Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00880g5.709ON37137120030.0
Kwal_55.196615.709ON37137113950.0
SAKL0E15070g5.709ON38538911491e-156
TDEL0B021105.709ON38934410941e-148
Kpol_2001.775.709ON41334810401e-140
NCAS0G002005.709ON43838810411e-139
Skud_9.155.709ON40235510331e-139
YIL153W (RRD1)5.709ON39339810261e-138
Suva_9.355.709ON39333310201e-137
Smik_9.165.709ON39332810131e-136
AFR293C5.709ON3653179981e-134
ZYRO0B16478g5.709ON3913919881e-132
Ecym_40125.709ON3953789881e-132
NDAI0F002405.709ON4643289891e-131
TPHA0D046505.709ON4213819531e-126
CAGL0H06655g5.709ON4243569411e-124
TBLA0E016905.709ON4883609271e-121
KLLA0A00462g5.709ON3533499031e-120
KAFR0D021905.709ON4263809051e-119
KNAG0L021705.709ON3963858611e-113
NDAI0E024108.674ON3592984516e-52
Ecym_23998.674ON3512554375e-50
KLTH0D11176g8.674ON3533004368e-50
ZYRO0F07326g8.674ON3522984306e-49
CAGL0M02255g8.674ON3582984238e-48
NCAS0C016908.674ON3592984221e-47
KAFR0H024408.674ON3533074151e-46
Kpol_1013.48.674ON3582994151e-46
ACR139C8.674ON3593304097e-46
Smik_6.3498.674ON3582984081e-45
SAKL0H06622g8.674ON3552984036e-45
Skud_16.1308.674ON3583354036e-45
TPHA0D012408.674ON3592954028e-45
KLLA0F11187g8.674ON3602964029e-45
YPL152W (RRD2)8.674ON3582984002e-44
Suva_16.1588.674ON3583353984e-44
TDEL0A062008.674ON3552933974e-44
KNAG0J016908.674ON3633013898e-43
Kwal_26.87838.674ON3553003843e-42
TBLA0C018608.674ON3563003792e-41
YOR296W8.765ON1289137713.6
NCAS0A114603.419ON870128704.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00880g
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   776   0.0  
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   541   0.0  
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   447   e-156
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   426   e-148
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   405   e-140
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      405   e-139
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   402   e-139
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   399   e-138
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   397   e-137
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   394   e-136
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   389   e-134
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   385   e-132
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   385   e-132
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      385   e-131
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   371   e-126
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   367   e-124
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   361   e-121
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   352   e-120
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   353   e-119
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   336   e-113
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   178   6e-52
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   172   5e-50
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   172   8e-50
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   170   6e-49
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   167   8e-48
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   167   1e-47
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   164   1e-46
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   164   1e-46
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   162   7e-46
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   161   1e-45
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   159   6e-45
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   159   6e-45
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   159   8e-45
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   159   9e-45
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   158   2e-44
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   157   4e-44
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   157   4e-44
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   154   8e-43
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   152   3e-42
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   150   2e-41
YOR296W Chr15 (870202..874071) [3870 bp, 1289 aa] {ON} Putative ...    32   3.6  
NCAS0A11460 Chr1 complement(2268077..2270689) [2613 bp, 870 aa] ...    32   4.4  

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/371 (100%), Positives = 371/371 (100%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60
           MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN
Sbjct: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60

Query: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120
           HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS
Sbjct: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120

Query: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180
           IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL
Sbjct: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180

Query: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240
           VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK
Sbjct: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240

Query: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300
           TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH
Sbjct: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300

Query: 301 FWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQMNPPNLRGIN 360
           FWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQMNPPNLRGIN
Sbjct: 301 FWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQMNPPNLRGIN 360

Query: 361 RLTSQDRFRRE 371
           RLTSQDRFRRE
Sbjct: 361 RLTSQDRFRRE 371

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 297/371 (80%), Gaps = 2/371 (0%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60
           M  ++ID  + TFTEP KRIFDSRG+HVFQSSVAM RLK +LHKY+  +SG +IP  ++N
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSN 60

Query: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120
             V S  ++L   S+LVD TPALPGPRRYGNLACR WHDK++E +   L +FLPE  + S
Sbjct: 61  PNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPS 120

Query: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180
           IVEL YYLGNAFGSRERLDYGTGHELSFF+ ICALDMLG+WG+ FQA D+L+LF++YY+L
Sbjct: 121 IVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSL 180

Query: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240
           VRKL+  Y+LEPAGSHGVWGLDDHFHLIYIFGASQW D K A  +PRE+Q K+IVDEY  
Sbjct: 181 VRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAG 240

Query: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300
           +NFYCQAISFIF+VKSGPFSEHSPML+DISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH
Sbjct: 241 SNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300

Query: 301 FWFGTGLFPWTSLGDGYALPTYEASQEAQGQV-LQHTTAPAPTNLNSARRQMNPPNLRGI 359
           FWFGT LFPWTS   G  LPTYE SQE   Q  L   T   P+ +   R  MNPP+LR +
Sbjct: 301 FWFGTALFPWTSTDGGDVLPTYEVSQETDTQAQLPRMTQHQPS-MTKLRHPMNPPHLRNV 359

Query: 360 NRLTSQDRFRR 370
           +R  + DR ++
Sbjct: 360 SRFIAHDRLKK 370

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  447 bits (1149), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 218/389 (56%), Positives = 269/389 (69%), Gaps = 27/389 (6%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60
           ++  +ID S   FTEP K+IFD++G+  FQSSV M RL+SYLHKY++ +    IP TS N
Sbjct: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNN 64

Query: 61  HEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKS 120
             V  F +++  LS  +D TP LPGPRR+GN ACRTWH K+  SL+ALL  F+PE  H  
Sbjct: 65  DAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVC 124

Query: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180
           IVE++YYLGNAFGS+ERLDYGTGHELSF A + A+DML +WG++    D+LFLF+ YY L
Sbjct: 125 IVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDILFLFNGYYTL 184

Query: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240
           V+KL+ TYTLEPAGSHGVWGLDDHFHL YI G+SQ       P+ P ++ D+  V++Y K
Sbjct: 185 VKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAK 244

Query: 241 TNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQH 300
           TN Y QAI+FI +VKSG FSEHSPML+DI+++V TWSKVQRGLLKMY AEVLNKFPVVQH
Sbjct: 245 TNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQH 304

