LIAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIY 119

Query: 116 IVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPAN 175
           IVDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN
Sbjct: 120 IVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPAN 179

Query: 176 THTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQG 235
            HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSANQG
Sbjct: 180 LHTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQG 239

Query: 236 IRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKE 295
           I++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD+GVFNIEGGCYAKCI L+  KE
Sbjct: 240 IKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKE 299

Query: 296 PEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKN 355
           PEIF+AI+FG+VLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKN
Sbjct: 300 PEIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKN 359

Query: 356 IVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLAL 415
           I+LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLAL
Sbjct: 360 IILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLAL 419

Query: 416 HPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQED 475
           HP++YATMLA KMSQHRANA+LINTGWTG+S+V GG+RC LKYTRAILD++HDGSLA+  
Sbjct: 420 HPIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKAS 479

Query: 476 FETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASA 535
           +E+LP F L VP  VN VP  +LNPAKNW +GE KYK  V  LA LF ENFK YQDRA+ 
Sbjct: 480 YESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATP 539

Query: 536 DVISAGP 542
           DV++AGP
Sbjct: 540 DVLAAGP 546

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/546 (78%), Positives = 479/546 (87%), Gaps = 4/546 (0%)

Query: 1   MSPTK----TRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56
           MSP+K    T +    +  IRQELAL +EV TIRRNAPAA+LYED LKE KT I+SSGAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116
           IA+SG KTGRSPKDKRIV+E TS   IWWGPVNK CSE+TW +NRERAADYLRTRDH+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176
           VDA+AGWDP+YRIK+RVVCARAYHALFMTNMLIRPT+EEL +FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236
           HT  M+SK+T+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
           ++ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI L+  KEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356
           EIF+AIKFG+VLENV YD  + VVDY+D  ITENTRCAYPI+YIPSAKIPCLA+SHPKNI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           +LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476
           P++YATMLA KMS H++NA+LINTGW+G+S+V GG RCPLKYTRAILD++HDGSLA E +
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536
           E+LP F L VP  V  VP  +LNPAKNW +GE KYK  V  LA LF ENFK YQDRA+ D
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 537 VISAGP 542
           V++AGP
Sbjct: 541 VLAAGP 546

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/546 (78%), Positives = 473/546 (86%), Gaps = 4/546 (0%)

Query: 1   MSPTKT----RNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGAL 56
           MSP+K      +    ++ IR+ELALG EVVTIR NAPAA LYED LKE KT + SSGAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 57  IAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYI 116
            A+SGSKTGRSPKDKRI++E TS + +WWGPVNK  SEKTW +NRERAADYLRTRDHLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 117 VDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANT 176
           +DAYAGWDPRYRIK+RV+CARAYHALFMTNMLIRP+ EEL NFGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 177 HTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGI 236
           +T+GMTSKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSSANQGI
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 237 RDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEP 296
              DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCI LT  KEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 297 EIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNI 356
           EI+NAIKFGSVLENV +D   R VDY D  ITENTRCAYPI+YIPSAKIPCLA+ HP NI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 357 VLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALH 416
           VLLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 417 PLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDF 476
           P++YATMLA+KM QH ANAWL+NTGWTG+S+  GG RCPLKYTRAILD++HDGSL++ D+
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 477 ETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASAD 536
           ETLP F LH P  VN VP+ +LNPAK+W EG TKY   V  LA  FTENFK YQD+A+ D
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 537 VISAGP 542
           V++AGP
Sbjct: 541 VLAAGP 546

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/549 (77%), Positives = 477/549 (86%), Gaps = 7/549 (1%)

Query: 1   MSPTKTRN-------HVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASS 53
           MSP K  N           +  IRQEL L ++V TIRRNAPAA+LYEDAL E  T I+S+
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 54  GALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDH 113
           GAL+A+SG KTGRSP+DKRIV+E TS  +IWWGPVNK CSE+TW +NRERAADYLRTRDH
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 114 LYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFP 173
           LYIVDA+AGWDP YRIK+RVVCARAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 174 ANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSAN 233
           AN HT  M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 234 QGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEA 293
           QGIR+ DVTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 294 KEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHP 353
           KEPEIF AIK+GS+LENV YDP TRVV Y+D  +TENTRCAYPIE+IPSAKIPCLA++HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 354 KNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFL 413
            NI+LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 414 ALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQ 473
           ALHP++YATMLA+K+S+H ANAWLINTGWTG+S+V GG RCPLKYTRAILD++HDGSLA+
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 474 EDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRA 533
           ++FETLP F L VP +VNNVP+ +LNPAKNW +GE KY   V  LA LF ENFK YQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 534 SADVISAGP 542
           + +V++A P
Sbjct: 541 TPEVLAAAP 549

