Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00836g5.711ON64164133010.0
Kwal_55.196495.711ON64164130580.0
SAKL0E15114g5.711ON64962025930.0
KLLA0A00418g5.711ON64260925030.0
TDEL0B020905.711ON64361224580.0
CAGL0H06699g5.711ON65061323960.0
Ecym_40105.711ON64460923680.0
ZYRO0B16522g5.711ON64361723510.0
KAFR0D021705.711ON66061523440.0
TPHA0E001505.711ON64661023280.0
Kpol_1043.775.711ON65762523160.0
AFR295W5.711ON63160923140.0
NCAS0G001805.711ON65461522580.0
TBLA0E017505.711ON66560122580.0
NDAI0F002105.711ON65360022220.0
Skud_9.135.711ON64961922010.0
YIL155C (GUT2)5.711ON64962321970.0
Smik_9.145.711ON65261621530.0
Suva_9.325.711ON53854020080.0
KNAG0L021905.711ON64559419990.0
TBLA0A106804.380ON26186770.84
Suva_10.5264.276ON114446761.6
KLTH0D00770g7.10ON61383733.5
Kwal_56.236368.296ON42149714.7
KAFR0D010708.56ON49237715.4
Smik_11.2671.294ON75165707.6
TPHA0H030607.10ON61763707.9
KLLA0D11154g8.56ON49352698.3
Smik_15.5527.10ON60361698.7
Skud_6.538.56ON49937699.0
Suva_6.418.56ON49937699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00836g
         (641 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...  1276   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...  1182   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...  1003   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   968   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   951   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   927   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   916   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   910   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   907   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   901   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   896   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   895   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   874   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   874   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   860   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   852   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   850   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   833   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   778   0.0  
KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....   774   0.0  
TBLA0A10680 Chr1 (2640996..2641781) [786 bp, 261 aa] {ON} Anc_4....    34   0.84 
Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR41...    34   1.6  
KLTH0D00770g Chr4 (74519..76360) [1842 bp, 613 aa] {ON} similar ...    33   3.5  
Kwal_56.23636 s56 complement(631160..632425) [1266 bp, 421 aa] {...    32   4.7  
KAFR0D01070 Chr4 complement(216926..218404) [1479 bp, 492 aa] {O...    32   5.4  
Smik_11.267 Chr11 complement(446092..448347) [2256 bp, 751 aa] {...    32   7.6  
TPHA0H03060 Chr8 complement(727126..728979) [1854 bp, 617 aa] {O...    32   7.9  
KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly...    31   8.3  
Smik_15.552 Chr15 complement(975355..977166) [1812 bp, 603 aa] {...    31   8.7  
Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}...    31   9.0  
Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON} Y...    31   9.1  

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score = 1276 bits (3301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/641 (97%), Positives = 625/641 (97%)

Query: 1   MFARTVSRRVXXXXXXXXXXXXXXXXQRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA 60
           MFARTVSRRV                QRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA
Sbjct: 1   MFARTVSRRVLAGATLAAGGYAAFALQRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA 60

Query: 61  KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120
           KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA
Sbjct: 61  KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120

Query: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180
           FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG
Sbjct: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180

Query: 181 SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240
           SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN
Sbjct: 181 SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240

Query: 241 YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR 300
           YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR
Sbjct: 241 YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR 300

Query: 301 NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF 360
           NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF
Sbjct: 301 NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF 360

Query: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL 420
           LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL
Sbjct: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL 420

Query: 421 VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF 480
           VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF
Sbjct: 421 VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF 480

Query: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEK 540
           QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEK
Sbjct: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEK 540

Query: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDA 600
           NQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDA
Sbjct: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDA 600

Query: 601 KQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641
           KQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV
Sbjct: 601 KQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score = 1182 bits (3058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/641 (89%), Positives = 607/641 (94%)

Query: 1   MFARTVSRRVXXXXXXXXXXXXXXXXQRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMA 60
           MFART+S+RV                Q D+ A +EV V+ PLKAEAPA+P+RSELL+KMA
Sbjct: 1   MFARTLSKRVLTTATLAAGGYAAYMVQNDKIARSEVRVTRPLKAEAPALPTRSELLEKMA 60

Query: 61  KTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120
           KT+QFDVL+IGGGATGTGCAVD ATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA
Sbjct: 61  KTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKA 120

Query: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180
           FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG
Sbjct: 121 FWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAG 180

Query: 181 SQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240
           SQNLKSSYMM+A+RASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN
Sbjct: 181 SQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLN 240

Query: 241 YMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPR 300
           YMEVT+L+KN+++GR+EGAM RDRETG+EFRI AKVVVNSTGPFSDR+LQMD AKDG PR
Sbjct: 241 YMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLLQMDAAKDGKPR 300

Query: 301 NDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFF 360
           NDLVQFANEGHDSIGSR+AVSNPRMVVPSAGVHIVLPAFYCPK+IGLLDAKTSDGRVMFF
Sbjct: 301 NDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLDAKTSDGRVMFF 360

Query: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPL 420
           LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKR DVLSAWAGIRPL
Sbjct: 361 LPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGDVLSAWAGIRPL 420

Query: 421 VRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF 480
           +RDPRT+KEGDDVSSTQGLVRNHFL+TSDNGLVTIAGGKWTTYREMAEETIDEVVKQG F
Sbjct: 421 IRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKF 480

Query: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEK 540
           QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMF+RDEK
Sbjct: 481 QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFKRDEK 540

Query: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDA 600
           NQLPVTFGGRENVTVYKNVNFDSFRYPFTI ELKYS++YEYTRTALDFLMRRTRFGFLDA
Sbjct: 541 NQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALDFLMRRTRFGFLDA 600

Query: 601 KQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641
           +QAL AV GTVS+MGDELGW +++R +E QQAS+FIKTFG+
Sbjct: 601 RQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/620 (78%), Positives = 553/620 (89%), Gaps = 7/620 (1%)

Query: 27  QRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATR 86
           Q+    +N+V V+ P++     +P+R +LL K++KT+QFDVL+IGGGATGTG A+D ATR
Sbjct: 32  QQKSVINNDVTVTNPVQKSKINLPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATR 91

Query: 87  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTA 146
           GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLV+EALNER HML TA
Sbjct: 92  GLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTA 151

Query: 147 PHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASI 206
           PHLCK+LPIMIPVYNYWQ PYFYVGCKMYDLFAGSQNLKSSYM+TA RA+EVAPMLDAS 
Sbjct: 152 PHLCKILPIMIPVYNYWQAPYFYVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASK 211

Query: 207 LKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRET 266
           LKAGLVYHDGSFNDSRMNA LAVTA+E+GATVLNYMEV +L+KNE+TG+VEGA+A+DRET
Sbjct: 212 LKAGLVYHDGSFNDSRMNATLAVTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRET 271

Query: 267 GKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMV 326
           G+ FRI AKVVVN+TGPFSDRILQMD    GLP + L+Q +N  + +I S+VAV+NP+MV
Sbjct: 272 GETFRIKAKVVVNATGPFSDRILQMDEDSKGLPDDRLLQSSNI-NATISSKVAVANPQMV 330

Query: 327 VPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTAT 386
           VPSAGVHIVLP+FYCPK+IGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTAT
Sbjct: 331 VPSAGVHIVLPSFYCPKEIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTAT 390