Query: 301 FWFGTGLFPWTSLGDGYALPTYEASQE----------------AQGQVL---QHTTAPAP 341
           FWFGTG FPW ++  G  LPTYEA+QE                A   VL     TT P P
Sbjct: 305 FWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPPP 364

Query: 342 TNLNSARRQMNPPNLRGINRLTSQDRFRR 370
           T L S    M         +  ++DRF+R
Sbjct: 365 TILPSRNSPM--------GKFANRDRFKR 385

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 243/344 (70%), Gaps = 2/344 (0%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTN 60
           +S  RID S   F  P K IFDS+G+  FQ SVA+ RLK +L KY   + G  I    + 
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSG 61

Query: 61  HEV-RSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHK 119
            EV      LL  LSELVD TP   GPRRYGNLACR WHDK+D +L  LL + LP+  HK
Sbjct: 62  IEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHK 121

Query: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179
            I EL YYLGN+FGS  RLDYGTGHELSF A + ALDMLG+W ++F   DVL LFD YY 
Sbjct: 122 CIPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDVLLLFDTYYK 181

Query: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239
           LVRKL+LTYTLEPAGSHGVWGLDDHFH+IYI G+SQW      P+ PR+V++K++V +Y 
Sbjct: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYA 241

Query: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299
            TN YCQAI FIF VKSGPFSEHS ML+DI+ +V TWSKVQ GLLKMY+ EVL KFPVVQ
Sbjct: 242 DTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQ 301

Query: 300 HFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTN 343
           HFWFG G +PW S  +G  LP YE ++  + Q    TT  AP+N
Sbjct: 302 HFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTM-APSN 344

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  405 bits (1040), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 246/348 (70%), Gaps = 12/348 (3%)

Query: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72
           F  P KRI+DS+G+ +FQSSVA+ RLK ++ KY+  +  V IP+ S   E+ +  +L+K 
Sbjct: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74

Query: 73  LSEL---VDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPE-------PCHKSIV 122
           +SEL   VD TP  PGPRR+GNL+CR WH KVD +L++LL K L +        C  S+V
Sbjct: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134

Query: 123 ELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVR 182
           EL YYLGN+FGS  RLDYGTGHELSF A I  +DMLG+W  + +  D+L +F++YY L++
Sbjct: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLMK 194

Query: 183 KLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTN 242
           KL+LTYTLEPAGSHGVWGLDDHFH  YI G++QW +    P+ P ++ +K +V EY  TN
Sbjct: 195 KLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANTN 254

Query: 243 FYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFW 302
            YC AI FI  VKSGPFSEHSPML+DIS+SV  WSKV+ GLLKMY  EVLNKFPVVQHFW
Sbjct: 255 MYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQHFW 314

Query: 303 FGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQ 350
           FGTGLFPW       +LP YE   +A+     HT +P+P+ L  + R+
Sbjct: 315 FGTGLFPWIDNNTKKSLPLYE--NDAKKTTSIHTKSPSPSPLGISTRR 360

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  405 bits (1041), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 205/388 (52%), Positives = 259/388 (66%), Gaps = 35/388 (9%)

Query: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEV-- 63
           +D  +  F+ P KRIFDS+ +  FQSS+A+ RL+ +L KY+S ++ V+ P   T   V  
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 64  -RSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHK----FLPE--- 115
             S  +LL  LS L+D TP L GPRRYGNLACR WH K++  L ALL++    +LP+   
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 116 ---PCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLF 172
                H  I EL YY+ NAFGS  RLD+GTGHELSF A I A+DMLG+W    Q +D+L 
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 173 LFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDK 232
           LF+ YYALVRKL+LTYTLEPAGSHGVWGLDDHFHL YI G+SQW+  + AP+ PR+V+D 
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVKDI 270

Query: 233 LIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVL 292
            +V +Y K+N YCQ I+FIFQVKSGPFSEHSP+L+DI+ SV TWSKVQRGL+KMY  EVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 293 NKFPVVQHFWFGTGLFPWTSLGDGYALPTYEAS-----QEAQGQVLQH------------ 335
            KFPVVQHFWFG G +PW +   G  LP YE S      E + ++ Q+            
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390

Query: 336 TTAPAPT---NLNSARRQMNPPNLRGIN 360
           T  P  T   ++ + R  M PP+ R +N
Sbjct: 391 TAKPGITAMPSVTNTRTNMAPPSSRMMN 418

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  402 bits (1033), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 254/355 (71%), Gaps = 11/355 (3%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56
           MSL+ +D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 10  MSLDHVDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAA 69

Query: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116
           +S+   V     +L  L++L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 70  SSSIAMVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAE 129

Query: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LGV+    + +DV  LF+K
Sbjct: 130 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVF-PHLRGNDVFLLFNK 188

Query: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PREV DK +
Sbjct: 189 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAR-APLQPREVLDKSL 247

Query: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V +Y  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 248 VHDYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 307

Query: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARR 349
           FPVVQHFWFGTG FPW ++ +G  LP +E   E + + ++   A +P   +++ R
Sbjct: 308 FPVVQHFWFGTGFFPWVNIQNGTDLPVFE---EKEDETIEQANAASPGPNHTSTR 359

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  399 bits (1026), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 206/398 (51%), Positives = 264/398 (66%), Gaps = 33/398 (8%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56
           MSL+R+D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + +S    P+    
Sbjct: 1   MSLDRVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHAT 60

Query: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116
            S+   V     +L  L+ L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 61  ASSIAMVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSE 120

Query: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176
            H+ + ELQYYLGN+FGS  RLDYGTGHELSF A + ALDMLG++    + +DV  LF+K
Sbjct: 121 YHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNK 179

Query: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PRE+ DK +
Sbjct: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPREILDKSL 238

Query: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYKDTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298

Query: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTY---------EASQEAQGQVLQHTTAPAPTNLN 345
           FPVVQHFWFGTG FPW ++ +G  LP +         +A+  + G+    T  P  T++ 
Sbjct: 299 FPVVQHFWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANAGSPGREQTSTRFPTSTSMP 358

Query: 346 SARRQMNPPNLRGINRLT-------------SQDRFRR 370
                  PP+   IN L              S+DR RR
Sbjct: 359 PPGV---PPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/333 (57%), Positives = 240/333 (72%), Gaps = 8/333 (2%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56
           MSL+ +D   A F+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 1   MSLDHVDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHAT 60

Query: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116
            S+   V     +L   ++L+D TP LPGPRRYGNLACR WH K+D  L   L + LP  
Sbjct: 61  ASSIPMVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQ 120

