Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0E00814g5.712ON97497447130.0
Kwal_55.196455.712ON97097930940.0
KLLA0A00396g5.712ON1012103320750.0
TPHA0D046605.712ON1045108919230.0
CAGL0H06721g5.712ON108185816690.0
ZYRO0B16544g5.712ON104485315020.0
AFR296C5.712ON116976714950.0
SAKL0E15136g5.712ON103744314790.0
NCAS0G001705.712ON103046213251e-166
TDEL0B020805.712ON102545213201e-165
NDAI0F002005.712ON110545413061e-162
Ecym_40095.712ON151747413011e-158
KNAG0L022005.712ON116158812391e-152
TBLA0E017605.712ON121255512291e-150
Kpol_2001.785.712ON40341611581e-149
KAFR0D021605.712ON84669011471e-142
Smik_11.3625.712ON72144010581e-130
Suva_11.3355.712ON72443910481e-129
Skud_11.3385.712ON71244010411e-128
YKR098C (UBP11)5.712ON71744110331e-126
KAFR0H001505.712ON6564769051e-109
CAGL0G02563gsingletonON6314478278e-98
YIL156W (UBP7)5.712ON10712548479e-97
Suva_9.305.712ON10622498372e-95
Smik_9.135.712ON10602558337e-95
Skud_9.125.712ON10642508275e-94
Kpol_304.65.712ON5624597412e-86
TDEL0B042208.188ON8255533231e-29
Kpol_1032.288.188ON8824483221e-29
NDAI0C059008.188ON8265363158e-29
YER144C (UBP5)8.188ON8057363095e-28
KLLA0E10275g8.188ON7965213014e-27
YDR069C (DOA4)8.188ON9262802829e-25
KNAG0D019308.188ON9862442821e-24
Smik_4.3078.188ON9292332802e-24
CAGL0G05247g8.188ON9472632792e-24
KAFR0C025908.188ON9782432783e-24
AFR007W8.188ON8482402773e-24
Ecym_61848.188ON8512402774e-24
Skud_4.3238.188ON9262332756e-24
TBLA0F036108.188ON11442572758e-24
Suva_2.2288.188ON9272332741e-23
SAKL0H18986g8.188ON8932682721e-23
ZYRO0G06798g8.188ON8772372722e-23
Smik_5.3098.188ON8054452693e-23
TPHA0C027708.188ON9702352694e-23
KLTH0H07678g8.188ON8612392684e-23
Kwal_14.20088.188ON4242952589e-23
NDAI0A036808.188ON11162972623e-22
NCAS0B042808.188ON9222342579e-22
Skud_5.2818.188ON8235282452e-20
CAGL0I06765g8.188ON8872542417e-20
Suva_5.2728.188ON7885152327e-19
NCAS0A039108.188ON7955232042e-15
Smik_10.371.137ON12472611953e-14
YJL197W (UBP12)1.137ON12542111917e-14
Skud_10.221.137ON12552041872e-13
ZYRO0C17908g1.137ON12042091863e-13
TDEL0C056401.137ON11782181863e-13
Suva_6.2761.137ON12562091863e-13
Kpol_2001.541.137ON12231981801e-12
KNAG0C021801.137ON12312141773e-12
AFR627C1.137ON12872061756e-12
Ecym_81401.137ON12642081721e-11
NCAS0I031401.137ON12012001721e-11
CAGL0L01639g1.137ON11472271702e-11
KAFR0F015601.137ON11712131683e-11
TPHA0A025401.137ON12862001659e-11
TBLA0J006001.137ON14622131631e-10
Kwal_33.136281.137ON11602041622e-10
NDAI0B004801.137ON12531981586e-10
KNAG0G015908.188ON6712461576e-10
SAKL0C04246g1.137ON12971371578e-10
KLLA0C03476g1.137ON12522041523e-09
KLTH0F03674g1.137ON11981991514e-09
TBLA0D010708.742ON4832591461e-08
KNAG0C035807.390ON7761271461e-08
ZYRO0B03300g7.390ON8131221352e-07
KNAG0B023707.390ON7531251343e-07
NCAS0A143707.390ON7291241318e-07
Smik_2.497.390ON7451231309e-07
KLLA0C06974g8.742ON4462351272e-06
Suva_2.507.390ON7501231272e-06
Skud_2.387.390ON7481211246e-06
YBL067C (UBP13)7.390ON7471231238e-06
NCAS0E026107.390ON7171261192e-05
TDEL0A011002.69ON6614431192e-05
TPHA0L022905.18ON11931051192e-05
NCAS0I016203.270ON7952541182e-05
NDAI0E041807.390ON8271261164e-05
Ecym_46857.390ON7781231164e-05
KAFR0A069102.307ON6782551155e-05
NCAS0D023905.18ON12111031156e-05
NDAI0A016707.390ON8461241156e-05
KAFR0A042108.742ON4402361121e-04
CAGL0K10494g1.369ON4952011121e-04
NDAI0C059508.202ON10801421122e-04
Kpol_534.231.369ON4961131102e-04
TPHA0O016402.69ON7463841093e-04
KNAG0G029308.742ON4592651083e-04
CAGL0A04477g7.390ON7701211084e-04
NDAI0F034102.69ON8701981084e-04
TDEL0C015707.390ON7651271084e-04
TBLA0C012001.369ON5031191066e-04
Ecym_56715.18ON11761021068e-04
Kpol_1045.417.390ON7121261059e-04
TBLA0C070205.18ON12471021050.001
KNAG0J008003.270ON7651131050.001
KAFR0L017307.390ON7011241040.001
TBLA0B019308.202ON10191421050.001
YMR304W (UBP15)5.18ON12301071040.001
Suva_13.4955.18ON12301071040.001
Kpol_513.255.18ON11901031040.001
YER098W (UBP9)7.390ON7541211030.002
CAGL0M13783g5.18ON11961021030.002
TDEL0B036708.742ON4632601020.002
Smik_5.2447.390ON7491341020.002
Skud_13.4785.18ON12311071030.002
Smik_13.5215.18ON12311071030.002
ZYRO0D07062g5.18ON11931031020.002
TPHA0P006807.390ON7271291020.002
CAGL0M11198g8.742ON4612611000.003
Smik_13.4318.742ON4712671000.003
YFR010W (UBP6)1.369ON4991391000.003
NCAS0C021108.540ON494841000.003
KNAG0C019401.369ON499119990.004
CAGL0I05522g7.390ON7241301000.004
TDEL0D024001.369ON494118990.005
TPHA0G005608.742ON463272980.005
TBLA0E025703.270ON785121990.005
TPHA0E008707.390ON71593990.005
Suva_5.2177.390ON754122980.006
Kpol_1018.937.390ON755125980.007
Kwal_33.144302.69ON511402970.007
KNAG0E012905.18ON1196103980.007
Ecym_27171.369ON483109970.007
KAFR0K018107.390ON714131970.007
Smik_7.3141.369ON499139960.009
KLLA0E01013g8.202ON77482970.009
Suva_4.2953.270ON782198970.009
KNAG0A054502.307ON764120960.009
NCAS0A038408.202ON917140970.010
TBLA0D006207.390ON1171121970.010
TDEL0G004105.18ON1186101970.010
NCAS0D006001.369ON49330950.011
KLTH0B09944g5.18ON1189102960.012
Kwal_34.162681.369ON449122950.013
NDAI0E008108.742ON493237940.015
Skud_5.2237.390ON748121950.015
NDAI0I025305.18ON1197107950.015
TBLA0A064705.443ON132029950.016
ZYRO0F01276g3.270ON776188940.016
Suva_13.4078.742ON471261940.017
KLLA0E02377g5.443ON122094940.018
Suva_6.831.369ON500131940.018
YMR223W (UBP8)8.742ON471258930.019
ZYRO0B11044g8.202ON826146930.024
NDAI0A074103.270ON810232930.027
ZYRO0G01188g1.369ON50030920.028
TPHA0E017105.443ON128327930.030
TPHA0A025101.369ON50534920.031
TDEL0D035503.270ON780229920.033
KAFR0C045201.369ON499122910.033
NDAI0C015505.443ON129543920.037
AGL357W5.18ON1166104920.037
KAFR0C004103.270ON769229910.038
Skud_6.941.369ON499127910.039
KLLA0A10791g1.369ON484120910.040
CAGL0K10252g5.443ON126748910.041
TDEL0A016208.202ON795141910.044
SAKL0G02728g5.443ON123731910.046
Klac_YGOB_Anc_5.18b5.18ON1166101910.048
SAKL0H00418g5.18ON119028900.052
Kwal_26.91518.742ON45496900.052
KLTH0D12760g8.742ON453127890.056
Kwal_14.19578.202ON444134890.058
KNAG0A019708.540ON471149890.058
Ecym_62488.742ON46699890.065
Smik_5.3188.202ON909145890.067
TPHA0D043508.202ON854144890.072
KAFR0I026005.18ON121328890.072
TPHA0J026205.443ON122529890.075
SAKL0H04994g8.742ON454258880.079
NDAI0E028208.540ON495101880.084
AEL029W1.369ON446120870.095
KLTH0B07150g2.69ON756246880.10
Ecym_45145.443ON124647880.11
Kpol_251.73.270ON480124870.12
CAGL0H05335g8.540ON483141870.12
ACL164C5.443ON138944870.12
Skud_14.1482.69ON776223870.13
CAGL0I06600g8.202ON816141870.13
Kwal_26.95985.18ON119127870.14
ZYRO0G01606g5.443ON130530870.15
KLTH0H13354g1.369ON49530850.17
Kpol_1016.15.443ON125131860.19
NDAI0H035501.369ON502114850.21
CAGL0H10186g3.270ON778111850.21
KAFR0D050705.443ON122732850.25
SAKL0F12430g7.390ON75471840.26
KLLA0F18700g3.270ON77047840.29
ZYRO0A05962g8.742ON46593830.29
AGR370W7.390ON74027840.30
Suva_8.1765.443ON127031830.38
SAKL0D03322g3.270ON765120830.40
Ecym_55448.202ON83475820.44
KNAG0B041905.443ON126230820.46
Skud_15.2865.443ON127830820.47
TDEL0D025805.443ON127230820.52
Skud_13.3928.742ON473264810.53
Skud_2.1773.270ON782103810.57
Smik_15.3015.443ON127230820.57
AEL242W8.540ON61388810.59
Kwal_55.213935.443ON123330810.60
KLTH0F15862g5.443ON124126810.63
YOR124C (UBP2)5.443ON127230810.67
NDAI0B034302.307ON856129800.74
KLLA0E20351g7.390ON69731800.79
SAKL0D10120g1.369ON49230800.82
AEL345WsingletonON645120800.83
Suva_14.1562.69ON788202800.84
NCAS0B005808.742ON46696790.89
Kpol_1055.318.202ON822144800.90
NCAS0B061302.307ON770235800.93
AGR139C8.202ON78975800.94
ZYRO0D03982g8.540ON82172800.95
SAKL0H18656g8.202ON772143791.0
Kwal_56.230843.270ON762112791.1
NCAS0H021005.443ON126929791.2
Ecym_11668.540ON696102781.5
Kpol_1062.235.443ON126627771.8
YER151C (UBP3)8.202ON912144772.1
CAGL0K10384g1.360ON210496772.2
SAKL0B03036g8.97ON472113752.6
AGR023C3.270ON780110753.2
Suva_5.2808.202ON905144753.7
KAFR0B023708.202ON829138743.9
ZYRO0A01232g2.229ON232105733.9
KAFR0A020702.557ON42563734.5
Skud_16.2098.540ON503107734.7
Skud_5.2898.202ON910144735.9
TPHA0M010903.270ON780111736.4
Smik_12.1658.295ON490952736.4
KLTH0H07370g8.202ON781142727.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0E00814g
         (974 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...  1820   0.0  
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...  1196   0.0  
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   803   0.0  
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   745   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   647   0.0  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   583   0.0  
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   580   0.0  
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   574   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     514   e-166
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   513   e-165
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     507   e-162
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   505   e-158
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   481   e-152
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   478   e-150
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   450   e-149
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   446   e-142
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   412   e-130
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   408   e-129
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   405   e-128
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   402   e-126
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   353   e-109
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   323   8e-98
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   330   9e-97
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   327   2e-95
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   325   7e-95
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   323   5e-94
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   290   2e-86
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   129   1e-29
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   128   1e-29
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   125   8e-29
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   123   5e-28
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   120   4e-27
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   113   9e-25
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   113   1e-24
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   112   2e-24
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   112   2e-24
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   111   3e-24
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   111   3e-24
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   111   4e-24
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   110   6e-24
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   110   8e-24
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   110   1e-23
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   109   1e-23
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   109   2e-23
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   108   3e-23
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   108   4e-23
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   107   4e-23
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   103   9e-23
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             105   3e-22
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    103   9e-22
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    99   2e-20
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    97   7e-20
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    94   7e-19
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     83   2e-15
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    80   3e-14
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    78   7e-14
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    77   2e-13
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    76   3e-13
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    76   3e-13
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    76   3e-13
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    74   1e-12
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    73   3e-12
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    72   6e-12
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    71   1e-11
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    71   1e-11
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    70   2e-11
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    69   3e-11
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    68   9e-11
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    67   1e-10
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    67   2e-10
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    65   6e-10
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    65   6e-10
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    65   8e-10
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    63   3e-09
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    63   4e-09
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    61   1e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    61   1e-08
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    57   2e-07
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    56   3e-07
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    55   8e-07
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    55   9e-07
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    54   2e-06
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    54   2e-06
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    52   6e-06
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    52   8e-06
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    50   2e-05
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    50   2e-05
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    50   2e-05
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    50   2e-05
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    49   4e-05
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    49   4e-05
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    49   5e-05
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    49   6e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    49   6e-05
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    48   1e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    48   1e-04
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    48   2e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    47   2e-04
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    47   3e-04
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    46   3e-04
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    46   4e-04
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    46   4e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    46   4e-04
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    45   6e-04
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    45   8e-04
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    45   9e-04
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    45   0.001
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    45   0.001
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    45   0.001
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    45   0.001
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    45   0.001
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    45   0.001
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    45   0.001
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    44   0.002
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    44   0.002
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    44   0.002
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.002
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    44   0.002
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    44   0.002
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    44   0.002
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    44   0.002
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    43   0.003
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    43   0.003
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    43   0.003
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    43   0.003
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    43   0.004
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    43   0.004
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    43   0.005
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    42   0.005
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    43   0.005
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    43   0.005
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    42   0.006
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    42   0.007
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    42   0.007
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    42   0.007
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    42   0.007
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    42   0.007
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    42   0.009
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    42   0.009
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    42   0.009
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    42   0.009
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    42   0.010
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    42   0.010
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    42   0.010
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    41   0.011
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    42   0.012
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    41   0.013
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    41   0.015
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    41   0.015
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    41   0.015
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    41   0.016
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    41   0.016
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    41   0.017
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    41   0.018
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    41   0.018
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    40   0.019
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    40   0.024
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    40   0.027
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    40   0.028
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.030
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    40   0.031
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    40   0.033
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    40   0.033
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    40   0.037
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    40   0.037
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    40   0.038
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    40   0.039
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    40   0.040
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    40   0.041
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    40   0.044
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    40   0.046
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    40   0.048
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    39   0.052
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    39   0.052
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    39   0.056
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    39   0.058
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    39   0.058
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    39   0.065
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    39   0.067
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    39   0.072
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    39   0.072
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    39   0.075
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    39   0.079
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    39   0.084
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    38   0.095
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    39   0.10 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    39   0.11 
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    38   0.12 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    38   0.12 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    38   0.12 
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    38   0.13 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    38   0.13 
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    38   0.14 
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    38   0.15 
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    37   0.17 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    38   0.19 
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    37   0.21 
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    37   0.21 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.25 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    37   0.26 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    37   0.29 
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    37   0.29 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.30 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    37   0.38 
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    37   0.40 
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    36   0.44 
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    36   0.46 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    36   0.47 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    36   0.52 
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    36   0.53 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    36   0.57 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    36   0.57 
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    36   0.59 
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    36   0.60 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    36   0.63 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    36   0.67 
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     35   0.74 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    35   0.79 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    35   0.82 
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    35   0.83 
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    35   0.84 
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       35   0.89 
Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {O...    35   0.90 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    35   0.93 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    35   0.94 
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    35   0.95 
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    35   1.0  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    35   1.1  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    35   1.2  
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    35   1.5  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    34   1.8  
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    34   2.1  
CAGL0K10384g Chr11 complement(1011380..1017694) [6315 bp, 2104 a...    34   2.2  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   2.6  
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    33   3.2  
Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON...    33   3.7  
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    33   3.9  
ZYRO0A01232g Chr1 complement(87135..87833) [699 bp, 232 aa] {ON}...    33   3.9  
KAFR0A02070 Chr1 (430633..431910) [1278 bp, 425 aa] {ON} Anc_2.5...    33   4.5  
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    33   4.7  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    33   5.9  
TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {...    33   6.4  
Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa]...    33   6.4  
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    32   7.6  