Query: 387 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDD-----VSSTQGLVR 441
           EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR  + G++      SSTQ LVR
Sbjct: 391 EADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVKDPRK-RIGENPHRVAASSTQELVR 449

Query: 442 NHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPN 501
           +HFLFTSDN LVTIAGGKWTTYREM+EETI+EVVK G F AKPCIT+K+KLAGAE +DPN
Sbjct: 450 SHFLFTSDNDLVTIAGGKWTTYREMSEETINEVVKVGKFNAKPCITRKLKLAGAENYDPN 509

Query: 502 FVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNF 561
             AMLAQEYHLSSKMAE+LANNYGTR+P+ICE+F+ D+KN+LP+ FGG+ENVTVY NV+F
Sbjct: 510 LPAMLAQEYHLSSKMAEYLANNYGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDF 569

Query: 562 DSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWD 621
           DSFRYPFTI ELKYS+  EYTRTALDFLMRRTR+ FLDAKQAL AV GTV +MGDEL WD
Sbjct: 570 DSFRYPFTIGELKYSINNEYTRTALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWD 629

Query: 622 ENKRLSEIQQASDFIKTFGV 641
            N+R  E ++A++FIKTFGV
Sbjct: 630 SNRRQEEREKATEFIKTFGV 649

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/609 (75%), Positives = 538/609 (88%), Gaps = 4/609 (0%)

Query: 33  HNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVAL 92
            N+V VS  +K     +PSR+ LL +++KTD+FDVL+IGGGATGTGCA+D +TRGLNVAL
Sbjct: 38  QNDVSVST-IKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVAL 96

Query: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152
           VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HMLNTAPHLCK+
Sbjct: 97  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKI 156

Query: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLV 212
           LPIMIPVYNYWQVPYFYVG KMYDLFAGSQNLKSSY+++  RASEVAPMLDAS LKAGLV
Sbjct: 157 LPIMIPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLV 216

Query: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRI 272
           YHDGSFNDSRMN++LA+TAIE+GATVLNY+++ +L+KN++TG+VEGA+A DRETG E++I
Sbjct: 217 YHDGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQI 276

Query: 273 NAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGV 332
            AKVVVN+TGP+SDR+LQMD +  GLP + ++Q  NE + ++ +++AV NP+MVVPSAGV
Sbjct: 277 KAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINE-NATVSTKIAVPNPKMVVPSAGV 335

Query: 333 HIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 392
           HIVLP+FYCPK+IGLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQ+PENPTATEADIQD
Sbjct: 336 HIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQD 395

Query: 393 ILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGL 452
           ILKELQHYI FPVKREDVLSAWAGIRPLV+DPR    G    STQ LVR+HFLFTS + L
Sbjct: 396 ILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGS--GSTQQLVRSHFLFTSPSNL 453

Query: 453 VTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512
           VTI+GGKWTTYREMAEETIDEVVK G F +KPC+TKK+KL G E W+PN  A+L+Q+YHL
Sbjct: 454 VTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLSQKYHL 513

Query: 513 SSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAE 572
           SS M+EHLANNYGTR+P+ICE+F  D +N+LPV   G+ENV+V+ +V++DSFRYP+TI E
Sbjct: 514 SSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGE 573

Query: 573 LKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQA 632
           LKYS+KYEY R  LDFLMRRTR+ FLDAKQAL AV+GTV +MGDELGWD  KR  EIQQA
Sbjct: 574 LKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQA 633

Query: 633 SDFIKTFGV 641
           +++IKTFGV
Sbjct: 634 TEYIKTFGV 642

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/612 (74%), Positives = 532/612 (86%), Gaps = 5/612 (0%)

Query: 30  RSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLN 89
           R   N+V +   +      +PSR +LL K++KTDQFDVLVIGGGATGTGCAVD ATRGLN
Sbjct: 37  RRIANDVALQSAVDTPNVKLPSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLN 96

Query: 90  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHL 149
           VALVEM+DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNERGHMLNTAPHL
Sbjct: 97  VALVEMHDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHL 156

Query: 150 CKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKA 209
           CK+LPIMIPVY YWQ+PYFYVGCKMYDLFAGSQNLK+SY++T R+A+++APMLD + LKA
Sbjct: 157 CKILPIMIPVYTYWQIPYFYVGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKA 216

Query: 210 GLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKE 269
           GLVYHDGSFNDSRMN ALAVTAIE GATVLNYMEV +L+K+++TG+V+GA+  +RETG++
Sbjct: 217 GLVYHDGSFNDSRMNTALAVTAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQ 276

Query: 270 FRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPS 329
           F + AKV VN+TGP+SD++LQMD  KDG P +      N    +I ++VAV NP+MVVPS
Sbjct: 277 FTVKAKVTVNATGPYSDKLLQMDENKDGKP-DPTKPLPNA---TISTKVAVENPKMVVPS 332

Query: 330 AGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEAD 389
           AGVHI+LP+FYCP+++GLLD KTSDGRVMFFLPWQGKVLAGTTDIPMKQVP+ PTA E+D
Sbjct: 333 AGVHIILPSFYCPREMGLLDVKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESD 392

Query: 390 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSD 449
           IQDIL+ELQHYIKFPVKREDVLSAWAGIRPLV DPR   +G+   STQGLVR+H  FT+D
Sbjct: 393 IQDILQELQHYIKFPVKREDVLSAWAGIRPLVIDPRK-SQGNTGGSTQGLVRSHLCFTTD 451

Query: 450 NGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQE 509
           NG+VTIAGGKWTTYREMAEETI+EVVK G F  KPCIT+K+KL+GAE W+PN  A+LAQ+
Sbjct: 452 NGMVTIAGGKWTTYREMAEETINEVVKVGKFNVKPCITRKLKLSGAENWNPNLAALLAQK 511

Query: 510 YHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFT 569
           YHLS  M+ HL+ NYGTR+P+ICEMF+ DE+NQLPVTFGGRENVTVY NVNFDSFRYPFT
Sbjct: 512 YHLSGAMSNHLSENYGTRAPLICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFT 571

Query: 570 IAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEI 629
           I EL YSV YEYTRTALDFLMRRTRF FLDA+QAL+AV+GTV++MGD+L WD  +R  EI
Sbjct: 572 IGELNYSVDYEYTRTALDFLMRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEI 631

Query: 630 QQASDFIKTFGV 641
           +++ +FI+TFGV
Sbjct: 632 EKSKEFIRTFGV 643

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/613 (73%), Positives = 519/613 (84%), Gaps = 8/613 (1%)

Query: 34  NEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALV 93
           N+V +  P++     +P+R ELLDK+++T+QFDVL+IGGGATGTGCA+D ATRGLNVALV
Sbjct: 41  NDVSLISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALV 100

Query: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153
           E NDFASGTSSKSTKMAHGGVRYLEKAFWE+SKAQLDLVIEALNER H+LNTAPHLCK+L
Sbjct: 101 EKNDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLL 160

Query: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVY 213
           PI+IPVYNYWQVPYFY GCKMYDLFAGSQNLK SY+M+     EVAPMLD S LKAGLVY
Sbjct: 161 PIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVY 220

Query: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRIN 273
           HDGSFND+RMNA LAVTAIE  ATVLNYMEV +L+K +K G+V GA+  DRETGK + + 
Sbjct: 221 HDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVK-DKDGKVAGAVVEDRETGKTYSVR 279