Query: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LG++    + +DV  LF K
Sbjct: 121 YHAVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSK 179

Query: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234
           YYA++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PR+V DK +
Sbjct: 180 YYAIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPRDVLDKSL 238

Query: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  TNFYCQ I+FI QVK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYQDTNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQK 298

Query: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTYEASQE 327
           FPVVQHFWFGTG FPW ++ +G  LP +E  +E
Sbjct: 299 FPVVQHFWFGTGFFPWINVQNGTDLPVFEEKEE 331

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 189/328 (57%), Positives = 239/328 (72%), Gaps = 8/328 (2%)

Query: 1   MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE---- 56
           MSL+ +D   ATF+ P KRIFD++ +  FQSS+A+ R+K +LHKY + MS    P+    
Sbjct: 1   MSLDHVDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAV 60

Query: 57  TSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP 116
            S+        ++L  L+ L+D TP LPGPRRYGNLACR WH K+DE L   L + LP  
Sbjct: 61  ASSIPMDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPE 120

Query: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDK 176
            H  + ELQYYLGN+FGS  RLDYGTGHELSF A + ALD+LG++    + +DV  LF+K
Sbjct: 121 YHVVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNK 179

Query: 177 YYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQW--VDGKCAPIAPREVQDKLI 234
           YY ++R+L+LTYTLEPAGSHGVWGLDDHFHL+YI G+SQW  +D + AP+ PRE+ DK +
Sbjct: 180 YYTIMRRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQ-APLQPREILDKSL 238

Query: 235 VDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNK 294
           V EY  TNFYCQ I+FI +VK GPF EHSP+L+DI+ +VP WSKV +GLLKMY  EVL K
Sbjct: 239 VREYKNTNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKK 298

Query: 295 FPVVQHFWFGTGLFPWTSLGDGYALPTY 322
           FPVVQHFWFGTG FPW ++ +G  LP +
Sbjct: 299 FPVVQHFWFGTGFFPWVNIQNGTNLPVF 326

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 230/317 (72%), Gaps = 2/317 (0%)

Query: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72
           F+ P KRIFD+ G+H FQ S+ M RL+S+L +Y+  + G KIP++S N  V  F  +L+ 
Sbjct: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVCILER 69

Query: 73  LSELVDSTPALPG-PRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           L  L+D TP   G  RR+G+LACR WHD++   L+ LL   LPE   +S  EL+YYLG+A
Sbjct: 70  LDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGAD-FQASDVLFLFDKYYALVRKLVLTYTL 190
           FGSRERLDYGTGHEL+F A + ALDMLG+W  D F   D+L+++ +YYALV +L+LTY L
Sbjct: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDDH HL YI GASQW   +  P+ P ++ D   V  Y++TN YC +I+F
Sbjct: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249

Query: 251 IFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFPW 310
           + +VK+G F++HSPML DI+++VPTWSKV  GL+KMY  EVLNKFPVVQHFWFGTG FPW
Sbjct: 250 LLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFPW 309

Query: 311 TSLGDGYALPTYEASQE 327
             +  G +LP YEA  E
Sbjct: 310 VDMAHGMSLPNYEAPSE 326

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/391 (48%), Positives = 247/391 (63%), Gaps = 23/391 (5%)

Query: 3   LERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE-TSTNH 61
           +  +   +  F  P KRIFDS+ +  FQ+SVA+ RLK ++ KY   ++ V IP+  S   
Sbjct: 1   MRMLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRIS 60

Query: 62  EVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSI 121
            V  F  +L  +S LVD TP L GPRRYGNLACR WH K+DE + +L  K LP+  H  I
Sbjct: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCI 120

Query: 122 VELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALV 181
           VEL +YLGN+FGS  RLDYGTGHELSF A + A+DMLG++  +FQ  D L + + YYA+V
Sbjct: 121 VELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIMNAYYAVV 180

Query: 182 RKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKT 241
           RKL+LTYTLEPAGSHGVWGLDDHFHL Y+FG++QW + K AP+ PR++ +  +V EY   
Sbjct: 181 RKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHL 240

Query: 242 NFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHF 301
           N YCQ I FI+QVK GPF EHS ML+D++ +V TW+K++ GL+KMY  EVLNKFPVVQHF
Sbjct: 241 NLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHF 300

Query: 302 WFGTGLFPWTSLGDGYALPTYEASQEAQGQV-----------------LQHTTAPAPTNL 344
           WFGTG +PW     G  L  Y+ +   +                    + H  AP+ T  
Sbjct: 301 WFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTTAA 360

Query: 345 NS-----ARRQMNPPNLRGINRLTSQDRFRR 370
           +      AR +M PP  R  N     D  +R
Sbjct: 361 SEARAPPARTRMGPPTARTTNSTAHHDLTKR 391

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 248/378 (65%), Gaps = 30/378 (7%)

Query: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRS 65
           ++     F+ P KRIFDS G+H FQ S+ M RL+S+L +Y+  +   ++P+ STN  V S
Sbjct: 3   VELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSVSS 62

Query: 66  FAEL-LKTLSELVDSTPALPG-PRRYGNLACRTWHDKVDESLEALLHKFLP-------EP 116
           F  + L    EL+D TP     PRR+GN+ACR WH KV E +++L  +FLP       E 
Sbjct: 63  FVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYEN 122

Query: 117 CHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVW-----GADFQASDVL 171
           C   I+EL+YYLGNAFGS ERLDYGTGHELSF A + A+DMLG+W     G     +D+L
Sbjct: 123 C---IIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLL 179

Query: 172 FLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVD-GKCAPIAPREVQ 230
           +L++KYY++V KL+LTYTLEPAGSHGVWGLDDH HL YI GASQW D  + API   ++ 
Sbjct: 180 YLWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDIL 239

Query: 231 DKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAE 290
           D   + +Y  TN YC +I+F+ +VKSGPFS+HSPML+DISR+VPTWSK   GL+KMY  E
Sbjct: 240 DMKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVE 299

Query: 291 VLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYE-------ASQEAQGQVLQHTTAPAPTN 343
           VLNKFPVVQHFWFGTG FPW  +  G +LP YE         +   G   + +T   PT 
Sbjct: 300 VLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACKERAVDGDASEDSTTAVPTA 359

Query: 344 LNSARR-----QMNPPNL 356
             S+ +      M PP +
Sbjct: 360 TGSSGKLTTSAAMPPPRM 377

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  385 bits (989), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 230/328 (70%), Gaps = 9/328 (2%)