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 1820 bits (4713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/974 (90%), Positives = 885/974 (90%)

Query: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
           MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA
Sbjct: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60

Query: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
           EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES
Sbjct: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120

Query: 121 MSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPE 180
           MSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPE
Sbjct: 121 MSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPE 180

Query: 181 LEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXXXXXXXXVP 240
           LEPNDHLKV              NEQFPKIHNESHSFPFEEPELHA            VP
Sbjct: 181 LEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEPELHALSLGGSRTRRSSVP 240

Query: 241 ARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVV 300
           ARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVV
Sbjct: 241 ARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVV 300

Query: 301 TCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQ 360
           TCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQ
Sbjct: 301 TCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQ 360

Query: 361 LERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGG 420
           LERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGG
Sbjct: 361 LERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGG 420

Query: 421 YEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKT 480
           YEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHY               KT
Sbjct: 421 YEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYPVAPPSIPPPPPPIAKT 480

Query: 481 EEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAI 540
           EEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAI
Sbjct: 481 EEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAI 540

Query: 541 PTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP 600
           PTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP
Sbjct: 541 PTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP 600

Query: 601 NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660
           NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD
Sbjct: 601 NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660

Query: 661 ELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFC 720
           ELSESNRVANDYPG              EYDTWFEKHISENGISPIDNIFQGQMENGLFC
Sbjct: 661 ELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFC 720

Query: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG 780
           QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG
Sbjct: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG 780

Query: 781 TSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXX 840
           TSASGTGPEEEKKKKRFLLNPDTRASGN                     QSSQQQNLE  
Sbjct: 781 TSASGTGPEEEKKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQNLEKL 840

Query: 841 XXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLY 900
                      NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLY
Sbjct: 841 KSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLY 900

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSS 960
           AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSS
Sbjct: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSS 960

Query: 961 DVYVLFYEKIDESQ 974
           DVYVLFYEKIDESQ
Sbjct: 961 DVYVLFYEKIDESQ 974

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/979 (61%), Positives = 703/979 (71%), Gaps = 18/979 (1%)

Query: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
           MN LYSPEYSNELLQFVK+VYTQDIAHY+P+LRLEKLIDLLEHAEYLFESYR +L A Q 
Sbjct: 1   MNHLYSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQN 60

Query: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
            +LLTAFV GCFYIYLIIPHSIQF SRDKSYAIYADL+KYYQDE NMTNVLLMVT VIES
Sbjct: 61  SELLTAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIES 120

Query: 121 MSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPE 180
           +S+DE+E+A+IMRKRAYSVP+ K    +QAL+ +       +A  ET+ EN +TMWTAPE
Sbjct: 121 VSRDELESAKIMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNENDSTMWTAPE 180

Query: 181 LEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXXXXXXXXVP 240
           LEPNDHLKV              NEQ  K+ NE +S   ++ E+               P
Sbjct: 181 LEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSSSDDIEMAVHSTTQDQR-----P 235

Query: 241 ARASRKLGTTQASNS-----SDFNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQ 295
            R+S  +      NS      D   QK++RY THRK SYHSVHM+ D+YD+FTFN ARLQ
Sbjct: 236 RRSSVPIKVEAPQNSLQSTVDDIYCQKVDRYNTHRKGSYHSVHMTGDEYDSFTFNTARLQ 295

Query: 296 KQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPI 355
           KQS++TCD+L+RIL S++ + LLL+DLRF KRF+TNHI+APNL+N+DP  LW+  KG  I
Sbjct: 296 KQSIITCDKLLRILDSEEAERLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAI 355

Query: 356 ESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPK 415
           E D  LE    N  L   SQF++IVYYTDMKTFM+LDFDYQLVFFQ++YTSN  + CTPK
Sbjct: 356 EGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDFDYQLVFFQMLYTSNWRISCTPK 415

Query: 416 VLLGGYEQWKKFLSKSSQAYCD-KDAFLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXX 474
           VLLGGYEQWKKFL+K  Q+    K+AFL+     G+    T  S   H            
Sbjct: 416 VLLGGYEQWKKFLAKVPQSRVPIKEAFLFRLKPGGKE---TVASAIIHQKASTPLPPSIP 472

Query: 475 XXXXKTEEMTKT---PYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGN 531
                 E+++K     Y RAPFP P  +        + S+       E        L   
Sbjct: 473 PPPPPVEKVSKADSGSYTRAPFPLPAKEMVIQSSLDSISRTQIPSHLESHYTHEKVLQNK 532