Query: 274 AKVVVNSTGPFSDRILQMDNAKDGLP-----RNDLVQFANEGHDSIGSRVAVSNPRMVVP 328
           AKVVVN+TGP+SDR+LQMD   DGLP     + + +   N    SI S+VAV+ P MVVP
Sbjct: 280 AKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVP 339

Query: 329 SAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEA 388
           SAGVHI+LP+FYCPK++GLLDAKTSDGRVMFFLPWQGKVLAGTTDIP+KQVPENPTATEA
Sbjct: 340 SAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEA 399

Query: 389 DIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTS 448
           DIQDILKELQ YIKFPVKREDVLSAWAGIRPLV DPR   + D   STQGLVR+HF+FTS
Sbjct: 400 DIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKAD--GSTQGLVRSHFIFTS 457

Query: 449 DNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQ 508
           D+GLVTIAGGKWTTYR MAEETIDEVVK G F AKPCIT+K+KLAGAE WDPN  A+LAQ
Sbjct: 458 DHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWDPNLPALLAQ 517

Query: 509 EYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPF 568
           +YHLS KM+ +LA NYGTR+P+ICEMF  D +N+LP+    +E   V  +V+FDSFRYP 
Sbjct: 518 KYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLGHVDFDSFRYPI 577

Query: 569 TIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSE 628
           TIAELKY++KYEY RTALDFLMRRTRF FLDAKQAL AV+GTV +MGD LGWDE +R  E
Sbjct: 578 TIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDE 637

Query: 629 IQQASDFIKTFGV 641
           I+ +++FIKTFGV
Sbjct: 638 IRYSTEFIKTFGV 650

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/609 (72%), Positives = 522/609 (85%), Gaps = 10/609 (1%)

Query: 34  NEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALV 93
           NE+   + L+  APA PSR++LL+K+ KTDQFDVLVIGGGA+GTG A+D ATRGLNVAL+
Sbjct: 45  NELPAELKLEKHAPAPPSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALL 104

Query: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153
           EMND+ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER HML+TAPHLCK+L
Sbjct: 105 EMNDYASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKIL 164

Query: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVY 213
           PIMIPVY +WQVPYFYVG KMYD FAG QNLKSSY+++A  AS+VAPMLDAS LKAGLVY
Sbjct: 165 PIMIPVYKWWQVPYFYVGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVY 224

Query: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRIN 273
           HDGSFNDSRMN+ LAVTAIE GAT+LNYMEV +LLKN +TG+VEGA+A DRETGK++ + 
Sbjct: 225 HDGSFNDSRMNSTLAVTAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVK 284

Query: 274 AKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVH 333
           AKVVV++TGPFSDRILQM+N   GLP +  +  ANEG  +I ++VAV++P+MVVPS+GVH
Sbjct: 285 AKVVVSATGPFSDRILQMENHPKGLPDDLSLSKANEGA-TITTKVAVADPKMVVPSSGVH 343

Query: 334 IVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 393
           I+LP+FYCPK +GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI
Sbjct: 344 IILPSFYCPKDMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 403

Query: 394 LKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLV 453
           LKELQHYIKFPVKREDV SAWAGIRPLV+DPR      D S TQ LVR+HFLFTSD+GLV
Sbjct: 404 LKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KDNSDTQDLVRSHFLFTSDSGLV 458

Query: 454 TIAGGKWTTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512
           TI+GGKWTTYREMA+ETIDEVVK G+F  AKPCIT+KIKL G+E WDPN  A+L+Q+Y+L
Sbjct: 459 TISGGKWTTYREMAQETIDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYNL 518

Query: 513 SSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAE 572
              ++E+L+ NYGT++  ICE+F+ D++NQLPV+    +      NV++D+FRYPFT+ E
Sbjct: 519 PPVLSEYLSENYGTKAAAICEIFQSDKRNQLPVSLAAEKAAA---NVDYDAFRYPFTVGE 575

Query: 573 LKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQA 632
           LKY+++ EY R  LDFLMRRTR+ FLDAKQA+ AV GTV IMGDELGWD  KR  E + A
Sbjct: 576 LKYNIRNEYARKPLDFLMRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYA 635

Query: 633 SDFIKTFGV 641
            +FIKTFGV
Sbjct: 636 IEFIKTFGV 644

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/617 (70%), Positives = 513/617 (83%), Gaps = 7/617 (1%)

Query: 27  QRDRSA-HNEVHVSIPLKAEAPA-IPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGA 84
           +R  SA  NEV V  P+       +PSR +LL  + KTD+FDVL+IGGGA+G G A+D A
Sbjct: 32  RRQSSALSNEVPVVSPIDPRPSVNLPSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAA 91

Query: 85  TRGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLN 144
           TRGLNVA VE NDFASGTSSKSTKMAHGGVRYLEKA +ELS+AQLDLVIEALNERGHML 
Sbjct: 92  TRGLNVACVEANDFASGTSSKSTKMAHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLE 151

Query: 145 TAPHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDA 204
           TAPHLCK+LPIMIPVY+YWQVPYF+ GCK+YD FAG QNL+SSY+++   ASE+APMLD 
Sbjct: 152 TAPHLCKILPIMIPVYSYWQVPYFFAGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDE 211

Query: 205 SILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDR 264
           S LKAGLVYHDGSFNDSRMN+ LA++AIE GATVLNY++VT+LLK+  T +VEGA+  D+
Sbjct: 212 SKLKAGLVYHDGSFNDSRMNSTLAISAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQ 271

Query: 265 ETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPR 324
           ETGK++++ AKV VN+TGP+SD ILQMD  K+GLP     Q AN    SI + VAV+ P 
Sbjct: 272 ETGKQYQVKAKVTVNATGPYSDLILQMDKNKNGLPDPQPPQPANV---SIATEVAVNKPN 328

Query: 325 MVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPT 384
           MVVPSAGVHI+LP++YCPK +GLLD KT+DGRVMFFLPWQGKVLAGTTDIPMK VP+NPT
Sbjct: 329 MVVPSAGVHIILPSYYCPKTVGLLDVKTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPT 388

Query: 385 ATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHF 444
           ATEADIQDIL+ELQHYIKFPV+REDVLSAWAGIRPLV DPR  K  D   ST+GLVRNH 
Sbjct: 389 ATEADIQDILRELQHYIKFPVRREDVLSAWAGIRPLVMDPR--KRKDTGGSTEGLVRNHL 446

Query: 445 LFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVA 504
           +FTS+ GL+T+AGGKWTTYREMAE+TIDEVVK+G F  KPCIT+KIKLAG E W PN  A
Sbjct: 447 IFTSETGLITLAGGKWTTYREMAEQTIDEVVKEGGFSVKPCITRKIKLAGGENWTPNLSA 506

Query: 505 MLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSF 564
           +LAQ Y LS  M++HL+NNYGTR+PIICE+F+ DE+NQLPV FGGRENVTV  +VNFDSF
Sbjct: 507 LLAQHYKLSQAMSQHLSNNYGTRAPIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSF 566

Query: 565 RYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENK 624
           RYPFTI E  YS+++EY+R A DFLMRRTR+ FLDA  AL AV+GTV +MGDEL WD  +
Sbjct: 567 RYPFTIGEFLYSIRHEYSRKATDFLMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSAR 626

Query: 625 RLSEIQQASDFIKTFGV 641
           R  EI++ ++FIKTFGV
Sbjct: 627 RQREIEECTEFIKTFGV 643

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/615 (70%), Positives = 512/615 (83%), Gaps = 17/615 (2%)