Query: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNH---- 61
           +D  +  F+ P KRIFDS+ +  FQSS+A+ RL+ +L +Y+  ++ V+IP    ++    
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 62  -EVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEP-CHK 119
             V S   LL  LS +V  TP L GPRRYGNLACR WH K++  L  LL K +P P    
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179
           SI+EL YY+ N+FGS  RLDYGTGHELSF A I ALDMLG++  D    D+L +F+ YY+
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLF-PDLTGKDLLIMFNAYYS 192

Query: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239
           LVR+L+LTYTLEPAGSHGVWGLDDHFHL YI G+SQW++   AP+ P+E+ +  +V +Y+
Sbjct: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN--APLTPKEITNSRLVKDYS 250

Query: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299
             N YCQ I F+  VKSGPF+EHSP+L+DIS SV  W KVQRGL+KMY  EVLNKFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 300 HFWFGTGLFPWTSLGDGYALPTYEASQE 327
           HFWFGTG +PW +      LP YE S E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  371 bits (953), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/381 (48%), Positives = 242/381 (63%), Gaps = 17/381 (4%)

Query: 3   LERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHE 62
           L  I+    +F+ P KRI+DS+ +  FQSS+A+ RLK YLHKY++ +  V+IP+ +   E
Sbjct: 4   LSTINIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSE 63

Query: 63  ---VRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHK 119
              V   + LL  LS  +D+ P   GPRRYGNLACR WH  +D  +  LL K L    H 
Sbjct: 64  ITIVNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHA 123

Query: 120 S-----------IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQAS 168
           +           I+EL YYL N+ GS  RLDYGTGHELSF A I A+DMLG+W  +F+  
Sbjct: 124 TEKGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGV 183

Query: 169 DVLFLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPRE 228
           D+L +F  YY LV+KL++TYTLEPAGSHGVWGLDDHFHL YI G+SQ  +    P +P +
Sbjct: 184 DLLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSD 243

Query: 229 VQDKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYF 288
           + +K IV EY   NFYC  I FI++VKSGPFSEHSP+L+DIS +V +W KV  GL+KMY 
Sbjct: 244 IINKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYM 303

Query: 289 AEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHT-TAPAPTNLNSA 347
            EVLNKFPVVQHFWFG G +PW ++     L  Y      +  V   + ++  P N  + 
Sbjct: 304 VEVLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNK 363

Query: 348 RRQMNPPNLRGINRLTSQDRF 368
            R +N  N   +NR+  Q+R+
Sbjct: 364 DRSVN-QNPSQLNRI-PQNRY 382

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  367 bits (941), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 241/356 (67%), Gaps = 12/356 (3%)

Query: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72
           F+EP KRI+DS+G++ FQSS A+ RL+  + KY   +    + +   +  V    ++L  
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLDR 61

Query: 73  LSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPE--PCH-KSIVELQYYLG 129
           L +LV  TP +PGPRRYGN+ACR WH+K++  +  LL   +    P   + +VEL+YYL 
Sbjct: 62  LDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYLA 121

Query: 130 NAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLVLTYT 189
           N+FGS  RLD+GTGHELSF A + ALDMLG   A F    VL++FD+YY+LV +L+L+YT
Sbjct: 122 NSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVHRLILSYT 178

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAIS 249
           LEPAGSHGVWGLDDHFHL YI G+SQW + K   + P ++ D ++V++Y++TN +C+ ++
Sbjct: 179 LEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKTLN 238

Query: 250 FIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFP 309
           F+F VKSG F EHSPMLFDISRSV TW+KV++GL KMY  EVLNKFPV+QHFWFGTG +P
Sbjct: 239 FVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGFYP 298

Query: 310 WTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSAR----RQMNPPNLRGINR 361
           W    +G  LP YE S +        T A A  N++  R    R ++P N   + R
Sbjct: 299 WVDYKNGKPLPNYENSPDIDETNDLKTQAQA--NMDGTRVVESRFLSPGNETFVRR 352

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  361 bits (927), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 175/360 (48%), Positives = 234/360 (65%), Gaps = 25/360 (6%)

Query: 9   SSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPET---STNHEVRS 65
           S+  F+ PTK+IFDS+G+  F  S+A  R++ ++ KY   +    IP T   S+N  +  
Sbjct: 11  SNCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISG 70

Query: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHK-----S 120
            ++++  L +LV+ TP LPGPRRYGNL+CR WH +VD+++  L  K+L     K      
Sbjct: 71  VSKIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQL 130

Query: 121 IVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYAL 180
            +EL YY   + GS  RLDYGTGHELSF A I ALDML +   D   +D+LF+F++YY L
Sbjct: 131 FLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLL-TDISGTDILFIFNEYYRL 189

Query: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKC-------------APIAPR 227
           +RKL+L YTLEPAGSHGVWGLDDHFHLIYIFG+SQW                  API P 
Sbjct: 190 IRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPV 249

Query: 228 EVQDKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMY 287
           ++ +K +++++  +NFYCQ+I FI  VK+GPF EHSP+LFDI+++V  W KV+ GLLKMY
Sbjct: 250 DILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMY 309

Query: 288 FAEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSA 347
             EVLNKFPVVQHFWFGTG +PW +      LPTYE + +         T   PT+L+ +
Sbjct: 310 MVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTY---TINKPTDLSKS 366

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  352 bits (903), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 235/349 (67%), Gaps = 12/349 (3%)

Query: 7   DASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPET-STNHEVRS 65
           D  +A F+ P KRIFDS+G+  FQ+SVAM R++ +L KY++   G +IP+T   +     
Sbjct: 4   DYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFFTNI 63

Query: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQ 125
             ELLK LS L+D TP      RYGNL+ R W  K    LE  LH+ LPE  + SI+EL 
Sbjct: 64  VVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSIIELS 123

Query: 126 YYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLV 185
           YY+ NAFGS+ER+DYGTGHELSF A I  LDML +     +   +L+ F+ YY +++KL+
Sbjct: 124 YYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFNSYYDVIQKLI 181

Query: 186 LTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYC 245
           LTY LEPAGSHGVWGLDDHFH  YI GA+Q +D   + I P+++ +  ++++ + +N +C
Sbjct: 182 LTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLI-PKDISNTRLMEQNSSSNLFC 240

Query: 246 QAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGT 305
           ++I FI  VKSGPFS HSP+L++ISRSV TW K+Q+GL+KMY  EVLNKFPVVQHFWFGT
Sbjct: 241 KSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFWFGT 300