Query: 532 GNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEH 591
            ++++ T IPTIEQS NEYVALSITGLRN+G TCY+NSMLQCLFAT+ FRDLFLS KYE 
Sbjct: 533 MHHAEGT-IPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYED 591

Query: 592 YFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFL 651
           YFS++Y+NP+QLSKYFN+LFKKMYMNGGCSVVPTGFLKACNALRPD +IPH+QQDTQEFL
Sbjct: 592 YFSKRYSNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFL 651

Query: 652 LFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQ 711
           LFLLSQLHDELSESN VANDYP               EYD WFE +ISENGISPID IFQ
Sbjct: 652 LFLLSQLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQ 711

Query: 712 GQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNE 771
           GQMENGL CQRCGHSS+NYS+FYVLSLAIP+S S+F Q+KK+RLEDCINLFTSDE+LTNE
Sbjct: 712 GQMENGLLCQRCGHSSYNYSMFYVLSLAIPASMSSFGQKKKMRLEDCINLFTSDEKLTNE 771

Query: 772 NAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQS 831
           NAWDCPKCG++ SG GP+ +KKK++FL   D     +                      S
Sbjct: 772 NAWDCPKCGSAVSGNGPDGDKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPS 831

Query: 832 SQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKN 891
           SQ    E             NF+SLP+VLTIHLSRF YDLT KNNKVITYPL LSIVLKN
Sbjct: 832 SQSPASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKN 891

Query: 892 EQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDID 951
            +++ YRLYAIANHFGNLISGHYTSLVNKDL HDL  G+QKWYYFDDE  K+D+NHG+ID
Sbjct: 892 NEVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNID 951

Query: 952 AGITSISSSDVYVLFYEKI 970
           AGITS+SSSDVYVLFYEKI
Sbjct: 952 AGITSVSSSDVYVLFYEKI 970

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1033 (45%), Positives = 620/1033 (60%), Gaps = 87/1033 (8%)

Query: 1    MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
            M+RLY+PEYS+ELL FV++VY+QD+ HY+ KL+LEKLI+LLE AE LFESYR +L+  + 
Sbjct: 1    MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY 60

Query: 61   EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
            ED L  +V G FY++LIIP S+QF +R+KSY+IY+DLKK YQDE NM+NVLLMV   ++S
Sbjct: 61   EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120

Query: 121  MSKDEVETARIM-----RKRAYSV--PYGKSPVTIQALSKANSATVEPDAPTETEFENGT 173
            +    +E          RKRA+SV  P  +  +    L+ A+  +V+ D  +       +
Sbjct: 121  VLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNNADQKSVDDDYKS-----FAS 175

Query: 174  TMWTAPELEPNDHLKVXXXXXXXXXXXX----XXNEQFPKIHNESHSFPFEEPEL----H 225
            T W AP+L+PND L +                  +E   K  +++ +      +L    H
Sbjct: 176  TEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVSDKLLGSIH 235

Query: 226  AXXXXXXXXXXXXVPARASRKLGTTQ-----ASNSSDF---NDQKINRYATHRKDSYHSV 277
                         VP   S  L T Q     A N S     N    +R  THRKDSYHSV
Sbjct: 236  KPDLLDRTGIIRKVPRHQS--LPTEQHHKLYAQNDSSLMLENMDSFDRSRTHRKDSYHSV 293

Query: 278  HMSND--DYDAFTFNLARLQKQSVVTCDQLMRILC-SQDRDNLLLIDLRFSKRFQTNHIL 334
            ++ ++  D +  +  LAR Q+++ + C  L  +L  ++ R+NLLLIDLR  KRF++NH++
Sbjct: 294  YLGDELEDLNNISTGLARHQQENTIDCFALFSLLKDAESRENLLLIDLRLPKRFESNHLV 353

Query: 335  APNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFD 394
            APNLLN+DP LL++  KG+ +ES   L++ + N +L+  SQ++ IVYYTD K+FM L F+
Sbjct: 354  APNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQYDNIVYYTDYKSFMHLTFN 413

Query: 395  YQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKS-SQAYCDKDAFLYSSTNNG---- 449
            Y+L+ F+L++   K     PK LLGGYEQWK FL+K    +  DK  FL+  + +     
Sbjct: 414  YELILFELLF--KKTGTAIPKSLLGGYEQWKAFLNKQLRDSEFDKSLFLFRKSKSAPSDK 471

Query: 450  -------------RNAP-VTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTP---YNRAP 492
                         +++P + S    +                         P   YNR P
Sbjct: 472  TASKPSVQTDNIIKSSPSILSKEHNDDTLISSTPPIPKVAPPPLPGSPLSAPTIVYNRPP 531

Query: 493  FPTPLVQAQRADHFPASSQNHTRDKN----EIQKHSVPALSGNGNYSKHTAIPTIEQSPN 548
             P P+           + +  T  +N    + Q   VP            +IPTIE+SPN
Sbjct: 532  VPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHLHVPF-----------SIPTIERSPN 580

Query: 549  EYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFN 608
            E+V+LSITGLRN+G TCY+NSMLQCLF    FRDLFL  KY  Y + K +N   +SK+F+
Sbjct: 581  EFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKRSN-TIISKWFS 639

Query: 609  VLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRV 668
            +LF+KMY+NGGCSVVP GFLKAC+ LRPDF IP DQQDTQEFLLFLL  LHDELSE  +V
Sbjct: 640  LLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTLHDELSEPTKV 699

Query: 669  ANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSF 728
            ANDYP               EYD WF++ +  NG+SPID+IFQGQMEN L CQRCG +S+
Sbjct: 700  ANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSLKCQRCGFTSY 759

Query: 729  NYSVFYVLSLAIPS--STSTFSQRKK-VRLEDCINLFTSDEQLTNENAWDCPKCGT---S 782
            NYS FYVLSLAIP+     TFS+ KK +RLEDCINL+T DE LT ENAWDCPKCGT   S
Sbjct: 760  NYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWDCPKCGTHSNS 819

Query: 783  ASGTGPEEE----KKKKRFL-LNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNL 837
            + G+   +E    KKKK FL +N D ++                           ++ ++
Sbjct: 820  SDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLSPFKSNSVKPEKLHI 879

Query: 838  EXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKY 897
            +             NFI++P +L IHLSRFFYDLTKKN  +I YPLIL +VLKN +I +Y
Sbjct: 880  K---SKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLKNNEIARY 936

Query: 898  RLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSI 957
            RLY I NHFGNL+SGHYTSLVNK L H++ KG+QKWYYFDDE VKK+ NHGD D GITSI
Sbjct: 937  RLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDFDRGITSI 996

Query: 958  SSSDVYVLFYEKI 970
            SS DVYVLFYE+I
Sbjct: 997  SSGDVYVLFYERI 1009

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1089 (40%), Positives = 594/1089 (54%), Gaps = 172/1089 (15%)

Query: 5    YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
            ++PEYSNELL+ V D Y  +I  +FP+LRL KLI++LEH  YL ESY   L   + ++ L
Sbjct: 7    FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 65   TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
            +A++ GCFY+YLIIP+S QFQ R+KS+ IY +LK  YQ++ANMTNVL +V   ++S+  +
Sbjct: 67   SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 125  ---EVETAR--IMRKRAYSVPYGKSPVTIQALSKA-------NSATVEPDAPTETEF--- 169
               E+E     I R RAYS P  K    I   SK        N  T+  D   ++ F   
Sbjct: 127  SILELEGIEKVIKRDRAYSSPAPKVN-NISKFSKLSINDNHHNGETISTDNKLQSHFPQT 185

Query: 170  --------------------------ENGTTMWTAPELEPNDHLKVXXXXXXXXXXXXXX 203
                                      E+   +W  P LEPND LK+              
Sbjct: 186  PNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALE----------- 234

Query: 204  NEQFPKIHNESHSFPFEEPELHAXXXXXXXXXXXXVPARASRKLGTTQA----------- 252
                     +   F  EE +  +             P +  R    + A           
Sbjct: 235  ---------QPVEFSDEEIDASSISEPLGRRYSPLSPYQKKRNSSISSAFLVPFPHNEND 285

Query: 253  ---SNSSDFNDQKINRYATHRKDSYHSVHMSNDDYDA-----------FTFNLARLQKQS 298
                NS    D  ++R  THRKDSYHSV+M+N D ++           +  ++ RLQKQ+
Sbjct: 286  KVHDNSMLIEDLPVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSYIQSMDRLQKQN 345

Query: 299  VVTCDQLMRILCS-QDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
            V+TC +L  IL S  +R  LLL+DLR  K  +TNHI+AP+++ +DP LLWN+   +PI S
Sbjct: 346  VITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYS 405

Query: 358  DVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIY-TSNKNLKCTPKV 416
              +L + ++N L++  ++F+YIVYY+D++TFM  D+D+   FF L+  T + NLK  P  
Sbjct: 406  FEELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTN 465

Query: 417  LLGGYEQWKKFLSKSSQAY-CDKDAF---LYSSTNNGRNAP--------VTSHSLPEHYX 464
            LLGG+E+WKK L   ++ Y  D   F   L+++  N    P         TS   PE   
Sbjct: 466  LLGGFEKWKKVLKTYNKEYGIDITPFIKKLHATELNKNTVPTGEMKTLEATSWKQPEVPL 525

Query: 465  XXXXXXXXXXXXXXKTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQ------------- 511
                               T   Y      T L++ +R ++     +             
Sbjct: 526  RIRKRPPPPPPSSIPEIPST---YQNNELTT-LIEDKRLENIDVQGKHRRIEYISPPIPP 581

Query: 512  -----NHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCY 566
                 NH    N+ +KH   AL      S  T +PTIEQ+PN YV+LSITGLRN+G TCY
Sbjct: 582  RTPSPNHQPSYNQ-KKHQYKALK-----SYATPVPTIEQNPNTYVSLSITGLRNLGNTCY 635

Query: 567  VNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTG 626
            ++SMLQCLFAT   RDLF++TKYE Y + K T+   LS+ F++LF+KMY+NGGCSVVP  
Sbjct: 636  ISSMLQCLFATTTLRDLFITTKYESYINHKVTDKINLSRSFSILFRKMYLNGGCSVVPAS 695

Query: 627  FLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXX 686
            FLK CN LRPD +IP DQQDTQEFL+ +L +LHDELS+ + V NDY              
Sbjct: 696  FLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRLHDELSKEDTVLNDYSNLLLYDAERMHVK 755

Query: 687  XXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPS-STS 745
              +Y  WFE      G+SPID+IFQGQ+EN + CQRCG+SSFNYS FYVLSLAIP  S  
Sbjct: 756  VDQYKKWFENSNLSGGVSPIDDIFQGQIENSINCQRCGYSSFNYSSFYVLSLAIPKISVM 815