Query: 41  PLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFAS 100
           PL   +  +P+R++L+ K+ KT+QFDVLVIGGGATG GCA+D  TRGLNVALVE  DFAS
Sbjct: 49  PLDKRSVNLPTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFAS 108

Query: 101 GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVY 160
           GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNER H+LNTAPHLCK+LPIMIPVY
Sbjct: 109 GTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVY 168

Query: 161 NYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFND 220
           NYWQ+PYFY GCKMYDLFAGSQNLKSSY+++ R A++VAPMLD + LKAGLVYHDG+FND
Sbjct: 169 NYWQIPYFYAGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFND 228

Query: 221 SRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNS 280
           SRMN+ LAVTAIE G+TVLNYMEV +LLK + +G++EGA+  D ETGK++ I AKVV+N+
Sbjct: 229 SRMNSTLAVTAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINA 288

Query: 281 TGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFY 340
           TGP+SD ILQMD    GLP  D +    + ++ I ++V+VSNP+MVVPSAGVHI+LP+FY
Sbjct: 289 TGPYSDAILQMDQNPTGLP--DPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFY 346

Query: 341 CPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHY 400
           CPK IGLLDAKTSDGRVMFFLPWQGKVLAGTTD+PMKQ+PENPTATEADIQDILKELQHY
Sbjct: 347 CPKDIGLLDAKTSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHY 406

Query: 401 IKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKW 460
           I+FPVKREDVLSAWAGIRPLV+DPRTL +  D  STQGLVR+HF+FTSD+GLVTIAGGKW
Sbjct: 407 IRFPVKREDVLSAWAGIRPLVKDPRTLDKNGD-GSTQGLVRSHFIFTSDHGLVTIAGGKW 465

Query: 461 TTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEH 519
           TTYR MAEET+DE +K G F   KPCIT+ IKLAG E W+PN  A+LAQ YHLSSK+++H
Sbjct: 466 TTYRAMAEETVDEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYHLSSKLSQH 525

Query: 520 LANNYGTRSPIICEMFRRDEKNQLPVTFGG----------RENVTVYKNVN---FDSFRY 566
           LA+NYGTR+PIICEM+ +D KN+LP+                N  +Y N     F+ FRY
Sbjct: 526 LADNYGTRAPIICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRY 585

Query: 567 PFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRL 626
           PFT+ E+KYSV YEY  TALDFLMRR+RF FLDAK+A+ AV+GTV IMGDEL WDE++R 
Sbjct: 586 PFTVGEVKYSVNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRH 645

Query: 627 SEIQQASDFIKTFGV 641
            EI+    +IKTFGV
Sbjct: 646 KEIENTIKYIKTFGV 660

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/610 (71%), Positives = 511/610 (83%), Gaps = 9/610 (1%)

Query: 33  HNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVAL 92
            NE  ++ P+ +    IP+RSEL++ +  TDQFDVL+IGGGATG+G A+D ATRGLNVAL
Sbjct: 45  QNEAVLANPVDSPNVNIPTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVAL 104

Query: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152
           VE +DFASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPHLCK+
Sbjct: 105 VEKDDFASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKI 164

Query: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLV 212
           LPIMIPVY YWQVPYFY G KMYD+FAGSQNLKSSY+++   A E+APMLD S LKAGLV
Sbjct: 165 LPIMIPVYKYWQVPYFYAGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLV 224

Query: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRI 272
           YHDG+FNDSRMN+ LA+TAIE GATVLNYMEV +LLK+  + ++ GA+  D ETG++ +I
Sbjct: 225 YHDGTFNDSRMNSTLAITAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQI 284

Query: 273 NAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGV 332
           NAKV+VN+TGP+SD+ILQMDN K+G P     +F      SI ++VAV NP MVVPSAGV
Sbjct: 285 NAKVIVNATGPYSDKILQMDNNKNGKPD----EFTQSAETSIATKVAVQNPHMVVPSAGV 340

Query: 333 HIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 392
           HI+LP+FYCP+++GLLDA TSDGRVMFFLPWQGKVLAGTTDIPMK VPENPTATEADIQD
Sbjct: 341 HIILPSFYCPREMGLLDANTSDGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQD 400

Query: 393 ILKELQHYIKFPVKREDVLSAWAGIRPLVRDPR-TLKEGDDVSSTQGLVRNHFLFTSDNG 451
           ILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR T KEG    +TQ LVR+HF+FTSD+G
Sbjct: 401 ILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRKTPKEG----ATQELVRSHFIFTSDHG 456

Query: 452 LVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYH 511
           LVTIAGGKWTTYREMAEETID VVK G F  KPC T+K+KLAG E +DPN  A+LAQ+YH
Sbjct: 457 LVTIAGGKWTTYREMAEETIDTVVKNGKFNVKPCSTRKLKLAGGENYDPNLAALLAQKYH 516

Query: 512 LSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIA 571
           L SK++EHLANNYGTRSP+IC+MF  D+ N+LP+   G+E   VY  V+FDSFRYP++IA
Sbjct: 517 LPSKLSEHLANNYGTRSPLICDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIA 576

Query: 572 ELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQ 631
           E+KY V +EY RT LDFLMRR+RF FLDAKQAL++V+GTV IMGDEL WDE +R  E   
Sbjct: 577 EVKYCVHHEYARTTLDFLMRRSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDY 636

Query: 632 ASDFIKTFGV 641
           + ++IKTFGV
Sbjct: 637 SIEYIKTFGV 646

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/625 (71%), Positives = 521/625 (83%), Gaps = 18/625 (2%)

Query: 29  DRSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGL 88
           + + +N+     P+      +PSR++LL K+ KT QFDVL+IGGGATGTGCA+D ATRGL
Sbjct: 39  NNAVYNDPSKPSPVDTTDVRLPSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGL 98

Query: 89  NVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPH 148
           NVALVE ND+ASGTSSKSTKMAHGGVRYLEKA ++LSKAQLDLVIEALNER H+L TAPH
Sbjct: 99  NVALVEKNDYASGTSSKSTKMAHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPH 158

Query: 149 LCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILK 208
           LCK+LPIMIPVY YWQVPYFYVG KMYDLFAGSQNLKSSY+++   A E+APMLD+S LK
Sbjct: 159 LCKILPIMIPVYQYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLK 218

Query: 209 AGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGK 268
           AGLVYHDGSFNDSRMNA LA++AIE+GATVLNYMEV +L+K+EKT ++ GA+  D ETG+
Sbjct: 219 AGLVYHDGSFNDSRMNATLAISAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGE 278

Query: 269 EFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANE-----------GHDSIGSR 317
            ++I AKV+VN+TGP+SD ILQMDN K+GLP  D+ +   E             +SI   
Sbjct: 279 TYQIKAKVIVNATGPYSDTILQMDNNKNGLP--DMFKKEIETGNLKTPLNVITPESISKE 336

Query: 318 VAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMK 377
           VAV NP MVVPSAGVHI+LP++YCP ++GLLDA T+DGRVMFFLPWQGKVLAGTTDIPMK
Sbjct: 337 VAVQNPNMVVPSAGVHIILPSYYCPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMK 396

Query: 378 QVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQ 437
            VPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLV+DPR  K G    +TQ
Sbjct: 397 TVPENPTATEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVQDPRVQKGG----ATQ 452