Query: 306 GLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQMNPP 354
             FPWTS G+ ++LP Y+ ++          TA      N+A  +M PP
Sbjct: 301 AFFPWTSYGNNHSLPIYQPAENNDDA--DFLTA------NNATTKMPPP 341

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/380 (48%), Positives = 239/380 (62%), Gaps = 16/380 (4%)

Query: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIP--ETSTNHEV 63
           +D  ++ F+ P KRIFDS+ +  FQ SVA  RLK + +KY++ + GV +P     T    
Sbjct: 10  VDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTIT 69

Query: 64  RSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDE----SLEALLHKFLPEPCHK 119
           R   +LL   S+ +D TP L  PRR+GNL+CRTWHDK++      L+ ++  F       
Sbjct: 70  RYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENEN 129

Query: 120 SIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYA 179
              EL YYL N+FGS+ RLDYGTGHELSF A I  +DM+ +   D  A D L ++  YY 
Sbjct: 130 MFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRML-QDMTADDFLLIWQSYYN 188

Query: 180 LVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYT 239
           L RKL+LTYTLEPAGSHGVWGLDDHFHL YIFG+SQ +    + +AP+++  K +V E+ 
Sbjct: 189 LTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKKDVVAEHK 247

Query: 240 KTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQ 299
           + N YCQAI+FIF VK GPF+EHSP+L+DIS++V +WSKV +GLLKMY  EVLNKFPVVQ
Sbjct: 248 ENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQ 307

Query: 300 HFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPT----NLNSARRQ----M 351
           HFWFG G FPW     G  LP +E S+         T  P+ T    + N AR      M
Sbjct: 308 HFWFGDGFFPWKDNNSGKDLPVFEHSEGESPNPAIMTMMPSSTETMASFNLARSSKSPIM 367

Query: 352 NPPNLRGINRLTSQDRFRRE 371
           NP     ++R  S  +  RE
Sbjct: 368 NPNYKMSMHRPPSLSKNSRE 387

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  336 bits (861), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 231/385 (60%), Gaps = 24/385 (6%)

Query: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRS 65
           +D   A F +P KRIFDS+ +  FQ SVA+ R++ ++ KY+  M G      S +  V  
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGISAS--VAR 73

Query: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQ 125
             ++L  L  LVD TP L GPRRYGNLACR WHDKVD SL  L  +        + +E +
Sbjct: 74  MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAE 133

Query: 126 YYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLV 185
           YYL N+FGS+ RLDYGTGHELSF A + ALDM+          ++  L+D+YY LVR+L+
Sbjct: 134 YYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSRLWDRYYRLVRRLI 192

Query: 186 LTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVD-EYTKTNFY 244
           + Y LEPAGSHGVWGLDDHFHL Y++GASQ+ +     + PR+V   +I   +    NF 
Sbjct: 193 VDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG-VQPRDVLSGVIPGRDDAPANFL 251

Query: 245 CQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
            +AI F+  VK GPF E+SPML DI   V +W K+QRGL +MY AEVLNKFPVVQHFWFG
Sbjct: 252 VEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFG 311

Query: 305 TGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAP-------------TNLNSARRQM 351
           T  FPWTS+ DG  LP YE S + + +       P P              ++ S R  M
Sbjct: 312 TAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTSTMASVPSRRPAM 371

Query: 352 NPPNLRGINRL------TSQDRFRR 370
            PP  R +N+       + +DR RR
Sbjct: 372 GPPAGRQVNKFIQHTTASHRDRLRR 396

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  178 bits (451), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 103/298 (34%), Positives = 166/298 (55%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+       ++++S     L  ++     ++ G +  + S   +  + +  ++L ++
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 74  SELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            +++D  P L      R+G    R ++D+++E  E L+H+  P   H+ + +L  YL  +
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G+++R+DYG+GHEL+F   +  L    V   D  A + VL +F KY  ++R L   Y L
Sbjct: 123 WGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + ++ +V+ + K   Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAYQLATHK--HLKPLSIHNEELVEMFAKKYLYFGCIAF 240

Query: 251 IFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I  VK +     HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 241 INSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYFSEFL 297

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  172 bits (437), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/255 (38%), Positives = 149/255 (58%), Gaps = 6/255 (2%)

Query: 56  ETSTNHEVRSFAELLKTLSELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFL 113
           E   + ++ +   LL T++++VD  P +   G  R+G +  R ++D+V E+ + L+    
Sbjct: 45  EQPISSQIENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLS 104

Query: 114 PEPCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFL 173
            E   + + EL  Y   ++G R+R+DYG+GHEL+F   +  L    V     + + VL +
Sbjct: 105 SELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKV 164

Query: 174 FDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKL 233
           F KY  ++R L   Y LEPAGSHGVWGLDD+  L ++FGA Q    K   + P+ + +  
Sbjct: 165 FIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPKSIHNPE 222

Query: 234 IVDEYTKTNFYCQAISFIFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVL 292
           IV+ + K   Y + ++FI +VK +     HSPML DIS  V TWSKV  G++KMY AEVL
Sbjct: 223 IVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEVL 281

Query: 293 NKFPVVQHFWFGTGL 307
            K P++QHF+F T L
Sbjct: 282 GKLPIMQHFFFSTFL 296

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  172 bits (436), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 161/300 (53%), Gaps = 11/300 (3%)

Query: 15  EPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE--TSTNHEVRSFAELLKT 72
           +P KR+       ++  S     L S+L     S+ G++  E    T   + S  +LL+ 
Sbjct: 2   KPQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQKPTGSSIESCCQLLEE 61

Query: 73  LSELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGN 130
           ++ L +  P        R+G +  R ++D +    + L+ +           EL  Y   
Sbjct: 62  VASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEELSVYFAE 121

Query: 131 AFGSRERLDYGTGHELSFFAEICALDMLGVWG--ADFQASDVLFLFDKYYALVRKLVLTY 188
           ++G R R+DYG+GHEL+F   +  L   GV+   AD++ + VL LF KY  ++R L   Y
Sbjct: 122 SWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYR-NMVLKLFIKYLGVMRTLETKY 180

Query: 189 TLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAI 248
            LEPAGSHGVWGLDD+  L ++FGA Q    K   + P+ + +  +V+ + K   Y   I
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK--HLKPKSIHNSEVVEMFGKRYLYFGCI 238

Query: 249 SFIFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
            FI +VK+      HSPML DIS  V TW+KV  G++KMY AEVLNK P++QHF+FG+ L
Sbjct: 239 DFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFGSFL 297