Query: 746  TFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG------------------TSASGTG 787
            +FS+  +V+LEDCIN+FT DE L+ ENAWDC +CG                  TS +   
Sbjct: 816  SFSRTNRVKLEDCINMFTRDEVLSGENAWDCSRCGSQSDNFVKTSHNDHHKEHTSETTDD 875

Query: 788  PEEEKKKKRFLL----NPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXX 843
             ++ +K + FLL    NP +R+                        +S            
Sbjct: 876  SKQNRKSRLFLLPKKYNPTSRSLSPFGRHSSHKSSEKWKSKKMETIKS------------ 923

Query: 844  XXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIA 903
                    NFI +P +L IHLSRFFYD++KKN  V+ YPLIL+IVLKNE++ KYRLYAI 
Sbjct: 924  -------LNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIV 976

Query: 904  NHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDV 962
            NH GN + SGHYT+LVNK+ +HDL K +Q+WYYFDDE VK ++NHG+ID G+  +SSS V
Sbjct: 977  NHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHV 1036

Query: 963  YVLFYEKID 971
            YVLFYEKID
Sbjct: 1037 YVLFYEKID 1045

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/858 (42%), Positives = 481/858 (56%), Gaps = 68/858 (7%)

Query: 149  QALSKANSATVEPDAPTETEFENGTTMWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFP 208
            +A S   +AT   D+  E   E+G+ +WTAP+L+PND LK+                   
Sbjct: 257  EAKSLPGTAT---DSDEEYYVEHGSPIWTAPDLDPNDQLKLALGTEL------------- 300

Query: 209  KIHNESHSFPFEEPELHAXXXXXXXXXXXXVPARASRKLGTTQASNSSDFNDQKINRYAT 268
                         P +                ++     G   +    DF D   NR  T
Sbjct: 301  ----------LSPPVMGLDGDTLGDDIYYETVSK-----GDDVSYRGKDFEDLHANRLIT 345

Query: 269  HRKDSYHSVHMSNDD----------YDAFTFNLARLQKQSVVTCDQLMRILCS-QDRDNL 317
            HRKDSYHS++M +DD           +AF   L RLQKQS++T  +L  IL + ++R  L
Sbjct: 346  HRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPELFSILSNPEERHKL 405

Query: 318  LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFE 377
            LLIDLR +KR   NHI+APN++N+DPT LW+    SPI  D  LE+ L+N L N R +++
Sbjct: 406  LLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQRLNNPLFNGRLKYD 465

Query: 378  YIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSK-SSQAYC 436
            YIVYY+DMKT+M  ++DY  + F L+ TS K+L   P  LLGGYE+WKK ++   SQ   
Sbjct: 466  YIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGGYEKWKKVMNTYVSQYQI 525

Query: 437  DKDAFLYS----STNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTPYNRAP 492
            + D +LY     S N G         +P                      +   P    P
Sbjct: 526  ELDDYLYRPYAPSNNKGEQNNAQIPDVPTWKPPPVPVMVRKRPPPPVPVSIPIPPETPPP 585

Query: 493  FPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVA 552
             P  +      +  P+ +  + R   ++  H++ +   N   ++  +IPTIE++ N YVA
Sbjct: 586  LPQKIKLESIEESAPSDNSQYIRPPAKLPIHALHS-PRNQTLTRKFSIPTIEKNSNPYVA 644

Query: 553  LSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP-NQLSKYFNVLF 611
             S+TGLRN+G TCY+N MLQ LFAT   ++LF+S KY  Y  +   N  + +S  F  LF
Sbjct: 645  YSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDNKESAISNTFANLF 704

Query: 612  KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAND 671
             KMYMNGGC+VVP+GFLK CN LRPD RIP DQQDTQEFLLF+L++LHDELS    V ND
Sbjct: 705  NKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVIND 764

Query: 672  YPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYS 731
            YP               +Y  WF+K +  NG+SP+D +FQGQMEN L CQRCG+ S NYS
Sbjct: 765  YPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYS 824

Query: 732  VFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG--------TS 782
             FYVLSLA+P  S   F +  +V+LEDCIN+FTSDE LT ENAWDCPKCG        TS
Sbjct: 825  TFYVLSLALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCGSKAVEPRFTS 884

Query: 783  ASGT------GPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQN 836
             + T       P   KK K F L P  +A                           ++  
Sbjct: 885  RTSTQTILPNSPHHHKKSKFFGL-PTGKAISRSKSPFRKLGLLEKHEGKQEKLDKMERDE 943

Query: 837  LE---XXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQ 893
            +E                NFISLP VL IHLSRF+YDLTKKN+ V++YPL+L+IVLKNE+
Sbjct: 944  IEEWHKMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEE 1003

Query: 894  IMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
            I++Y+LY+I NH GNLISGHYTSLVNKD  H+L   +QKWYYFDDE VK +  HG++D G
Sbjct: 1004 IVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKG 1063

Query: 954  ITSISSSDVYVLFYEKID 971
            IT +SS +VYVLFYE++D
Sbjct: 1064 ITKVSSKNVYVLFYERVD 1081

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 85/123 (69%), Gaps = 2/123 (1%)

Query: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
           M+R ++PE+S +LL  ++ +Y  +I   FP+L+L++L+DLLE A+ + E Y   +  + +
Sbjct: 1   MDR-FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTS 59

Query: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
           +  +  F+ GCFYIYL++P S+QFQ+R KSY++Y +L+  Y+ + NMTNV+ MV E +  
Sbjct: 60  K-AVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQ 118

Query: 121 MSK 123
           + +
Sbjct: 119 IQE 121

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/853 (39%), Positives = 474/853 (55%), Gaps = 85/853 (9%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYS+ELL+ V+D+Y  DI  ++  L+LE L DL++H  YL+ES+   +     +D L
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES-MSK 123
           TA++ GC+++YLIIP S QFQ+R+K++ ++  LKK Y+++ NMTNVLLMV + ++S + +
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 124 DEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEF-----------ENG 172
           D  +   + RKRA+S P       I  L+ A + +  P    + +F              
Sbjct: 128 DFRKLKDVERKRAFSSPDNGLDSEISRLTLAGNGSTLPKMHKKWDFIRSDSNFHSHDTGN 187

Query: 173 TTMWTAPELEPNDHLKVXXXXXX-XXXXXXXXNEQFPKI---------HNESHSFPFEEP 222
             +W AP LEPND LK+                ++ P++         H        EE 
Sbjct: 188 VPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYPKHKSKSELTVEEK 247

Query: 223 ELHAXXXXXXXXXXXXVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSND 282
           E H                + + +LG  +  +   F D K++R   HRKDSYHSV+M + 
Sbjct: 248 E-HPQQDHRHHHGV----QQETHQLG--KDDDEQHFWDAKVDRAVAHRKDSYHSVYMDDG 300

Query: 283 DYD-----AFTF------NLARLQKQSVVTCDQLMRILCS-QDRDNLLLIDLRFSKRFQT 330
           D+D       TF       + RLQKQS++T  +L  IL + ++R+ LLLIDLR   R++ 
Sbjct: 301 DHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERNRLLLIDLRLQSRYKF 360

Query: 331 NHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMK 390
           N+ILAPN++ +DP +LW+ N  +P+     L+  L N + N R  F++IVYYTDMKT+M+
Sbjct: 361 NYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGSFDFIVYYTDMKTYME 420

Query: 391 LDFDYQLVFFQLIYTSNK-NLKCTPKVLLGGYEQWKKFLSKS-SQAYCDKDAFL---YSS 445
           +DFDY  VF+ L+  S + +L+  P  LLGGYE+WK  L K  +Q     D +L   YSS
Sbjct: 421 MDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQFGIRVDDYLYRPYSS 480

Query: 446 TNNGRN----------APVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTPYNRAPFPT 495
              G+            P    +LPE                  T+EM        P P 
Sbjct: 481 NKEGKEKSANAKHIEPVPWKPPALPERMRNLPPPPPPATLPI--TKEMP------PPVPP 532

Query: 496 PLVQAQRADHFPASSQNHTR------------DKNEIQKHSVPALSGNGNYSKHTAIPTI 543
            +   Q+ D      +NHTR             KN +    +  L       +  ++PTI
Sbjct: 533 KIQLEQQED------KNHTRPRSRTVSSPAEVPKNVVAPEQLSQLDSYPMRQRQFSVPTI 586

Query: 544 EQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQL 603
           E+S N+YVALSITGLRN+G TCY+NSMLQCLFAT  FRDLF  + YE +F+ +  +  +L
Sbjct: 587 ERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGKL 646

Query: 604 SKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
           SK F+VL +KMYMNGGCSVVPT FLK CN LRPDF IP DQQD QEFL+  + +LHDELS
Sbjct: 647 SKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELS 706

Query: 664 ESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRC 723
               V N +P               EY  WFE  +     SPID IFQGQ+ENGL C++C
Sbjct: 707 NQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKC 766

Query: 724 GHSSFNYSVFYVLSLAIPSSTSTFSQRKK---VRLEDCINLFTSDEQLTNENAWDCPKCG 780
           G+SS++YS FY+LSLAIP  +S+F    K   V LEDCIN+FTSDE ++ ENAWDCPKCG
Sbjct: 767 GYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKCG 826

Query: 781 TSASGTGPEEEKK 793
            +      E  ++
Sbjct: 827 VTVQKEKSESNQR 839

 Score =  186 bits (471), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 100/120 (83%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF++LP VL IHLSRF+YDLTKKN  VITYPLIL+IVLKN + +KYRLYA+ NH GNLIS
Sbjct: 925  NFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHNGNLIS 984

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKID 971
            GHYTSLVNK+ DHDL   +Q+WYYFDDE VK + +HG++  G+  +SS DVYVLFYE+ID
Sbjct: 985  GHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLFYERID 1044

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/767 (43%), Positives = 440/767 (57%), Gaps = 60/767 (7%)

Query: 258  FNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNL 317
            F  Q+++R    R + Y+     N         L RL + S + C  LM IL S  +D +
Sbjct: 408  FEQQELDRPHNSRVEPYNPFANGNAAGLESCNPLTRLYETSSIKCSDLMIILESDIQDRV 467

Query: 318  LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFE 377
            L IDLR  KR++ NHI+A +L+N+DP LLW+  + +PI S  + ER LDN L   R QF 
Sbjct: 468  LFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFTTRGQFS 527

Query: 378  YIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKSSQAYCD 437
            Y+V YTD  T M +DF ++L FF+L+Y     L    K L GGY+QW+ +L  ++++   
Sbjct: 528  YLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLT--KCLQGGYDQWRLYLKTNTKSIHA 585

Query: 438  KDA-FLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTPYNRAPFPTP 496
            K + F++ +   GR+  V+ H+                     T      PY  +P P P
Sbjct: 586  KISDFMWRANFLGRDTSVSDHN--PFRATPPVPTARPPVPPLPTAPPPVAPYISSPRPVP 643