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/544 (77%), Positives = 478/544 (87%), Gaps = 3/544 (0%)

Query: 2   SPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASS-GALIAFS 60
           +P K  N V  K  IRQEL L   V TIRRNAP ++LYEDALK+ K TI SS GALIA+S
Sbjct: 8   TPLKDLNAVEQK--IRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTGALIAYS 65

Query: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120
           G KTGR PKDKRIV+E  S  +IWWGPVNK CSE+TW +NRERAADYLRTR+H+YIVDA+
Sbjct: 66  GEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHIYIVDAF 125

Query: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180
           AGWDP+YRIK+RVVCARAYHALFMTNMLIRPTK+ELENFG+PDFTVWNAGQFPAN HT+ 
Sbjct: 126 AGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPANFHTED 185

Query: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240
           M+SKTT+EINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSAN+GI  +D
Sbjct: 186 MSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANEGIEKKD 245

Query: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300
           VTLFFGLSGTGKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIFN
Sbjct: 246 VTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEKEPEIFN 305

Query: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360
           +IKFGS+LENV YDP +R VDY+D  ITENTRCAYPIE+IPSAKIPC+ANSHPKNI+LLT
Sbjct: 306 SIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPKNIILLT 365

Query: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420
           CDASGVLPPVSKLT  QVMYHFISGYTSK+AGTE+GVTEP+ TFSSCFGQPFLALHP+KY
Sbjct: 366 CDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLALHPMKY 425

Query: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480
           ATMLAEKM +H+ANAWLINTGWTG+S++ GG RCPL YTRAILDA+HDGSL +E FETLP
Sbjct: 426 ATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKESFETLP 485

Query: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540
            F L VP++VNNVP  +LNP+KNW+EGE KY   V  L+KLF ENFK Y+D+A+ +V++A
Sbjct: 486 IFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKATKEVLAA 545

Query: 541 GPVL 544
           GP L
Sbjct: 546 GPRL 549

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  905 bits (2340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/534 (78%), Positives = 470/534 (88%)

Query: 11  SAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPKD 70
           S ++ IR EL L +EV  IRRNAPAA+LY+DALKE KT I+S+GALIA+SG KTGRSPKD
Sbjct: 11  SVEERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKD 70

Query: 71  KRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRIK 130
           KRIV+E TS  N+WWGPVNK CSE+TW +NRERAADYLRTR+ LY+VDA+AGWDP+YRIK
Sbjct: 71  KRIVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIK 130

Query: 131 IRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEIN 190
           +RVVCARAYHALFMTNMLIRPT+EEL NFGEPDFTVWNAGQFPAN  T  MTSKTT+EIN
Sbjct: 131 VRVVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEIN 190

Query: 191 FQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSGT 250
           F+ MEMVILGTEYAGEMKKGIFTVMFYLMPV+HNVLTLHSS NQGI++ DVTLFFGLSGT
Sbjct: 191 FKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGT 250

Query: 251 GKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLEN 310
           GKTTLSADP R LIGDDEHCWSD GVFNIEGGCYAKCI L+  KEPEIF+AI+FGSVLEN
Sbjct: 251 GKTTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLEN 310

Query: 311 VAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPPV 370
           V YD  +  VDY+D  ITENTRCAYPI++IPSAKIPCLA +HPKNI+LLTCDASGVLPPV
Sbjct: 311 VIYDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPV 370

Query: 371 SKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMSQ 430
           SKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFSSCFGQPFL+LHP++YATMLAEKM +
Sbjct: 371 SKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHE 430

Query: 431 HRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRHV 490
           H ANAWLINTGWTG+S+V GG RC LKYTRAILDA+HDGSLA+ +FE+LP F L VP+ V
Sbjct: 431 HSANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAV 490