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  170 bits (430), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 164/298 (55%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIP--ETSTNHEVRSFAELLKTL 73
           P KR+  ++   ++  S  M  L  ++     S+ G +    +   + ++    +LLK +
Sbjct: 3   PEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDMEPTMQLLKKV 62

Query: 74  SELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           ++L+D  P +      R+G +  R ++D +    E L+    P      + EL  YL  +
Sbjct: 63  NDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAVYLYES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   I  L +  V+  +  A+D VL +F +Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q        + P+ + ++ +V+ +     Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAHQL--ATHPHLRPKSIHNEEVVEMFMDKYIYFGCIAF 240

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I  VKS      HSPML DIS  V TW+KV  G++KMY AEVL+K P++QHF+FG  L
Sbjct: 241 INSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFGNIL 297

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  167 bits (423), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 161/298 (54%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P+KRI   +   +++ S     + S++     ++ G +  + S   +  V+S   +L  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 74  SELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            +L+   P +      R+G +  R ++D V E  + LL    P    + I +L  YL  +
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L    ++     A + VL LF +Y  ++R++   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P+ + ++ +V+ +     Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLAPHK--HLKPKSIHNEELVEMFADKYLYFGCIAF 240

Query: 251 IFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I  VK S     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F   L
Sbjct: 241 INSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYFSEFL 297

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 104/298 (34%), Positives = 164/298 (55%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPET--STNHEVRSFAELLKTL 73
           P KRI       V+++S     L +++     S+ G +  +     +  + S + LL  +
Sbjct: 3   PEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSLLDEV 62

Query: 74  SELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           ++LVD  P +   +  R+G +  R ++D+++E   +L+         + + +L  YL  +
Sbjct: 63  NKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L   G++  +  A + VL +F KY  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q V  K   + P  + ++ +V+ +     Y   ISF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLVPHK--HLKPMSIHNEELVELFKDKFLYFGCISF 240

Query: 251 IFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I  VK +     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F   L
Sbjct: 241 INSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYFSEFL 297

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/307 (35%), Positives = 161/307 (52%), Gaps = 16/307 (5%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSY---LHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72
           P KR+       ++ SS     L ++   L + V      +  E   + EV S   LL +
Sbjct: 5   PQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRDNTQFKE-PISAEVSSTLALLDS 63

Query: 73  LSELVDSTPALPGP-RRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           +  +VD  P L     R+G    R+++  V  +   LL K         I +L  Y   +
Sbjct: 64  VLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLSIYFYES 123

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFL-FDKYYALVRKLVLTYTL 190
           +G+ ER+DYG+GHEL+F   +  L    V+  +  +++++ L F KY  ++R+L   Y L
Sbjct: 124 WGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRLETLYWL 183

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q  + K   + P+ + +  IVD +     Y   I+F
Sbjct: 184 EPAGSHGVWGLDDYHFLPFLFGAFQLSNHK--HLKPKSIHNDEIVDMFKDKYLYFGCIAF 241

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG----- 304
           I  VK+      HSPML DIS  V  WSKV  G++KMY AEVL+K PV+QHF+F      
Sbjct: 242 INSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYFSEFLAC 300

Query: 305 -TGLFPW 310
            TG+ P+
Sbjct: 301 PTGISPY 307

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 162/299 (54%), Gaps = 11/299 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSG--VKIPETSTNHEVRSFAELLKTL 73
           P KR+       ++  S     L  ++ K   S+ G   K  +     ++ SF  LLK++
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 74  SELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           + ++D  P +   +  R+G +  R ++D++    + L+    P      + +L  YL  +
Sbjct: 63  NNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVW--GADFQASDVLFLFDKYYALVRKLVLTYT 189
           +G+++R+DYG+GHEL+F   +  L    ++    DF  + VL +F +Y  ++R L   Y 
Sbjct: 123 WGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDF-TNMVLKIFIEYLRVMRILETKYW 181

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q    K   + P  + ++ +V+ +     Y   ++
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLATHK--HLKPLSIHNEELVEMFQDKYLYFSCVA 239

Query: 250 FIFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           FI  VK S     HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+FG  L
Sbjct: 240 FINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFGEFL 297

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  162 bits (409), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 114/330 (34%), Positives = 170/330 (51%), Gaps = 24/330 (7%)

Query: 42  LHKYVSSMS-GVKIPETSTNHE-----VRSFAELLKTLSELVDSTPAL--PGPRRYGNLA 93
           L ++VSS++  V+  E S + E     + +   LL+ +  +    P L      R+G + 
Sbjct: 33  LLRFVSSLAQSVRGRENSEHAEPVSPAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVE 92

Query: 94  CRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEIC 153
            R +H +V    EAL+ +  P    +   EL  YLGNA+G  +R+DYG+GHEL+F   + 
Sbjct: 93  FRDFHKEVQARAEALVLQVDPSLTDEQAQELAVYLGNAWGDCKRIDYGSGHELNFVCFLY 152

Query: 154 ALDMLGVWGADFQASDVLFLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGA 213
            L   GV       + VL +F KY  ++R L   Y LEPAGSHGVWGLDD+  L ++FGA
Sbjct: 153 GLWKYGVLSEHDFTNAVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGA 212

Query: 214 SQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISFIFQVK-SGPFSEHSPMLFDISRS 272
            Q    K   + P+ + +  +V+ +     Y   I+FI +VK +     HSPML DIS  
Sbjct: 213 FQLATHK--HLKPKSIHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-G 269

Query: 273 VPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQV 332
           V +W+KV  G++KMY AEVL K P++QHF+F   L     + DG + P     + A    
Sbjct: 270 VRSWTKVSEGMVKMYKAEVLGKLPIMQHFFFSRFL----PVPDGVSPPRTSEEELADCSE 325

Query: 333 LQHTT--------APAPTNLNSARRQMNPP 354
             H+T         P+    + A R+ + P
Sbjct: 326 HAHSTWGDCCGIPIPSAVAASEATRKHSKP 355

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 156/298 (52%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIP--ETSTNHEVRSFAELLKTL 73
           P KR+  S    +++ S        ++     S+ G +    E   +  +     LL  +
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 74  SELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            +++   P +      R+G +  R ++D+V +S    L    P    + + +L  YL  +
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L   GV+     +++ +L +F +Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETRYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + +  +V+ +     Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTSHK--HLKPISIHNNELVEMFANRYLYFGCIDF 240