Query: 438 GLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEG 497
            +VR+HF+FTSDNGLVTIAGGKWTTYREMAEETIDEVVKQG F AKPCIT+K+KLAGAE 
Sbjct: 453 EVVRSHFIFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGKFNAKPCITRKLKLAGAEN 512

Query: 498 WDPNFVAMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYK 557
           WD N  A+L+Q+Y++S+ MAEHLANNYGTRSPIICEM +  ++N+LPV   GREN ++  
Sbjct: 513 WDANLAALLSQKYNVSTPMAEHLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISN 572

Query: 558 -NVNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGD 616
            +V +DSFRYP+TIAELKYS+ YEYTRTALDFLMRRTR+ FLDAK+AL+AV GTV IMGD
Sbjct: 573 AHVGYDSFRYPYTIAELKYSMDYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGD 632

Query: 617 ELGWDENKRLSEIQQASDFIKTFGV 641
            L WD ++R  E   A+D+IKTFGV
Sbjct: 633 HLNWDNDRREREKVYATDYIKTFGV 657

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/609 (70%), Positives = 513/609 (84%), Gaps = 11/609 (1%)

Query: 34  NEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALV 93
           NEV   + L+  APA PSRSELL+K+ KT+QFDVLVIGGGA+G G A+D +TRGLNVAL+
Sbjct: 33  NEVPTELKLERRAPAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALL 92

Query: 94  EMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVL 153
           EMNDFASGTSSKSTKMAHGGVRYLEKA WELSKAQLDLVIEALNER H+L TAPHLCKVL
Sbjct: 93  EMNDFASGTSSKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVL 152

Query: 154 PIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVY 213
           PIMIPVY +WQVPYFYVG KMYD FAGSQNLKSSY+++A  A EVAPMLDAS LKAGLVY
Sbjct: 153 PIMIPVYKWWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVY 212

Query: 214 HDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRIN 273
           HDGSFNDSRMNA +AVTAIE GATVLNYMEV RL+KN + G+VEGA+A DRETGKE+ + 
Sbjct: 213 HDGSFNDSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVR 272

Query: 274 AKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVH 333
           AKVVVN+TGPFSDR+LQMDN  +GLP + ++   N+   +I + VAV+NP+MVVPS+GVH
Sbjct: 273 AKVVVNATGPFSDRLLQMDNHPEGLPDDKILDAINKD-STIATEVAVANPKMVVPSSGVH 331

Query: 334 IVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDI 393
           I+LP++YCPK +GLLDA+TSDGRVMFFLPWQGKVLAGTTDIPMKQVP NPTATEADIQDI
Sbjct: 332 IILPSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDI 391

Query: 394 LKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLV 453
           LKELQHYIKFPVKREDV SAWAGIRPLV+DPR      ++S TQGLVR+H +FTS NG+V
Sbjct: 392 LKELQHYIKFPVKREDVQSAWAGIRPLVKDPR-----KNLSDTQGLVRSHLVFTSKNGMV 446

Query: 454 TIAGGKWTTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAMLAQEYHL 512
           TI+GGKWTTYREMAEET++EVVK G F  AKPCIT+K+KL+GAE WD N  A+L+ +Y++
Sbjct: 447 TISGGKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNI 506

Query: 513 SSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAE 572
              +AEHL+ NYGT++  +CE+F  D  N LPV+    +  +    +++++FRYP+TI E
Sbjct: 507 PPLLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTS----IDYNAFRYPYTIGE 562

Query: 573 LKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQA 632
           LK+++ +EY RT LDFLMRRTR+ FLDAKQAL+AV GTV +MGD LGWD  KR++E + A
Sbjct: 563 LKFTMTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYA 622

Query: 633 SDFIKTFGV 641
            ++IKTFGV
Sbjct: 623 IEYIKTFGV 631

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/615 (69%), Positives = 502/615 (81%), Gaps = 4/615 (0%)

Query: 30  RSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLN 89
           +S H    VS P+     ++P+RS+LL ++ +  QFDVL+IGGGATGTGCAVD ATRGL 
Sbjct: 41  QSQHTPGLVS-PVDTLQVSLPTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQ 99

Query: 90  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHL 149
           VALVE NDFASGTSSKSTKMAHGGVRYLEKAF++LSK+QLDLVIEALNER H+LNTAPHL
Sbjct: 100 VALVEQNDFASGTSSKSTKMAHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHL 159

Query: 150 CKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKA 209
           CK+LPI+IPVY YWQVPYFY GCK+YDLFAG+QNLK+SY+++   A E+APML+A+ LKA
Sbjct: 160 CKILPILIPVYTYWQVPYFYAGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKA 219

Query: 210 GLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKE 269
            LVYHDGSFNDSR+NA LA+TAIERGATVLNY+EV +LLK+ +TG + G   RD ETG  
Sbjct: 220 ALVYHDGSFNDSRLNATLAITAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDT 279

Query: 270 FRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPS 329
             + +KVVVN+TGPFSD+ILQMD    GLP +  +       + I S++AV NP MVVPS
Sbjct: 280 MDVLSKVVVNATGPFSDKILQMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPS 339

Query: 330 AGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEAD 389
           +GVHI+LP++YCPKQ+GLLD +TSDGRVMFFLPWQGKV+AGTTDIPM QVPE P A EAD
Sbjct: 340 SGVHIILPSYYCPKQMGLLDVRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEAD 399

Query: 390 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTLK--EGDDVSSTQGLVRNHFLFT 447
           IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPR +   E   + STQGLVR+HF+FT
Sbjct: 400 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFT 459

Query: 448 SDNGLVTIAGGKWTTYREMAEETIDEVVKQGHF-QAKPCITKKIKLAGAEGWDPNFVAML 506
           SDNGLVTIAGGKWTTYREMAEETIDEVVK G F  AKPCIT+++KLAGAE WDPN  A+L
Sbjct: 460 SDNGLVTIAGGKWTTYREMAEETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALL 519

Query: 507 AQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRY 566
           +Q+Y+L S MA +L++NYGTRSPIICE+F  DE N+LPV   G E   +  N +F++FRY
Sbjct: 520 SQKYNLPSMMANYLSDNYGTRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRY 579

Query: 567 PFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRL 626
           P TI ELKYS++YEY RTALDFLMRRTRF FLDAK+AL AV GTV IMGDE  W   +R 
Sbjct: 580 PITIGELKYSMRYEYARTALDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQ 639

Query: 627 SEIQQASDFIKTFGV 641
            E ++   FIK+FGV
Sbjct: 640 EEKEKTIQFIKSFGV 654

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/601 (69%), Positives = 500/601 (83%), Gaps = 12/601 (1%)

Query: 50  PSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKM 109
           PSRSELL  + KT +FDVL+IGGGATGTGCAVD +TRGLNVAL+EMNDFAS TSSKSTKM
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169
           AHGGVRYLEKA ++LSKAQLDLVIEALNER HML TAPHLCK+LPIMIPVYNYW+VPYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 170 VGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229
            GCKMYD FAGSQNLKS+Y+++   A ++APMLD   LKA LVYHDGSFND+RMN +LAV
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 230 TAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRIL 289
           TAIE GATVLNYMEV +L+K+ KTG+++GA  RDRET K++ + AKVVVNSTGPFSD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 290 QMDNAKDGLP------RNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPK 343
           QMD  K G P        D  +  +  HD++ SR+AV NP+MVVPSAGVHI+LP++YCPK
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNL-SRIAVDNPKMVVPSAGVHIILPSYYCPK 366