Query: 497  LVQAQRAD-HFPASSQNHTRDKNEIQKHSVPALSGNGNYS------KHTAIPTIEQSP-- 547
             +  Q+       +S N  +      ++ +  ++G  +++      K+  +P   +SP  
Sbjct: 644  FIPLQQPSLSLLHTSANIVKPGKAELRNELSRITGQIDHTQYNQPEKYRYLPDSRESPYP 703

Query: 548  ----------------------------------NEYVALSITGLRNIGCTCYVNSMLQC 573
                                              NEY+ALSITGLRN+  TCY+NSMLQC
Sbjct: 704  IEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQC 763

Query: 574  LFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNA 633
            LF+T  FR+LFLS KY  Y   K +N + +S+ F +LFKKMYMNGGCSVVP+GFLK C+ 
Sbjct: 764  LFSTTEFRNLFLSNKYSRYL--KSSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSY 821

Query: 634  LRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTW 693
            L+PD RIPH QQDTQEFLLFLL +L DELS    V NDYP               EY TW
Sbjct: 822  LKPDLRIPHGQQDTQEFLLFLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTW 881

Query: 694  FEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTS-TFSQRKK 752
            F+++  +NG+SPID+IFQGQ+E+ L CQRC  SS++YS FYVLSLA+P+  S  F + KK
Sbjct: 882  FDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKK 941

Query: 753  VRLEDCINLFTSDEQLTNENAWDCPKCGTSASG---TGPEEEKKKKRFLLNPDTRASGNX 809
            +RLEDCIN FT DE LT +N WDCPKCG ++SG      E+ K+K +F +  +   S N 
Sbjct: 942  LRLEDCINFFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANS 1001

Query: 810  XXX------XXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIH 863
                                        S  +  E             NFI+LP +L IH
Sbjct: 1002 NRDHLPRLFKIGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIH 1061

Query: 864  LSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLD 923
            LSRF YDLTKKNN V+TYPLIL+IVLKN ++ KYRLY+  NHFG LISGHYTSLVNKDL 
Sbjct: 1062 LSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQ 1121

Query: 924  HDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            H++ +GKQKWYYFDDE VK D NHG+ D GITS+SSSDVY+LFYE+I
Sbjct: 1122 HEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSDVYLLFYERI 1168

 Score =  152 bits (384), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 122/202 (60%), Gaps = 14/202 (6%)

Query: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
           M+  Y PEYS+EL  FV++ Y Q +   +P+LR EKL+DLLE A  LFESY+  +   Q 
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
            + L A+V G FY+YLIIP SI+F +R+ SY++Y DL+K+Y+ E NMTNV+ MVTE +++
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 121 M------SKDEVETARIMRKRAYSVP---YGKSPVTIQALS----KANSATVEPDAPTET 167
           +         E    ++ RKRAYSVP     +S  ++Q L+    +         A  E 
Sbjct: 121 VLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIPEV 180

Query: 168 EFENGTTMWTAPELEPNDHLKV 189
             +   T+W+AP+LE ND L+ 
Sbjct: 181 AVQ-ADTLWSAPKLEENDLLRT 201

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/443 (63%), Positives = 327/443 (73%), Gaps = 8/443 (1%)

Query: 536  KHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSR 595
            ++ ++PTIEQS N YV+LSITGLRN+G TCY+NSMLQCLFAT+ FRD+FLS KY  Y S+
Sbjct: 593  QYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYISK 652

Query: 596  KYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655
             Y +  Q+S+ F++LFKKMYMNGGCSVVP+GFLKACN++RPDF+IP+DQQDTQEFLLFLL
Sbjct: 653  GYIHRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLL 712

Query: 656  SQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQME 715
             QLHDELS+  +VANDYP               EYD WFE  IS+NG+SPID+IFQGQME
Sbjct: 713  DQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQME 772

Query: 716  NGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNENAW 774
            N L CQRCGHSS+NYS FYVLSLAIP+  TSTF + KKV LEDCINLFTSDE L+ ENAW
Sbjct: 773  NCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFGKTKKVLLEDCINLFTSDEVLSGENAW 832

Query: 775  DCPKCGTSASGTGPEEEK-KKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQ 833
            DCP+CGTS SG+GP E K KKKR  L P    + N                      S+ 
Sbjct: 833  DCPRCGTSMSGSGPGEGKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFNSSNG 892

Query: 834  QQNL------EXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSI 887
              +       E             NFI++P +L IHLSRFFYDLTKKN+ VITYPLIL+I
Sbjct: 893  HNSGSSMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNI 952

Query: 888  VLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINH 947
            VLKN ++ KYRLY I NHFGNLISGHYTSLVNKDL H++  G+QKWYYFDDE VK+D NH
Sbjct: 953  VLKNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNH 1012

Query: 948  GDIDAGITSISSSDVYVLFYEKI 970
            GD DAGI S+SSSDVYVLFYE+I
Sbjct: 1013 GDFDAGIASVSSSDVYVLFYERI 1035

 Score =  400 bits (1028), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/459 (47%), Positives = 295/459 (64%), Gaps = 35/459 (7%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           Y+PEYSNELLQFV+DVY QDI HY+PKL+LEKLIDLLEHAEYLFESY   L     ED L
Sbjct: 5   YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESM--- 121
           TAF+ G FY+YLIIP SIQF +R+KSY IY DL+KYYQDE +MTNVLLMVT+ ++++   
Sbjct: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 122 SKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVE--PDAPTETE-----FENGTT 174
           S+D  +  +I RKRAYSVP       +++L+  N+  +E  P+   E++      ++ TT
Sbjct: 125 SRD-FDDTKITRKRAYSVPSQALANQLRSLTLNNTDGLEQLPEVSKESDTLTNYADDYTT 183

Query: 175 MWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEP---ELHAXXXXX 231
           +W+AP+LEP+D LK+                 F  +   S  F   E    E        
Sbjct: 184 IWSAPKLEPDDQLKLALNPPSKSSSATSSLSSF-VMDQHSKKFSIGESSSDEFEPIPTQE 242

Query: 232 XXXXXXXVPARASRKLGTTQASNSSDFND--------------QKINRYATHRKDSYHSV 277
                   P+  S++       +S+D                 Q ++RY THRKDSYHSV
Sbjct: 243 ALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTHRKDSYHSV 302

Query: 278 HMSNDDYDA----FTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHI 333
           +M N+D D     F  NL+RLQKQ V++C++LM IL S +R+N+LL+DLR SKRF  NHI
Sbjct: 303 YMLNEDDDTNEYDFFQNLSRLQKQYVISCEELMDILQSDERNNVLLVDLRISKRFHNNHI 362

Query: 334 LAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDN-KLLNARSQFEYIVYYTDMKTFMKLD 392
           +APNL+N+DP  LW+ ++  PI SDV+LE+ + + +   +RS+F+YIVYYTDMKTF+ +D
Sbjct: 363 VAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSKFKYIVYYTDMKTFLNID 422

Query: 393 FDYQLVFFQLIY-TSNKNLKCTPKVLLGGYEQWKKFLSK 430
           FDY+LVFFQL+Y +S+  L+  PK LLG YEQWK F+ +
Sbjct: 423 FDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQ 461

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  514 bits (1325), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 258/462 (55%), Positives = 307/462 (66%), Gaps = 24/462 (5%)

Query: 526  PALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
            P L      ++  +IPTIE+SPN YV+LSITGLRN+G TCY+NSMLQCLFAT+ FRDLFL
Sbjct: 578  PHLQQTTTLTRRPSIPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFL 637

Query: 586  STKYEHYF-SRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQ 644
            ++KY  +    K+ N   +S  FN+LFKKMY+NGGCSVVPT FLK CN LRPD +IP DQ
Sbjct: 638  TSKYSSFLNGSKFPNSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQ 697

Query: 645  QDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGIS 704
            QDTQEFL+ +L +LHDELS    V N+YP               EY  WFEK +  NG+S
Sbjct: 698  QDTQEFLMIILDRLHDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLS 757

Query: 705  PIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTST-FSQRKKVRLEDCINLFT 763
            PID IFQGQ+ENGL CQRCGHSSFNYS FYVLSLAIP  + T FS+ K+V+LEDCIN+FT
Sbjct: 758  PIDEIFQGQIENGLQCQRCGHSSFNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFT 817

Query: 764  SDEQLTNENAWDCPKCGTSASG-------------TGPEEEKKKKRFLLNPDTRASGNXX 810
            +DE L+ ENAWDCP CG++A                  EE + K RF   P TR   +  
Sbjct: 818  NDEMLSGENAWDCPNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLP-TRPHRSLS 876

Query: 811  XXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYD 870
                               Q  + + L              NFI LP VL IHLSRFFYD
Sbjct: 877  PFRKSGSSSTNSTSKIKHEQQWKTKKL--------ITIKTLNFIMLPPVLVIHLSRFFYD 928

Query: 871  LTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGK 930
            LTKKN  VITYPLIL+IVLKN ++ KY+LY I NH GNLISGHYTSLVNK+  H+LN  +
Sbjct: 929  LTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQ 988

Query: 931  QKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKIDE 972
            Q+WYYFDDE VK + NHGDID GI+ +SS DVYVLFYE++ E
Sbjct: 989  QRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERLYE 1030

 Score =  314 bits (804), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 276/484 (57%), Gaps = 69/484 (14%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYSNELL+ ++ VY +DI HY+P+L+LEKL+DLLEH EYLFE + H       +D L
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
           T+F+ GC+Y++LI+P SIQFQSR+KSY IY+DLKK Y+++A+MTNVLLMV + IE++ + 
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 125 EVETA------RIMRKRAYSVPYGKSPV-TIQALSKANSATVEP---------------D 162
             E        RI+R+RAYSVP        + +LS ++     P               D
Sbjct: 130 TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSDSD 189

Query: 163 APTETEFENGTTMWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEE- 221
              E E +  + +WTAP LEP D LK+              NE  P         P+E  
Sbjct: 190 VINE-ENDMSSPLWTAPPLEPTDQLKLAVLG----------NETLP-----PPVIPYEAD 233

Query: 222 -------------PELHAXXXXXXXXXXXXVPARASRKLG-----TTQASNSSDFNDQKI 263
                        PEL               P ++   L        + SN+  F +   
Sbjct: 234 IQERTDLLKQPSIPELSPTTTSLKNSKDFNSPFQSVISLDNDIPLVREPSNNRSFRETNA 293

Query: 264 NRYATHRKDSYHSVHMSNDD--------YDAFTF--NLARLQKQSVVTCDQLMRIL-CSQ 312
           +R  THRKDSYHSV+M +++        YD+  +  +L RLQKQS++T  +L+ IL C  
Sbjct: 294 DRSQTHRKDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCPP 353

Query: 313 DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNA 372
           +R  LLLIDLR+SKR   NHI+APN++++DP LLW+    +PI +   LE+ LDN+L N 
Sbjct: 354 ERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLDNELFNR 413