Query: 491 NNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544
             VP  +LNPA+NW EGE KY+  V  LA LF ENFK YQD+A++DV++AGP L
Sbjct: 491 EGVPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/549 (73%), Positives = 462/549 (84%), Gaps = 8/549 (1%)

Query: 2   SPTKTRNHVSAKDHIRQEL----ALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALI 57
           +P+  +  +S +D +  +L    +    ++ I+ N  AA+LYEDALKE KT I+SSGALI
Sbjct: 26  NPSLKKQKLSMEDQLLSQLNWDGSKDSSLINIKHNPSAAILYEDALKEPKTVISSSGALI 85

Query: 58  AFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIV 117
           A+SG+KTGRSPKDKRIV E  S  N+WWGPVNK CSEKTW +NRER  DYL TR +LY++
Sbjct: 86  AYSGAKTGRSPKDKRIVYEDGSKDNVWWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVI 145

Query: 118 DAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTH 177
           DAY GWDPRYR+K+RVVCARAYHALFMTNMLIRPT+EEL+NF EPDFTVWNAG F AN++
Sbjct: 146 DAYVGWDPRYRLKVRVVCARAYHALFMTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSY 205

Query: 178 TDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIR 237
           T  MTSKT+VEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN+GI 
Sbjct: 206 TADMTSKTSVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIE 265

Query: 238 DQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPE 297
            +DVT+FFGLSGTGKTTLSADP R LIGDDEHCWSDHGVFNIEGGCYAKCIGLT  KEPE
Sbjct: 266 KKDVTVFFGLSGTGKTTLSADPNRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPE 325

Query: 298 IFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIV 357
           IF+AI+FGSVLENV Y+ L   VDY DC ITENTRCAYPI+YI SAKIPCLANSHPKN++
Sbjct: 326 IFDAIRFGSVLENVTYNELNHKVDYNDCAITENTRCAYPIDYIKSAKIPCLANSHPKNLI 385

Query: 358 LLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHP 417
           LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP
Sbjct: 386 LLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP 445

Query: 418 LKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFE 477
           + YATMLA+KM Q+++NAWLINTGWTG+S+  GG+RCPLKYTRAILDA+HDG+LA E++E
Sbjct: 446 ITYATMLAKKMDQYKSNAWLINTGWTGSSYSAGGSRCPLKYTRAILDAIHDGTLANENYE 505

Query: 478 TLPTFRLHVPRHVNNVPEHILNPAKNWFEGETK----YKHRVGALAKLFTENFKKYQDRA 533
           TLP F L +P HVN VP  ILNP  +W     K    Y   V  LA LF ENFK YQD+A
Sbjct: 506 TLPVFNLQIPTHVNGVPNEILNPENSWNSPANKNNISYNKAVNKLAALFVENFKIYQDKA 565

Query: 534 SADVISAGP 542
           + DV++AGP
Sbjct: 566 TDDVLAAGP 574

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  861 bits (2225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/520 (75%), Positives = 452/520 (86%)

Query: 25  EVVTIRRNAPAALLYEDALKENKTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIW 84
           +++ I+RN P A LYED LKENKTT++S+GALIA+SG KTGRSPKDKRIV+E  S  NIW
Sbjct: 59  QLINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIW 118

Query: 85  WGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFM 144
           WGPVNK+CSE+TW +NRERA DYL TRD LY++DA+ GWDPRYRIKIRVVCARAYHALFM
Sbjct: 119 WGPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFM 178

Query: 145 TNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYA 204
            NMLIRPTKEELENFG+PDFTVWNAGQF AN+ T+ M+SKT+VEINF++MEM ILGTEYA
Sbjct: 179 NNMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYA 238

Query: 205 GEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLI 264
           GEMKKGIFTVMFYLMP+ HNVLTLHSSANQ   + DVTLFFGLSGTGKTTLSADP R+LI
Sbjct: 239 GEMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLI 298

Query: 265 GDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYED 324
           GDDEHCWSD+GVFNIEGGCYAKCIGL++ KEP+IFNAIKFGSVLEN  YD  T  VDY++
Sbjct: 299 GDDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDN 358

Query: 325 CEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFIS 384
             ITENTRCAYPI+YI +AKIPCLA+ HP N++LLTCDASGVLPPVSKLTP QVMYHFIS
Sbjct: 359 STITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFIS 418