Query: 344 QIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKF 403
            +G+LD KT+DGRVMFFLPWQ KVLAGTTDIPMK+VPENP ATEADI+DIL ELQHY KF
Sbjct: 367 DMGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKF 426

Query: 404 PVKREDVLSAWAGIRPLVRDPRTL---KEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKW 460
           PVKREDVLSAWAGIRPLVRDPR L    +GDD  STQGLVR+HF+FTS+N LVTIAGGKW
Sbjct: 427 PVKREDVLSAWAGIRPLVRDPRKLSPNSKGDD--STQGLVRSHFIFTSENNLVTIAGGKW 484

Query: 461 TTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHL 520
           TTYR MAEETIDE +K G    KP +TK + L+G E W PN  A+L+Q+YH+ S ++++L
Sbjct: 485 TTYRRMAEETIDEAIKVGQLPNKPSVTKDLILSGGENWTPNTAALLSQKYHIPSSLSKYL 544

Query: 521 ANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYE 580
           + NYGTR+PIICE+ ++D+KN+LPVT  G+E+  +  NV+F + RYP+T+AE+KY +  E
Sbjct: 545 SENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNE 604

Query: 581 YTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFG 640
           Y+RTALDFL+RRTRFGFLDAK+A+ AV+GTVSIMGDEL WD  KR  EI+++ ++IKT G
Sbjct: 605 YSRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLG 664

Query: 641 V 641
           V
Sbjct: 665 V 665

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/600 (69%), Positives = 502/600 (83%), Gaps = 9/600 (1%)

Query: 49  IPSRSELLDKMAKTD-QFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKST 107
           +PSRS+L +++   D QFD+L+IGGGATGTGCA+D ATRGLNVALVE +DFASGTSSKST
Sbjct: 56  LPSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKST 115

Query: 108 KMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPY 167
           KMAHGGVRYLEKAF + SK+QLDLVIEALNER H+LNTAPHLCK+LPI+IPVYNYWQ+PY
Sbjct: 116 KMAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPY 175

Query: 168 FYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAAL 227
           FY GCK YD FAG QNLKSSY+++ + A E+APMLDA+ LKA LVYHDGSFNDSR+N+++
Sbjct: 176 FYAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSI 235

Query: 228 AVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDR 287
           A+TAIE GATVLNY+EV +LLK+  + ++ G   +D+ETG+   + +KV+VN+TGP+SD 
Sbjct: 236 AITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDT 295

Query: 288 ILQMDNAKDGLPRNDLVQFANEGHD--SIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQI 345
           ILQMD    GLP  DL     + +D   I S++AVSNP+MVVPS+GVHI+LP++YCPKQ+
Sbjct: 296 ILQMDKNLSGLP--DLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQM 353

Query: 346 GLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPV 405
           GLLDA+T+DGRVMFFLPWQGKV+AGTTDIPM QVP+ P A E DIQDILKELQHYIKFPV
Sbjct: 354 GLLDARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPV 413

Query: 406 KREDVLSAWAGIRPLVRDPRTLKEG--DDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTY 463
           +REDVLSAWAGIRPLVRDPR + +     + +TQGLVR+HFLFTSDNGL+TIAGGKWTTY
Sbjct: 414 RREDVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTY 473

Query: 464 REMAEETIDEVVKQGHFQ--AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLA 521
           REMAEETIDEVVK GHF   AKPC TK +KL GAE WDPN VA+L+Q+++LSS MA++L+
Sbjct: 474 REMAEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFNLSSMMAKYLS 533

Query: 522 NNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEY 581
            NYGTRS IIC++F R+E N+LPV   G E+  +  NV+F++FRYP TIAELKY++KYEY
Sbjct: 534 ENYGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEY 593

Query: 582 TRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641
            RT LDFLMRRTRF +LDA QAL AVKGTV +MGDE GWD  +R  EI+ A+ FI++FGV
Sbjct: 594 ARTPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/619 (67%), Positives = 493/619 (79%), Gaps = 9/619 (1%)

Query: 30  RSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLN 89
           R   N+    +P    AP   SR +LLD++AKT QFDVL+IGGGATGTGCA+D ATRGLN
Sbjct: 33  RLVRNDASYMVPFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLN 92

Query: 90  VALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHL 149
           VALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHL
Sbjct: 93  VALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHL 152

Query: 150 CKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKA 209
           C VLPI+IP+YN WQVPY Y+GCK YD FAGSQNLK SY+++     E APML    LKA
Sbjct: 153 CTVLPILIPIYNTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKA 212

Query: 210 GLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKE 269
            LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV RL+K+  +G+V GA ARD ET + 
Sbjct: 213 SLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNEL 272

Query: 270 FRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPS 329
            +INAK VVN+TGP+SD ILQMD    G P + L    N    S  +++AV++P+MV+PS
Sbjct: 273 VKINAKCVVNATGPYSDAILQMDRNPSGQPNSPLND--NSLIKSTFNQIAVTDPKMVIPS 330

Query: 330 AGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEAD 389
            GVHIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEAD
Sbjct: 331 IGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEAD 390

Query: 390 IQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTL-KEGDDVSSTQGLVRNHFLFTS 448
           IQDILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+TQG+VR+HFLFTS
Sbjct: 391 IQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTS 450

Query: 449 DNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFVAMLA 507
           DNGL+TIAGGKWTTYR+MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+VA+LA
Sbjct: 451 DNGLITIAGGKWTTYRQMAEETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLA 510

Query: 508 QEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKN-----VNFD 562
           Q YHLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +Y +     VNFD
Sbjct: 511 QNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD 570

Query: 563 SFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDE 622
           +FRYPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL +   TV +MGDE  W E
Sbjct: 571 TFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSE 630

Query: 623 NKRLSEIQQASDFIKTFGV 641
            KR  E+++  +FIKTFGV
Sbjct: 631 KKRQWELEKTINFIKTFGV 649

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/623 (67%), Positives = 496/623 (79%), Gaps = 10/623 (1%)

Query: 27  QRDRS-AHNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGAT 85
           Q DR   HN+    +     AP   SR +LLD++AKT QFDVL+IGGGATGTGCA+D AT
Sbjct: 29  QGDRPLVHNDPSYMVQFPTAAPPQVSRRDLLDRLAKTHQFDVLIIGGGATGTGCALDAAT 88

Query: 86  RGLNVALVEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNT 145
           RGLNVALVE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NT
Sbjct: 89  RGLNVALVEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINT 148

Query: 146 APHLCKVLPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDAS 205
           APHLC VLPI+IP+Y+ WQVPY Y+GCK YD FAGSQNLK SY+++     E APML   
Sbjct: 149 APHLCTVLPILIPIYSTWQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTD 208

Query: 206 ILKAGLVYHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRE 265
            LKA LVYHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  +G+V GA ARD E
Sbjct: 209 NLKASLVYHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPTSGKVIGAEARDVE 268

Query: 266 TGKEFRINAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRM 325
           T +  RINAK VVN+TGP+SD ILQMD    GLP + L    N    S  +++AV +P+M
Sbjct: 269 TNELVRINAKCVVNATGPYSDAILQMDRNPSGLPDSPLND--NSKIKSTFNQIAVMDPKM 326