Query: 373 RSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKN-LKCTPKVLLGGYEQWKKFLSKS 431
           R +FEY+VYYTDMKT+M  DFDY    F L+ T   N L+ TP  LLGGY++WK FL   
Sbjct: 414 RHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHY 473

Query: 432 SQAY 435
           ++ Y
Sbjct: 474 AKEY 477

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  513 bits (1320), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 251/452 (55%), Positives = 310/452 (68%), Gaps = 30/452 (6%)

Query: 536  KHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSR 595
            +H +IPTIE+S N YV+LSITGLRN+G TCY+NSMLQCLFAT  FRDLF+S K+E +F++
Sbjct: 588  RHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQ 647

Query: 596  KYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655
             Y+N  QLSK FN+LF+KMY+NGGCSVVPT FLK  + LRPD RIP DQQDTQEFL+  L
Sbjct: 648  NYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTL 707

Query: 656  SQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQME 715
             +LHDELS    VAN+YP               EY  WFE+ +  NG++PID+IFQGQ+E
Sbjct: 708  DRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIE 767

Query: 716  NGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNENAW 774
            N L CQRCG+SSF+YS FYVLSLAIP  STSTFS+ K+V+LEDCIN+FT+DE L+ ENAW
Sbjct: 768  NILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTNDEILSGENAW 827

Query: 775  DCPKCGTSASGTGP---------------EEEKKKKRFLLNPDTRASGNXXXXXXXXXXX 819
            DCPKCG++ +  GP               EE + K  F                      
Sbjct: 828  DCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSKRSKSPFRMLGSTKF 887

Query: 820  XXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVI 879
                      + S ++ L              NFI LP VL IHLSRF+YDLTKKN+ ++
Sbjct: 888  PLAMEDWKSKELSTKKTL--------------NFIFLPPVLIIHLSRFYYDLTKKNDTIV 933

Query: 880  TYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDE 939
            TYPL+L+I+LKN +  +YRLYA+ NH GNLISGHYTSLVNK+  H L+KG+QKWYYFDDE
Sbjct: 934  TYPLVLNIILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDE 993

Query: 940  TVKKDINHGDIDAGITSISSSDVYVLFYEKID 971
             VK++  HG+ID GI  +SSSDVYVLFYE++D
Sbjct: 994  VVKEETKHGNIDQGILKVSSSDVYVLFYERLD 1025

 Score =  279 bits (714), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 192/505 (38%), Positives = 269/505 (53%), Gaps = 75/505 (14%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYSNELL+ V+++Y  DI HYF + +LEKL+DLLEH EYLFESY   L     +D L
Sbjct: 8   FTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDAL 67

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSK- 123
           TAF+ GC+Y+YLI+P SI+FQ+R+KSY+I+ DL K YQ++ANMTNVLLMV + ++S+   
Sbjct: 68  TAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDR 127

Query: 124 -----DEVETARIMRKRAYSVP-------------YGKSPVTI---QALSKANSATVEPD 162
                 E E  +  R RAYSVP             + ++P+ +   QA SK+       D
Sbjct: 128 NAREFKEFEHQK-ARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSEQG--RED 184

Query: 163 APTETEFENGTTMWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEP 222
                  E+ + +WTAP LEPND L++              ++            P    
Sbjct: 185 MNNLQNDEDSSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQ------------PMATK 232

Query: 223 ELHAXXXXXXXXXXXXVPARASRKLGTT-----------QASNSS----DFN----DQKI 263
           EL                +R +  +G T           Q  NS      FN    +  +
Sbjct: 233 ELAISTSRKAL-------SRRASAMGPTPYPIEELDISGQDGNSHYDELGFNKTLWNANV 285

Query: 264 NRYATHRKDSYHSVHM---SNDDY-----DAFTFNLARLQKQSVVTCDQLMRIL-CSQDR 314
           +R  THRKDSYHSV+M    +DD+       FT  L RLQKQS++T  +L  IL  S++ 
Sbjct: 286 DRQTTHRKDSYHSVYMFEGGSDDHMPSISKDFTQGLERLQKQSIITAPELFTILSSSEES 345

Query: 315 DNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARS 374
           + LLLID R SKR + NHI+AP  + +DP  LW+    +PI +   L+  +       R 
Sbjct: 346 EKLLLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERG 405

Query: 375 QFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS-NKNLKCTPKVLLGGYEQWKKFLSKSSQ 433
            ++YIVYYTDMKT+M +D+DY    F L+  S   NL+  P  LLGGYE+WKK +   S 
Sbjct: 406 SYDYIVYYTDMKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSV 465

Query: 434 AY-CDKDAFLYSSTNNGRNA-PVTS 456
            +  + D ++Y      + A P TS
Sbjct: 466 DHGVNMDNYIYRPYGESKKALPDTS 490

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  507 bits (1306), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 258/454 (56%), Positives = 311/454 (68%), Gaps = 21/454 (4%)

Query: 535  SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
            S+  +IPTIE+SPN YV+LSITGLRN+G TCY+NSMLQCLFAT+ FRDLF+S+K++ + +
Sbjct: 657  SRKFSIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIN 716

Query: 595  -RKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLF 653
              K+ N  ++S  FN+LFKKMY+NGGCSVVPT FLK CN LRPD RIP DQQDTQEFL+ 
Sbjct: 717  DSKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMI 776

Query: 654  LLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQ 713
            +L +LHDELS    V N+YP               EY  WF+K++  NG+SPID+IF GQ
Sbjct: 777  ILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQ 836

Query: 714  MENGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFSQRKKVRLEDCINLFTSDEQLTNEN 772
            MEN L CQRCG+SS+NYS FYVLSLAIP  S++TFS+ K+V+LE+CIN+FTSDE L+ EN
Sbjct: 837  MENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGEN 896

Query: 773  AWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSS 832
            AWDCPKCG+SAS T  + EK     LLN  +    N                       S
Sbjct: 897  AWDCPKCGSSASSTISDSEK-----LLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRS 951

Query: 833  --------------QQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKV 878
                               E             NFI LP +L IHLSRF+YDLTKKNN V
Sbjct: 952  ISPFRKKTSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTV 1011

Query: 879  ITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDD 938
            ITYPLIL+IVLKN ++ KYRLY I NH GNLISGHYTSLVNK+ +HDL   KQ+WYYFDD
Sbjct: 1012 ITYPLILNIVLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDD 1071

Query: 939  ETVKKDINHGDIDAGITSISSSDVYVLFYEKIDE 972
            ETVK++ NHGD+D GI  +SS DVYVLFYE+I E
Sbjct: 1072 ETVKEERNHGDMDKGILQVSSRDVYVLFYERIYE 1105

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 119/189 (62%), Gaps = 17/189 (8%)

Query: 264 NRYATHRKDSYHSVHMSND----------DYDAFTFNLARLQKQSVVTCDQLMRILCSQ- 312
           +R + HRKDSYHS++M +D          D + +  +L RLQKQ ++T  +L  IL +  
Sbjct: 331 DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYIHSLERLQKQCIITAQELFSILSNPI 390

Query: 313 DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL----DNK 368
           ++  LLLIDLRF KRF +NHI+APNL+ +DP LLWN    +PI     LE  L      K
Sbjct: 391 EKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLENLLYEPKARK 450

Query: 369 LLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS--NKNLKCTPKVLLGGYEQWKK 426
           LL  R+QFEYIV+YTD KT+M  +FDY   FF L+ TS  NKN+K  P  LLGGY++WKK
Sbjct: 451 LLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHLLGGYDKWKK 510

Query: 427 FLSKSSQAY 435
            L   S+ Y
Sbjct: 511 VLYSYSEQY 519

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 94/224 (41%), Positives = 133/224 (59%), Gaps = 39/224 (17%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESY-RHALAANQAEDL 63
           ++PEYSNELLQ V+ +Y  DI HY+P+L+LEKL+DLLEH EYL E +  +       +D+
Sbjct: 9   FTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDV 68

Query: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES-MS 122
           LTAF+ GC+Y++LIIP SIQFQS++KSY IY +LKK Y++E +MTNVLLMV + IE+ + 
Sbjct: 69  LTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD 128

Query: 123 KDEVETAR------IMRKRAYSVPYGKSPVTIQALSKANSA-------------TVEP-- 161
            DE           I R+RAYS+   +    +++LS +NS              T +P  
Sbjct: 129 MDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQPPN 188

Query: 162 ----------------DAPTETEFENGTTMWTAPELEPNDHLKV 189
                           +    T+F+  + +WTAP LEP D LK+
Sbjct: 189 HHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKL 232

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  505 bits (1301), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/474 (52%), Positives = 321/474 (67%), Gaps = 16/474 (3%)

Query: 498  VQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITG 557
            +  + AD  P  + N   D +++ ++ +P          H +IPTIE S NEYVALSITG
Sbjct: 1057 ISHKGADRSPEETNNIKVDGHKLIRNPIP----------HFSIPTIENSYNEYVALSITG 1106

Query: 558  LRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMN 617
            LRN+  TCY+NSMLQCLF+T AFR+LFLS KY HY   K    + +S+ F +LF+KMYMN
Sbjct: 1107 LRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL--KSPEMDTMSRSFYMLFRKMYMN 1164

Query: 618  GGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXX 677
            GGCSVVP+GFLK CN L+PD RIP+ QQDTQEFLLFLL +LHDELS    V+NDY     
Sbjct: 1165 GGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKLHDELSSIESVSNDYSHLLL 1224

Query: 678  XXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLS 737
                       +Y+ WF+++I +NG+SPID++FQGQMEN L CQRCG+SS+ YS FYVLS
Sbjct: 1225 HDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQLSCQRCGYSSYTYSTFYVLS 1284

Query: 738  LAIPSSTS-TFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKKKR 796
            LA+P+  +  F + KK+RLEDCIN FT DE L+++NAWDCP+C  S S     + K K++
Sbjct: 1285 LALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSDQNAWDCPRC-CSPSDYMSYDHKGKRK 1343

Query: 797  FLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISL 856
               + ++   GN                      SS+    +             NFI++
Sbjct: 1344 ISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLS--DKVSNGKPATVKSLNFITM 1401

Query: 857  PTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTS 916
            P +L IHLSRF YDLTKKNN V++YPLIL+IVLKN ++ K+RLY+I NHFG LISGHYTS
Sbjct: 1402 PRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYSIVNHFGTLISGHYTS 1461

Query: 917  LVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            LVNK+L+H+++ GKQKWYYFDDE VK D NHGD D GI S+SSS+VYVLFYE+I
Sbjct: 1462 LVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSNVYVLFYERI 1515

 Score =  271 bits (692), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 243/462 (52%), Gaps = 49/462 (10%)