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I +VKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYFSDFL 297

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  159 bits (403), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 100/298 (33%), Positives = 155/298 (52%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE--TSTNHEVRSFAELLKTL 73
           P KR+       ++  S     L  ++ K   S+ G +  +     +  +     LL  +
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 74  SELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
           +++V S P +      R+G +  R ++D +      ++     +     + EL  Y   +
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAAYFRKS 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLF-LFDKYYALVRKLVLTYTL 190
           +G+R R+DYG+GHEL+F   +  L+    +  +  A++V+  +F KY  ++R L   Y L
Sbjct: 123 WGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P+ + +K  V+ + K   Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLATHK--HLKPKSIHNKEFVEMFEKRYLYFGCIGF 240

Query: 251 IFQVKSG-PFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I  VK+      HSPML DIS  V TWSKV  G++KMY AEVL K P++QHF+FG  L
Sbjct: 241 INSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFGDFL 297

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  159 bits (403), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 103/335 (30%), Positives = 169/335 (50%), Gaps = 21/335 (6%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPE--TSTNHEVRSFAELLKTL 73
           P KR+  +    +++ S        ++ +   S+ G +  +     + ++ S   LL  +
Sbjct: 3   PEKRLLTAGDMKLWEESQTRADFTKFIIELAESVKGHENYQFKEPISEQIISMMNLLSQI 62

Query: 74  SELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            +++   P +      R+G +  R ++D+V ++   LL    P    + + +L  YL  +
Sbjct: 63  KDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWG-ADFQASDVLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L   G++  +D   + +L +F +Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + +  +V+ +     Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNNELVEMFAHRYLYFGCIAF 240

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFP 309
           I +VKS      HSPML DIS  V TWSKV  G++KMY  EVL+K P++QHF+F      
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYFCE---- 295

Query: 310 WTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNL 344
                    LP  E    ++G +   T A    N 
Sbjct: 296 --------FLPCPEGVSRSRGHIHNGTYADDECNF 322

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  159 bits (402), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 98/295 (33%), Positives = 156/295 (52%), Gaps = 9/295 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+  +    ++  S     L ++L +   S+ G +  + +   +  V S  +LL  +
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMKLLHKV 62

Query: 74  SELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
             ++   P +      R+G +  R ++D +    + LL +  P      I +L  Y+  +
Sbjct: 63  QSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYVDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G+++R+DYG+GHEL+F   I  L    ++  +  A++ VL +F +Y  L+R L L Y L
Sbjct: 123 WGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + +  +++ +     Y   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAYQLSTHK--HLKPSSIHNDDLIEMFADKYLYFGCIEF 240

Query: 251 IFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
           I  VK +     HSPML DIS  V  WSKV  G+ KMY AEV+ K P++QHF+F 
Sbjct: 241 INSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFN 294

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  159 bits (402), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 161/296 (54%), Gaps = 12/296 (4%)

Query: 18  KRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTLSE 75
           KR+ +     ++ +S     +  +++    S+ G +  + +   +  V+  + LL  ++E
Sbjct: 4   KRLINEHDMELWNNSKTFEDVIGFINTLALSVRGRENNDYTQPISDNVQRVSNLLSKVTE 63

Query: 76  LVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKF---LPEPCHKSIVELQYYLGN 130
           ++     +      R+G +  R ++D + E    L+ K    + +P    + ++  Y  N
Sbjct: 64  IIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGKLDDICTYFIN 123

Query: 131 AFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYT 189
           ++G R R+DYG+GHEL+F   +  L    V+  +  +S+ VL LF KY  ++R L L Y 
Sbjct: 124 SWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGIMRSLELKYW 183

Query: 190 LEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAIS 249
           LEPAGSHGVWGLDD+  L ++FGA Q    K   + P+ + +  +V+ +     Y   I+
Sbjct: 184 LEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK--HLKPKSIHNPEVVEMFQDRYLYFGCIA 241

Query: 250 FIFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304
           FI +VK +     HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+FG
Sbjct: 242 FINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIMQHFYFG 296

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 156/298 (52%), Gaps = 9/298 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+       +++ S        ++     S+ G +  +     +  + S   LL  +
Sbjct: 3   PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQI 62

Query: 74  SELVDSTPALPGP--RRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            ++    P +      R+G +  R ++D+V  +   +L    P    + + +L  YL  +
Sbjct: 63  KDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L   G++     +++ VL +F +Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + +  +V+ +     Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNNELVEMFAHRYLYFGCIAF 240

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
           I +VKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYFSEFL 297

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  157 bits (398), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 170/335 (50%), Gaps = 21/335 (6%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+  +    +++ S        ++     S+ G +  +     + ++     LL  +
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQITRMLSLLSRV 62

Query: 74  SELVDSTPAL--PGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131
            ++++  P +      R+G +  R ++D+V ++   LL         + + +L  YL  +
Sbjct: 63  RDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYLDES 122

Query: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTYTL 190
           +G++ R+DYG+GHEL+F   +  L   GV+     +++ +L +F +Y  ++R L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETKYWL 182

Query: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250
           EPAGSHGVWGLDD+  L ++FGA Q    K   + P  + +  +V+ ++    Y   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTTHK--HLKPISIHNSELVEMFSDRYLYFGCIAF 240

Query: 251 IFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFP 309
           I +VKS      HSPML DIS  V TWSKV  G++KMY AEVL+K P++QHF+F      
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYFSE---- 295

Query: 310 WTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNL 344
                    LP  E   + +G +   T A    N+
Sbjct: 296 --------FLPCPEGVSQPRGHIHDGTDADDECNI 322

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 156/293 (53%), Gaps = 8/293 (2%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+       ++Q+      L  +L +   ++ G++  + S      ++S   L++ +
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSVEALIECV 63

Query: 74  SELVDSTPALP-GPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNAF 132
            + +++ P    GP R+G    R  +D +      L+ +       + + +L  Y   ++
Sbjct: 64  DQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNESW 123

Query: 133 GSRERLDYGTGHELSFFAEICALDMLGVWG-ADFQASDVLFLFDKYYALVRKLVLTYTLE 191
           G + R+DYG+GHEL+F   +  L   GV+  A    + VL +F KY   +R +   Y LE
Sbjct: 124 GDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVYWLE 183

Query: 192 PAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISFI 251
           PAGSHGVWGLDD+  L ++FGASQ    +   + P+ + +  +V+ +++   Y   I FI
Sbjct: 184 PAGSHGVWGLDDYHFLPFLFGASQLSTHR--HLKPKSIHNPEVVEMFSEKYLYFGCIDFI 241