Query: 326 VVPSAGVHIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTA 385
           V+PS GVHIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  
Sbjct: 327 VIPSIGVHIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMP 386

Query: 386 TEADIQDILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTL-KEGDDVSSTQGLVRNHF 444
           TEADIQDILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+TQG+VR+HF
Sbjct: 387 TEADIQDILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHF 446

Query: 445 LFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFV 503
           LFTSDNGL+TIAGGKWTTYR+MAEET+D+VV+ G F   KPC T+ IKLAGAE W  N+V
Sbjct: 447 LFTSDNGLITIAGGKWTTYRQMAEETVDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYV 506

Query: 504 AMLAQEYHLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKN----- 558
           A+LAQ YHLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +Y +     
Sbjct: 507 ALLAQNYHLSSKMSNYLVQNYGTRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNL 566

Query: 559 VNFDSFRYPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDEL 618
           VNFD+FRYPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL AV  TV +MGDE 
Sbjct: 567 VNFDTFRYPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEF 626

Query: 619 GWDENKRLSEIQQASDFIKTFGV 641
            W E KR  E+++  +FIKTFGV
Sbjct: 627 NWSEKKRQWELEKTVNFIKTFGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/616 (66%), Positives = 487/616 (79%), Gaps = 9/616 (1%)

Query: 33  HNEVHVSIPLKAEAPAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVAL 92
           HN+    +     AP   SR +LL+++ KT QFDVL+IGGGATGTGCA+D ATRGLNVAL
Sbjct: 39  HNDASYMVQFPTAAPPQVSRRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVAL 98

Query: 93  VEMNDFASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKV 152
           VE  DFASGTSSKSTKM HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC V
Sbjct: 99  VEKGDFASGTSSKSTKMIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTV 158

Query: 153 LPIMIPVYNYWQVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLV 212
           LPI+IP+Y+  QVPY Y+GCK YD FAGSQNLK SY+++     E APML    LKA LV
Sbjct: 159 LPILIPIYSTLQVPYIYMGCKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLV 218

Query: 213 YHDGSFNDSRMNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRI 272
           YHDGSFNDSR+NA LA+TA+E GATVLNY+EV +L+K+  +G+V GA ARD ET +  RI
Sbjct: 219 YHDGSFNDSRLNATLAITAVENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRI 278

Query: 273 NAKVVVNSTGPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGV 332
            AK VVN+TGP+SD ILQMD    G P + L    N    S  +++AV +P+MV+PS GV
Sbjct: 279 KAKCVVNATGPYSDAILQMDRNPSGQPDSPLND--NSKAKSAFNQIAVMDPKMVIPSIGV 336

Query: 333 HIVLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQD 392
           HIVLP+FYCPK +GLLD +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQD
Sbjct: 337 HIVLPSFYCPKDMGLLDVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQD 396

Query: 393 ILKELQHYIKFPVKREDVLSAWAGIRPLVRDPRTL-KEGDDVSSTQGLVRNHFLFTSDNG 451
           ILKELQHYI+FPVKREDVLSAWAG+RPLVRDPRT+  +G   S+TQG+VR+HFLFTSDN 
Sbjct: 397 ILKELQHYIEFPVKREDVLSAWAGVRPLVRDPRTIPADGKKGSATQGVVRSHFLFTSDND 456

Query: 452 LVTIAGGKWTTYREMAEETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEY 510
           L+TIAGGKWTTYR+MAEETID+VV+ G F    PC T+ IKLAGAE W  N+VA+LAQ Y
Sbjct: 457 LITIAGGKWTTYRQMAEETIDKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNY 516

Query: 511 HLSSKMAEHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKN-----VNFDSFR 565
           HLSSKM+ +L  NYGTRS IICE F+   +N+LP++   +EN  +Y +     VNFD+FR
Sbjct: 517 HLSSKMSNYLVQNYGTRSSIICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFDTFR 576

Query: 566 YPFTIAELKYSVKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKR 625
           YPFTI ELKYS++YEY RT LDFL+RRTRF FLDAK+AL +V  TV +MGDE  W E KR
Sbjct: 577 YPFTIGELKYSMQYEYCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKR 636

Query: 626 LSEIQQASDFIKTFGV 641
             E+++  +FIKTFGV
Sbjct: 637 QWELEKTVNFIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/540 (68%), Positives = 431/540 (79%), Gaps = 9/540 (1%)

Query: 109 MAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYF 168
           M HGGVRYLEKAFWE SKAQLDLVIEALNER H++NTAPHLC VLPI+IP+YN WQVPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 169 YVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALA 228
           Y GCK YD FAG QNLKSSY+++     E APML    LKA LVYHDGSFNDSR+NA LA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 229 VTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRI 288
           +TA+E GATVLNY+EV +L+K+  +G+V GA ARD ET +  RINAK VVN+TGP+SD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 289 LQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLL 348
           LQMD    G P + L    N    S  ++VAV +P MV+PS GVHIVLP+FYCPK IGLL
Sbjct: 181 LQMDRNASGQPNSPLND--NSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLL 238

Query: 349 DAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRE 408
           D +TSDGRVMFFLPWQGKVLAGTTDIP+KQVPENP  TEADIQDILKELQHYI+FPVKRE
Sbjct: 239 DVRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRE 298

Query: 409 DVLSAWAGIRPLVRDPRTLKEGDDV-SSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMA 467
           DVLSAWAG+RPLVRDPR++  G    S+TQG+VR+HFLFTSDNGL+TIAGGKWTTYR+MA
Sbjct: 299 DVLSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 358

Query: 468 EETIDEVVKQGHFQ-AKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMAEHLANNYGT 526
           EETID+VV+ G F   KPC T+ IKLAGAE W  N+VA+LAQ YHLSSKM+ +L  NYGT
Sbjct: 359 EETIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYHLSSKMSNYLVENYGT 418

Query: 527 RSPIICEMFRRDEKNQLPVTFGGRENVTVYKN-----VNFDSFRYPFTIAELKYSVKYEY 581
           RS IICE F+   +N+LP++   +EN T+Y N     VNFD+FRYPFTI ELKYS++YEY
Sbjct: 419 RSSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFDTFRYPFTIGELKYSMQYEY 478

Query: 582 TRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641
            RT LDFL+RRTRF FLDAK+AL +V  TV +MGDE  W + KR  E+++  +FIKTFGV
Sbjct: 479 CRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFGV 538

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/594 (64%), Positives = 467/594 (78%), Gaps = 9/594 (1%)

Query: 50  PSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKM 109
           P R+++L ++  T +FDVLV+GGGATGTG A+D + RGL VALVE  DFA+GTSSKSTK+
Sbjct: 59  PDRAKVLQRLQDT-KFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKL 117

Query: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169
           AHGGVRYLEKA +ELSK QLDLV+EALNER H+L  APHL K+LPI+IPVY YW+VPYFY
Sbjct: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177

Query: 170 VGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229
            GCKMYD FAG+QNLKSSY+++    S +APMLD   LK GLVYHDG FNDSR+ A LA+
Sbjct: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237

Query: 230 TAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRIL 289
           +A+ERGATV NY+ V +L+K++ TG + GA   D+ETG  F +NAK+VVN+TGP+SD+IL
Sbjct: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297

Query: 290 QMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLD 349
           QMD    GLP  +  +   E      + +AV NP+MVVPS GVHI LP+FYCP ++GLLD
Sbjct: 298 QMDANPQGLPEKEPEKATPE-----NALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352