Query: 1   MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQA 60
           M   Y PEYS EL QFV++VY +++   + KLRLEKLIDLLEH  YL ESYR  L   Q 
Sbjct: 1   MEAPYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQV 60

Query: 61  EDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIES 120
           E  +TA+V G FY+YLIIP SI+F +R+ SY+IY DLK++Y+ + NM NV+L+V   + S
Sbjct: 61  EAGITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGS 120

Query: 121 MSK-------DEVETARIM-RKRAYSVPYGKSPVTIQALSKANSATVEPDAPT--ETEFE 170
           + +       DE   AR   RKRAYS+    S      L K +         T  E + E
Sbjct: 121 VMQLYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTE 180

Query: 171 NGT------------TMWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFP 218
            G             T+W+AP LEP+D LK+                  P IH+ S S  
Sbjct: 181 QGAFGQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHS-----------PSIHDTSDSKT 229

Query: 219 FEEPELHAXXXXXXXXXXXXVPARASRKLGTTQASNSSD--FNDQ---------KINRYA 267
            +    +             V  R S  +  +   +SSD   ND+          ++R+ 
Sbjct: 230 KDSGLENNSAAEFSVLDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFY 289

Query: 268 THRKDSYHSVHMSNDD-YDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSK 326
           TH +D  + +   ND        ++  L + S + C  L+  L S +R ++LLIDLR  K
Sbjct: 290 THGQDLRYPI--CNDGVVPCENSSIMWLYESSSIKCLDLLSKLTSSERSSMLLIDLRLPK 347

Query: 327 RFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMK 386
           R++ +HILA N++N+DP LLW+  KG+P+ S  +LE  +DN L  +R QF  IV YTD  
Sbjct: 348 RYEYSHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNY 407

Query: 387 TFMKLDFDYQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKKFL 428
           T+M++DFD+  + F+L+Y     L    K L GGYEQWK FL
Sbjct: 408 TYMQIDFDFVFLLFRLLYLGRPQLVL--KTLSGGYEQWKSFL 447

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  481 bits (1239), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 266/588 (45%), Positives = 346/588 (58%), Gaps = 65/588 (11%)

Query: 252 ASNSSDFNDQKINRYATHRKDSYHSVHMSN-----------DDYDAFTFNLARLQKQSVV 300
            ++   F D   +R  THRK+SYHSV+M             D+ +A+  +L RLQKQS++
Sbjct: 339 GAHDRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSII 398

Query: 301 TCDQLMRILCS-QDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDV 359
           T  +L  IL + Q    LLLIDLR   R+ T+ I+APN +++DP +LWN N G+P+    
Sbjct: 399 TAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEIT 458

Query: 360 QLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS-NKNLKCTPKVLL 418
           +LE  L+N L N R +F+Y+VY++DMKTFMKL+FDY   FF L+ T+  K LKC P VLL
Sbjct: 459 ELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLL 518

Query: 419 GGYEQWKKFLSKSSQAY--CDKDAFL-------------------YSSTN----NGRNA- 452
           GGYE+WKK + +  + Y  C  D  +                   Y   N    NG  A 
Sbjct: 519 GGYEKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAV 578

Query: 453 -PVTSHSLPEHYXXXXXXXXXXXXXXX---------KTEEMTKTPYNRAPFPTPL----V 498
            P   H +P                           +    +K   +RAPF + L     
Sbjct: 579 EPWKPHEVPATIRKRPPPPPPASVPQSPDVVPVIPPRIMLDSKVSQHRAPFQSNLNFVTG 638

Query: 499 QAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGL 558
           Q   AD   A     T+    IQ+   P  S      +  +IPTIEQ+PN YV+LSITGL
Sbjct: 639 QILEADEDTALQVAPTK---RIQQE--PFRSATNGLHETYSIPTIEQNPNIYVSLSITGL 693

Query: 559 RNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ------LSKYFNVLFK 612
           RN+G TCY+NSM+QCLFATK+FR+LF+S KY+ +       P        +S+ F +LFK
Sbjct: 694 RNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFK 753

Query: 613 KMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDY 672
           KMY+NGGCSVVP  FLK+C+ LRPDF+IP DQQDT EFL+ +L +LHDELS  + V N+Y
Sbjct: 754 KMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEY 813

Query: 673 PGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSV 732
           P               EY  WF+K +  NG+SPID+IFQGQMEN L CQRCGHSSFNYS 
Sbjct: 814 PDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYST 873

Query: 733 FYVLSLAIPSST-STFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           FYVLSLAIP +T STFS+ K+V LE+C+N++TSDE L+ ENAWDCP C
Sbjct: 874 FYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921

 Score =  177 bits (448), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 77/119 (64%), Positives = 96/119 (80%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NFI +P  L IHLSRF+YDLTKKN+ ++TYPLIL+IVLK+ +++KY+LY + NH GNLIS
Sbjct: 1043 NFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLIS 1102

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTS+V+K LDH LN     WYYFDDE VK++  HGD+  G+  ISSSDVYVLFYE+I
Sbjct: 1103 GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161

 Score =  151 bits (381), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 124/228 (54%), Gaps = 43/228 (18%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PE S+EL Q V  VYT DI    P+LRL++LIDLLEH E+L+E Y   L  +Q  D L
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
            +F+ GCFY+YL++P SIQF +R++++ +Y+D++  Y+ + NMTNVLLMV E ++ + + 
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 125 EVETA----RIMRKRAYSVP--------------------YGKSPVT--IQALSKANSAT 158
           + ++A    RI R RAYSVP                     G  P +   Q L       
Sbjct: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193

Query: 159 VEPDAPTETEFENGTT-----------------MWTAPELEPNDHLKV 189
           V   + +E   E G +                 +W AP+LEPND LK+
Sbjct: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKL 241

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  478 bits (1229), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 250/555 (45%), Positives = 345/555 (62%), Gaps = 23/555 (4%)

Query: 263 INRYATHRKDSYHSVHMSNDD--------YDA---FTFNLARLQKQSVVTCDQLMRILCS 311
           ++R  THRKDSYHSV+M ND         YD    +  +L  +QKQ V+TC +L  +L +
Sbjct: 446 VDRSVTHRKDSYHSVYMFNDSNEDNNNHGYDETSEYIESLEHIQKQDVITCPELFSLLSN 505

Query: 312 Q-DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLL 370
             +R+ +LLIDLRF +RF  NHI+APN+L ++P LLW+    +P+ +  +LE+ ++N L 
Sbjct: 506 NVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQIINNPLF 565

Query: 371 NARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYT-SNKNLKCTPKVLLGGYEQWKKFL- 428
           + R  F+Y+VYY+DMKT+M + FDY    F L+ T ++K +K  P  LLGGYE+W K + 
Sbjct: 566 SKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKWYKVIN 625

Query: 429 SKSSQAYCDKDAFLY---SSTNNGRNAPVTSHSLPE-HYXXXXXXXXXXXXXXXKTEEMT 484
           S  +Q     + ++Y   +  + GR  P+ ++  P+                       +
Sbjct: 626 SYVNQYSITMNDYVYRKDAGASAGR--PLNNNEKPKMEIWTPPQLPIRIRKRAPPPPPSS 683

Query: 485 KTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIE 544
               N    P PL         P+    H+  +N++  HS+     NG   +H +IP +E
Sbjct: 684 LPKPNSGKMPPPLPPKINLHGNPSLPPIHSPLENQV--HSLDTHKQNGAIHRHFSIPILE 741

Query: 545 QSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLS 604
           +S N+YV+LSITGLRN+G TCY+NSMLQCLFAT  FR++FLS KYE Y         +LS
Sbjct: 742 KSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHDIPTNQRLS 801

Query: 605 KYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE 664
           K FN+LFKKMYMNGGCSVVPTGFLK CN LRPD RIP DQQDTQEFL+ +L +LHDELS 
Sbjct: 802 KSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRLHDELSN 861

Query: 665 SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
            + V  DYP               +Y  W+ + +  NG+SPID++FQGQ E+GL CQRCG
Sbjct: 862 QHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQTEDGLVCQRCG 921

Query: 725 HSSFNYSVFYVLSLAIP-SSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSA 783
            SSF YS FY+LSLAIP +ST+ F + K+V LEDCI +FT+DE L++ENAWDCP+CG++A
Sbjct: 922 CSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSDENAWDCPRCGSAA 981

Query: 784 SGTGPEEEKKKKRFL 798
               P    ++K+ +
Sbjct: 982 PKQEPIHRHREKKHI 996

 Score =  179 bits (453), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 98/119 (82%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF+  P +L IHLSRF+YDLTKKNN VITYPL L+I LKN ++ +Y+LY + NH G L+S
Sbjct: 1093 NFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYGLVNHTGTLVS 1152

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTSLVNKD DH+L   KQKW+YFDDE VK++ NHGDI+ G+TSISSS VYVLFY++I
Sbjct: 1153 GHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSHVYVLFYQRI 1211

 Score =  139 bits (351), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 68/156 (43%), Positives = 107/156 (68%), Gaps = 12/156 (7%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           Y+PEYS+ELLQ V+++Y  +   ++P+L+LEKLIDLL+H+ +LFE+Y  +L  +  +D L
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMV----TEVIES 120
           +AF+ G FY+Y IIP S QF ++++ Y +Y +LK  Y+DE NMTNVL MV    T++++S
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 121 MSKDEVETAR--------IMRKRAYSVPYGKSPVTI 148
             K + E++         I R+RA+SVP   +P ++
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSVPNASNPFSL 165

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  450 bits (1158), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 227/416 (54%), Positives = 276/416 (66%), Gaps = 30/416 (7%)

Query: 570 MLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLK 629
           M+QCLF TK  RDLF+S+KYE Y S++    + LS+ F++LFKKMY+NGGCSVVPT FLK
Sbjct: 1   MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFLK 60

Query: 630 ACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXE 689
            CN LRPD RIP DQQDTQEFL+ +L +LHDELS    V  DYP               E
Sbjct: 61  TCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNKE 120

Query: 690 YDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPS-STSTFS 748
           Y  WF+K I  NG+SPID+IFQGQ+EN L CQRCG  S+NYS FYVLSLAIP  S+ TFS
Sbjct: 121 YSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTFS 180

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSA---------SGTGPEEEKKKKR--- 796
           + K+V+LEDCIN+FT+DE L+ ENAWDC  CG+S+           TG  EEKK+ R   
Sbjct: 181 RSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRKSR 240

Query: 797 -FLL-NPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFI 854
            FLL N + R+S                        +S +   E             NFI
Sbjct: 241 LFLLPNINGRSS---------------RSISPFRKSASPRPPHEKLKHKKLVTIKSMNFI 285

Query: 855 SLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHY 914
           SLP  L IHLSRF+YDL+KKN  ++TYPLIL+IVL N +  KYRLY I NH GNLISGHY
Sbjct: 286 SLPPTLVIHLSRFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHY 345