Query: 252 FQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWF 303
             VK +     HSPML DIS  V  W+KV +G++KMY AEVL K P++QHF+F
Sbjct: 242 NSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF 293

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  154 bits (389), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/301 (32%), Positives = 158/301 (52%), Gaps = 11/301 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKTL 73
           P KR+   R   +++SS     L  ++ +   ++ G +  +     +  V +   LL+ +
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQQV 65

Query: 74  SELVDSTPALPG---PRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGN 130
             +++  P         R+G +  R ++D++     +L+    P+     + +LQ YL  
Sbjct: 66  RGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTYLEE 125

Query: 131 AFGSRERLDYGTGHELSFFAEICALDMLGVW--GADFQASDVLFLFDKYYALVRKLVLTY 188
           ++G + R+DYG+GHEL+F   +  L    V+  G   +A+ VL  F +Y  ++R L   Y
Sbjct: 126 SWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVLKPFIEYLKIMRVLETEY 185

Query: 189 TLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAI 248
            LEPAGSHGVWGLDD+  L ++FGA Q    K   + P  + ++ +V+ +     Y   I
Sbjct: 186 WLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK--HLKPLSIHNEEVVELFADKYLYFGCI 243

Query: 249 SFIFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
            FI  VK+      HSPML DIS  V  WSKV  G++KMY AEVL+K P++QHF+F   L
Sbjct: 244 HFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHFYFSDFL 302

Query: 308 F 308
            
Sbjct: 303 L 303

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  152 bits (384), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 153/300 (51%), Gaps = 11/300 (3%)

Query: 15  EPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETS--TNHEVRSFAELLKT 72
           +P KR+  S+    +       +L  ++ +   S+ G++  +        +     LL  
Sbjct: 2   KPQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASIDKCCSLLDE 61

Query: 73  LSELVDSTPALPGPR--RYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGN 130
           +  +    P        R+G +  R ++D +    + L+ K   +       EL  Y   
Sbjct: 62  VFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFVE 121

Query: 131 AFGSRERLDYGTGHELSFFAEICALDMLGVW--GADFQASDVLFLFDKYYALVRKLVLTY 188
           ++G RER+DYG+GHEL+F   +  L   G++    D++ + VL +F  Y  L+R L  TY
Sbjct: 122 SWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYR-NLVLKVFIHYLELMRVLETTY 180

Query: 189 TLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAI 248
            LEPAGSHGVWGLDD+  L ++FGASQ    K   + P+ + +  +VD +     Y   I
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGASQLAPHK--HLKPKSIHNNELVDMFASRYLYFGCI 238

Query: 249 SFIFQVK-SGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
            FI +VK +     HSPML DIS    +WSKV  G++KMY  EVL K P++QHF FG+ L
Sbjct: 239 DFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGSFL 297

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 160/300 (53%), Gaps = 11/300 (3%)

Query: 16  PTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETST--NHEVRSFAELLKTL 73
           P KR+  S+   ++ +S     L  ++    +S+   +  + S   +  + +   LL+ +
Sbjct: 2   PEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFSLLQDI 61

Query: 74  SELVDSTPALPG----PRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLG 129
            ++++  P          R+G +  ++++D ++++ E L+           I EL  YL 
Sbjct: 62  RDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELSIYLV 121

Query: 130 NAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASD-VLFLFDKYYALVRKLVLTY 188
            ++G+R+R+DYG+GHEL+F   +  L    ++     +++ VL +F +Y  ++R +   Y
Sbjct: 122 ESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRIIETKY 181

Query: 189 TLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAI 248
            LEPAGSHGVWGLDD+  L ++FGA Q    K   + P  + ++ +V+ +     Y   I
Sbjct: 182 WLEPAGSHGVWGLDDYHFLPFLFGAFQL--SKHKHLKPISIHNEEMVEMFKDKYMYFGCI 239

Query: 249 SFIFQVKS-GPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGL 307
            FI  +K+      HSPML DIS  V  WSKV  G++KMY AEVL K P++QHF+F   L
Sbjct: 240 DFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFYFSDFL 298

>YOR296W Chr15 (870202..874071) [3870 bp, 1289 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           expressed during copper starvation; YOR296W is not an
           essential gene
          Length = 1289

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 57/137 (41%), Gaps = 11/137 (8%)

Query: 27  HVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKTLSELVDSTPAL--P 84
            + Q  +  G   SY  +   + S + +   + NHE    + L + L  +V STP +  P
Sbjct: 735 ELIQRDLQEGDEPSYSLESSDTRSSLSLNNANVNHEKSRSSRLFEDLKNVVKSTPKMVAP 794

Query: 85  GPRRYGNLACRTWHDKVDESLEALLHKF--LPEPCHKSIVELQYYLGNAFGSRERLDYGT 142
            P ++    C   +D +D++L  LL  F    +P   S V  QY+      S    D G 
Sbjct: 795 APYQFKKRTCVLLND-LDKTL-FLLESFEEKADPSKISSVIAQYH-----SSHNLEDNGK 847

Query: 143 GHELSFFAEICALDMLG 159
             +     ++  L ++G
Sbjct: 848 SFDDQNMKQVYTLRIIG 864

>NCAS0A11460 Chr1 complement(2268077..2270689) [2613 bp, 870 aa]
           {ON} Anc_3.419 YPR105C
          Length = 870

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 20/128 (15%)

Query: 181 VRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTK 240
           V  L L + + P       GLD +         S++V    A  + + +  K  + + T 
Sbjct: 213 VDTLTLVFKMFPMVGQDSLGLDLY---------SKYVCDIIAEESRKILTQK--ISQSTN 261

Query: 241 TNFYCQAISFIFQVKSGPFSEHSPM---------LFDISRSVPTWSKVQRGLLKMYFAEV 291
           T++Y QA+  +F++ S   ++HS +         +  +  +V   + +Q GLL   FAE 
Sbjct: 262 TSYYSQALLHLFKIVSTIINDHSKIIATCYGKKFMIHVMENVEKEADLQAGLLLDIFAES 321

Query: 292 LNKFPVVQ 299
            N   +V+
Sbjct: 322 RNLDGIVK 329

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,355,433
Number of extensions: 1686272
Number of successful extensions: 3994
Number of sequences better than 10.0: 45
Number of HSP's gapped: 3969
Number of HSP's successfully gapped: 45
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)