Query: 350 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRED 409
           A TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+RED
Sbjct: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412

Query: 410 VLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEE 469
           VLSAWAGIRPLVRDPR  +       T+GLVR+HF+FTS   LVTIAGGKWTTYREMAEE
Sbjct: 413 VLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472

Query: 470 TIDEVVKQGHFQA-KPCITKKIKLAGAEGWDPNFVAMLAQEYH-LSSKMAEHLANNYGTR 527
           T+DEV+K G FQ  KPC T+K KL GA+ W+ NF A L Q Y  L   +AEHLANNYG R
Sbjct: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532

Query: 528 SPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALD 587
           +PIICEMF  D+ ++LPV   G  +  V KN++ ++F YPFTIAELKY +++EY RTALD
Sbjct: 533 APIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALD 591

Query: 588 FLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641
           FL+RR+RF FLDA++AL AV  TV+++GDELGWD  KR +E  +   +IKTFGV
Sbjct: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>TBLA0A10680 Chr1 (2640996..2641781) [786 bp, 261 aa] {ON} Anc_4.380
           YJR144W
          Length = 261

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 5/86 (5%)

Query: 436 TQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGA 495
           T  LV   +       +V+IA G+   + E    T  E  K      + C    I   G+
Sbjct: 161 TPKLVTREYALVCHGQIVSIARGEQDYFNETGIPTATEGCKSNALM-RCCKDLGI---GS 216

Query: 496 EGWDPNFVAMLAQEYHLSSKMAEHLA 521
           E WDP F+    +EY +  K  EH+A
Sbjct: 217 ELWDPTFIKTFKKEYCV-DKFVEHIA 241

>Suva_10.526 Chr10 (903294..906728) [3435 bp, 1144 aa] {ON} YLR410W
           (REAL)
          Length = 1144

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 335 VLPAFYCPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVP 380
           VL  F CPK+ G+LDA+  D  ++  LP   ++L    D+  ++ P
Sbjct: 935 VLFDFICPKEYGILDAEKLDIGLLTSLPLAKQILNDIGDMKNRETP 980

>KLTH0D00770g Chr4 (74519..76360) [1842 bp, 613 aa] {ON} similar to
           uniprot|P32864 Saccharomyces cerevisiae YOR370C MRS6 Rab
           escort protein forms a complex with the Ras-like small
           GTPase Ypt1p that is required for the prenylation of
           Ypt1p by protein geranylgeranyltransferase type II
           (Bet2p-Bet4p)
          Length = 613

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 27  QRDRSAHNEVHVSIPLKAEAPAIPSRSELLDKMAKT--DQFDVLVIGGGATGTGCAVDGA 84
           +R  S  N+   S+  +A +  +P  + + D +  T  D+ DV+V+G G   +  A   A
Sbjct: 12  ERRPSTLNQSSFSMERRASSVVVPHLAGIEDPLPDTTPDKVDVVVVGTGLVESILAAALA 71

Query: 85  TRGLNVALVEMNDFASGTSSKST 107
            +G NV  ++ N +   TS+  T
Sbjct: 72  WQGSNVLHIDSNSYYGDTSATLT 94

>Kwal_56.23636 s56 complement(631160..632425) [1266 bp, 421 aa] {ON}
           YLR107W (REX3) - RNA EXonuclease; member of 3'->5'
           exonuclease family. See Moser et al. 1997 Nucleic acids
           Res. 25:5110-5118 [contig 175] FULL
          Length = 421

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 28/49 (57%)

Query: 250 NEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRILQMDNAKDGL 298
           N+K   +EGA+A+   +G+ +R NA +++        ++  +D+ K G+
Sbjct: 71  NQKAIDLEGAIAKKSASGQSYRFNASILLRDLAKTKGKVETLDSKKRGV 119

>KAFR0D01070 Chr4 complement(216926..218404) [1479 bp, 492 aa] {ON}
           Anc_8.56 YPL017C
          Length = 492

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 66  DVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGT 102
           D++VIGGG  G   A+ GA  G N A +E      GT
Sbjct: 22  DLVVIGGGPAGYFAAIKGAQLGFNTACIEKRGKLGGT 58

>Smik_11.267 Chr11 complement(446092..448347) [2256 bp, 751 aa] {ON}
           YKR010C (REAL)
          Length = 751

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 573 LKYSVKYEYTRTALDFLMRRTRFGF-LDA----KQALEAVKGTVSIMGDELGWDENKRLS 627
           LK+   Y Y    ++ +  R R G  LD+    K   E+    + I+ DEL W +NK +S
Sbjct: 103 LKFDKLYPYFNEPIEIMSLRDRHGCDLDSQFIIKDVFESDGVVLVILKDELDWSKNKHIS 162

Query: 628 EIQQA 632
            +Q A
Sbjct: 163 LLQLA 167

>TPHA0H03060 Chr8 complement(727126..728979) [1854 bp, 617 aa] {ON}
           Anc_7.10 YOR370C
          Length = 617

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 47  PAIPSRSELLDKMAKT--DQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSS 104
           P +P  + + D + +T  D+ DVL+ G G   +  A   A +G +V  ++ ND+   TS+
Sbjct: 29  PVVPHLAGIEDPLPETTPDKVDVLIAGTGMVESVLAAALAWQGSSVLHIDKNDYYGDTSA 88

Query: 105 KST 107
             T
Sbjct: 89  TLT 91

>KLLA0D11154g Chr4 (952049..953530) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P09624 Saccharomyces cerevisiae
           YFL018C LPD1 Dihydrolipoamide dehydrogenase the
           lipoamide dehydrogenase component (E3) of the pyruvate
           dehydrogenase and 2-oxoglutarate dehydrogenase multi-
           enzyme complexes
          Length = 493

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 51  SRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGT 102
           S S LL  + K  + D++VIGGG  G   A+  A  G +VA VE      GT
Sbjct: 11  SSSALLKTVTK--KHDLVVIGGGPGGYVAAIKAAQLGYDVACVEKRGRLGGT 60

>Smik_15.552 Chr15 complement(975355..977166) [1812 bp, 603 aa] {ON}
           YOR370C (REAL)
          Length = 603

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 49  IPSRSELLDKMAKT--DQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKS 106
           +P  + + D +  T  D+ DVL++G G   +  A   A +G NV  ++ ND+   TS+  
Sbjct: 29  VPHLAGIEDPLPATTPDKVDVLIVGTGMVESVLAAALAWQGSNVLHIDKNDYYGDTSATL 88

Query: 107 T 107
           T
Sbjct: 89  T 89

>Skud_6.53 Chr6 complement(103908..105407) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 66  DVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGT 102
           DV++IGGG  G   A+  A  G N A VE      GT
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

>Suva_6.41 Chr6 complement(74641..76140) [1500 bp, 499 aa] {ON}
           YFL018C (REAL)
          Length = 499

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 66  DVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGT 102
           DV++IGGG  G   A+  A  G N A VE      GT
Sbjct: 28  DVVIIGGGPAGYVAAIKAAQLGFNTACVEKRGKLGGT 64

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,000,386
Number of extensions: 2609604
Number of successful extensions: 6445
Number of sequences better than 10.0: 45
Number of HSP's gapped: 6533
Number of HSP's successfully gapped: 45
Length of query: 641
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 525
Effective length of database: 40,180,143
Effective search space: 21094575075
Effective search space used: 21094575075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)