Query: 385 GYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTG 444
           GYTSK+AGTE GVTEP+ TFSSCFGQPFLALHP+KYA+MLAEKM +H+ANAWL+NTGWTG
Sbjct: 419 GYTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTG 478

Query: 445 ASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNW 504
           +S+V GG+RCPLKYTRAILDA+HDGSL  E++ETLP F L +P++ N VP  +LNPA +W
Sbjct: 479 SSYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSW 538

Query: 505 FEGETKYKHRVGALAKLFTENFKKYQDRASADVISAGPVL 544
            +    Y   V  L KLF ENFK Y+D+A+ +VI AGPVL
Sbjct: 539 TDSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGPVL 578

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/558 (71%), Positives = 461/558 (82%), Gaps = 14/558 (2%)

Query: 1   MSPTKTRNH-VSAKDHIRQELALGEEV-------------VTIRRNAPAALLYEDALKEN 46
           M+PTK  ++ ++ +++I + L     V             +TI+RN P A LYED LKE+
Sbjct: 1   MAPTKIEDYSLNERENIIKNLKSNSNVKLDNVMKCLYNKDITIKRNPPIAELYEDGLKED 60

Query: 47  KTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAAD 106
            TT++S+GAL+A+SG KTGRSPKDKRIV+EP+S  NIWWGPVNK CSE TW +NRERA D
Sbjct: 61  STTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWGPVNKPCSELTWSINRERAID 120

Query: 107 YLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTV 166
           YL TR  LY++DAYAGWD  YRIKIRVVCAR YHALFM NMLIRPT EELENFGEPDFT+
Sbjct: 121 YLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNNMLIRPTTEELENFGEPDFTI 180

Query: 167 WNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVL 226
           WNAG F AN+ T  MTSKT++EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPV HNVL
Sbjct: 181 WNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGEMKKGIFTVMFYLMPVYHNVL 240

Query: 227 TLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAK 286
           TLHSSANQG+ + DVTLFFGLSGTGKTTLSADP R+LIGDDEHCWSDHGVFNIEGGCYAK
Sbjct: 241 TLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGDDEHCWSDHGVFNIEGGCYAK 300

Query: 287 CIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIP 346
           CIGLTE KEPEIFNAIKFGSVLEN  YD  T VVDY+D  ITENTRCAYPI++I SAKIP
Sbjct: 301 CIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSRITENTRCAYPIDFIESAKIP 360

Query: 347 CLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSS 406
           CL + HP N++LLTCDASGVLPPVSKLTP QVMYHFISGYTSK+AGTE+GVTEPE TFS+
Sbjct: 361 CLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSA 420

Query: 407 CFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAV 466
           CFGQPFLALHP+KYA MLA+KM+ H+A+AWLINTGWTGAS+  GG RCPLKYTRAILDA+
Sbjct: 421 CFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGASYTAGGKRCPLKYTRAILDAI 480

Query: 467 HDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENF 526
           H+GSLA E++ETLP F L +P++V NVP  +LNP+K W + +  Y   V  L  LF +NF
Sbjct: 481 HNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSDPDVTYSQAVKKLGSLFVQNF 540

Query: 527 KKYQDRASADVISAGPVL 544
             YQD+A+ DVI+AGP L
Sbjct: 541 TIYQDQATDDVIAAGPAL 558

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 64.3 bits (155), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/111 (39%), Positives = 59/111 (53%), Gaps = 18/111 (16%)

Query: 373 LTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKYATMLAEKMSQHR 432
           LT  +VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 433 ANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLPTFR 483
            +A+LINTG+             LK TR   D++HD SLA+E F   PT++
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRA-PTYK 93

>TPHA0A05270 Chr1 complement(1185683..1190263) [4581 bp, 1526 aa] {ON}
            Anc_5.75 YHR164C
          Length = 1526

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 237  RDQDVTLFFGLSGTGKTTLSADPARKLIGD 266
            R +D  L  G+ GTGKTTL A+  R ++G+
Sbjct: 1075 RAEDYALVLGMPGTGKTTLIAEIIRHIVGN 1104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,830,012
Number of extensions: 2592128
Number of successful extensions: 6076
Number of sequences better than 10.0: 24
Number of HSP's gapped: 6190
Number of HSP's successfully gapped: 24
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)