Query: 915 TSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
           T+LVNK+ +H+L K KQKWYYFDDE VK++ NHG+ID G+  +SSS VYVLFYE++
Sbjct: 346 TTLVNKEKNHELKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  446 bits (1147), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 275/690 (39%), Positives = 377/690 (54%), Gaps = 57/690 (8%)

Query: 291 LARLQKQSVVTCDQLMRILCS-QDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQ 349
           L  L ++  +T  +L  IL +  DR  +L+IDLR S+ F    I +PNL+  DP  LWN 
Sbjct: 206 LKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNN 265

Query: 350 NKGSPIESDVQLERT--LDNKLLNARSQFEYIVYYTDMKTFMKLD-FDYQLVFFQLIYTS 406
              +P+     L RT    N L      F YI+ Y+D +T    + F+Y   FF+L+ +S
Sbjct: 266 RDQTPV-----LHRTSLFSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSS 320

Query: 407 NKNLKCTPKVLLGGYEQWKKFL-SKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXX 465
           +  +K TP  LLGG+E+W++ + S S Q   +   +++++       P  +     H   
Sbjct: 321 S--MKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNKRFTEPPSWNPPPVPHEIR 378

Query: 466 XXXXXXXXXXXXXKTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSV 525
                        +T     T   R          ++         NH R K  + +   
Sbjct: 379 KRPPPPPPPNLPSRTYSTRHTQGYR----------EQQQQQQQHHHNH-RPKRIVTR--- 424

Query: 526 PALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
                   Y+K+  +P +  S N YV LSI+GLRN+G TCY+NSMLQCLFAT AFR+LFL
Sbjct: 425 --------YTKY-GLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFL 475

Query: 586 STKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQ 645
           S +Y+ Y   K  +P  LS  F++LF+KMY+NGGC+V+P  FLK CN LRPD RIP  QQ
Sbjct: 476 SNRYKEYIGTK-VDP-HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQ 533

Query: 646 DTQEFLLFLLSQLHDEL-SESNRVANDYPGXXX-XXXXXXXXXXXEYDTWFEKHISENGI 703
           DTQEFL+ LL QLH+EL S  +R+ +++P                EY  WF + +   G+
Sbjct: 534 DTQEFLILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGL 593

Query: 704 SPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFT 763
           S I  IFQGQ+EN L CQRC ++S NYS F  LSL+IP+    F  RK V LEDCI+LF 
Sbjct: 594 SLIHEIFQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF--RKLVDLEDCISLFI 651

Query: 764 SDEQLTNENAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXX 823
            +E LT ENAW+CPKC +S++     + K +  F  +     S N               
Sbjct: 652 ENEMLTGENAWNCPKCSSSSNNNT-SKRKSRGFFKFSKHKNRSHNDLTFSEYNHNSSSDD 710

Query: 824 XXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRF-FYDLTKKNNKVITYP 882
                 +   +++               +FI LP +L IHLSRF    L  KNN  I YP
Sbjct: 711 VKFSKKKLVTRKS--------------TSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYP 756

Query: 883 LILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVK 942
            IL+I LKN++  +++LY + NHFGNL +GHYTSL+NK+  HDLN  +QKW+YFDDETVK
Sbjct: 757 AILTITLKNKEKCRFKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVK 816

Query: 943 KDINHGDIDAGITSISSSDVYVLFYEKIDE 972
           +  N+ D+D  +  ISSSDVYVLFYEKI E
Sbjct: 817 QQFNYFDLDKNVNRISSSDVYVLFYEKIIE 846

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 94/182 (51%), Gaps = 34/182 (18%)

Query: 10  SNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVA 69
           S+EL + V  +Y   I   + +L   + IDLLE+ E LFE +   L  N   D L +F+ 
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYF---LKGNT--DSLDSFII 67

Query: 70  GCFYIYLIIP--HSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKDEVE 127
           G FYI L+IP  H++   S +   AIY DLKKYY+ + N++++L     +I S S++ ++
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLF----IIRSESENILQ 123

Query: 128 TARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAPTETEFENGTTMWTAPELEPNDHL 187
           +  +            +P +     + N+A            ++ TT+W AP LEPND L
Sbjct: 124 SFDV-----------DAPSSHSQHEEDNTA------------DSSTTIWQAPFLEPNDQL 160

Query: 188 KV 189
           K+
Sbjct: 161 KL 162

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score =  412 bits (1058), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/440 (48%), Positives = 283/440 (64%), Gaps = 16/440 (3%)

Query: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-SRKYT 598
           +PTIE S +    LSITGL+N   TCY+NS++QCLF T  FRDLFL+ KY  +  + KY 
Sbjct: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 599 NPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQL 658
              QLS+   VLFKKMY+NGG ++ P GFLK C  LRPD  IP DQQDTQEFLL +L++L
Sbjct: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406

Query: 659 HDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGL 718
           H+ELS    V   YP               +Y  W+E  +  +G+SPID IF+GQMEN L
Sbjct: 407 HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465

Query: 719 FCQRCGHSSFNYSVFYVLSLAIP--SSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDC 776
            CQRCG+SS +YS FYVLSLAIP  S  S  S+ KK++LEDCINLFTSDE+L+ +N+WDC
Sbjct: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525

Query: 777 PKCGTSASGTGPEE--EKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQ 834
           P CGT+   T   E   +KKK    +  +R+                          + +
Sbjct: 526 PNCGTTDLKTKINESTSQKKKSTFFSFHSRSRSK---------SPHHHHHHHHHSHDNTE 576

Query: 835 QNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQI 894
           ++ +             +FI LP +L IHLSRF+YDLT+KNN VITYPLIL+++LKN ++
Sbjct: 577 KHSKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKV 636

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
           ++Y+LY   NH GNL++GHYTS VNK+ +H++   +Q W  FDD+ +K+  +H D +AG 
Sbjct: 637 VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGK 695

Query: 955 TSISSSDVYVLFYEKIDESQ 974
           T +SSS+VYVLFYE++DES+
Sbjct: 696 TEVSSSEVYVLFYERMDESE 715

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 5/150 (3%)

Query: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70
           ++++  V++VY  DI  ++ +LRL+ L  LL+HA +LFE Y      NQ  + LTAF+ G
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTE----VIESMSKDEV 126
            +Y+YL+IP S+QFQ+R+  Y+ YA LK  YQDE  M+ VL +V E    +++    D  
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 127 ETAR-IMRKRAYSVPYGKSPVTIQALSKAN 155
             +R I RKRAYS+P    PV + +LS  N
Sbjct: 126 RISRTITRKRAYSLPLRPLPVHMASLSILN 155

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  408 bits (1048), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/439 (48%), Positives = 281/439 (64%), Gaps = 8/439 (1%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF- 593
           SK   +P IE S N    LSITGLRN   TCY+NSM+QCLF+T  FRDLFL+ KY+ +  
Sbjct: 275 SKTFKLPVIENSDNLLSELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLE 334

Query: 594 SRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLF 653
           + KY    QLS    VLFKKMY+NGG +++P GFLK C  LRPD  IP DQQDTQEFL+ 
Sbjct: 335 NEKYPKGLQLSHSIYVLFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMI 394

Query: 654 LLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQ 713
           +L+++H+ELS +N V   Y                +Y  W E+ +  +G+SPID+IFQGQ
Sbjct: 395 ILARIHEELS-NNNVTKYYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQ 453

Query: 714 MENGLFCQRCGHSSFNYSVFYVLSLAIPSST--STFSQRKKVRLEDCINLFTSDEQLTNE 771
           MEN L CQRCG+SS++YS FYVLSLAIP ++  S  S+ KK++LEDCIN FTSDE+L+++
Sbjct: 454 MENILKCQRCGNSSYSYSTFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDD 513

Query: 772 NAWDCPKCGTSASGTGPEE--EKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXX 829
           NAWDCPKC T+      +E   +KK+  L N  +R                         
Sbjct: 514 NAWDCPKCRTAEYKLKKDENLSQKKRSILFNLHSRPRSKSPRHRHHHHHHRHKNDDAKKN 573

Query: 830 QSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVL 889
             + + + +             +FI LP +L IHLSRF+YDLTKKNN VITYPLIL+I+L
Sbjct: 574 DDATKNS-KKWKSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIIL 632

Query: 890 KNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK-DINHG 948
           KN ++++Y+LYA  NH GNLI+GHYTS+VNK+  H++   +Q W  FDD+ +K+   +  
Sbjct: 633 KNNKVVRYKLYATVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRD 692

Query: 949 DIDAGITSISSSDVYVLFY 967
           D + G T ISS++VYVLFY
Sbjct: 693 DFETGRTEISSNEVYVLFY 711

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (62%), Gaps = 5/154 (3%)

Query: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70
           N++L  V++VY  DI   + +LRL+KL  LLEHA YLF+ Y   L  NQ ++ LTAF+ G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMV----TEVIESMSKDEV 126
            FY+YL+IPHS+QFQ+R+  Y+ YA LK  YQDE  M+ VL +V    T +++    D  
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 127 ETARIM-RKRAYSVPYGKSPVTIQALSKANSATV 159
             +R M RKRAYS+P    PV + +LS  N   V
Sbjct: 126 RISRSMKRKRAYSLPLRPLPVHMASLSIHNQLDV 159

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  405 bits (1041), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/440 (48%), Positives = 279/440 (63%), Gaps = 20/440 (4%)

Query: 541 PTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-SRKYTN 599
           PTIE S      LSITGL+N   TCY+NS++QCLF +  FRDLFL+ KY  +  + +Y  
Sbjct: 277 PTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPK 336

Query: 600 PNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLH 659
             QLS+    LFKKMY NGG ++VP GFLK C  LRPD  IP DQQDTQEFLL +L+++H
Sbjct: 337 EVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIH 396

Query: 660 DELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLF 719
           +ELS  N V   Y                +Y  W+E+ I  +G+SPID+IF+GQMEN L 
Sbjct: 397 EELSNEN-VTKYYCDLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENILK 455

Query: 720 CQRCGHSSFNYSVFYVLSLAIPSST--STFSQRKKVRLEDCINLFTSDEQLTNENAWDCP 777
           CQRCG+SSF+YS FYVLSLAIP ++  S  S+ KK++LEDCINLFTSDE+LT +NAWDCP
Sbjct: 456 CQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDCP 515

Query: 778 KCGTSAS--GTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQ 835
           +C    S   TG    +KK+  L +  +R+                          +  +
Sbjct: 516 ECRIDDSKLKTGENSSQKKRSPLFSFHSRSRSK---------SPHHHHHYHHHGSDNTTK 566

Query: 836 NLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIM 895
           N               +FI LP +L IHLSRF+YDLTKKNN VITYPLIL+I+LKN +++
Sbjct: 567 NSNKWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVV 626

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDID---A 952
           +Y+LY   NH GNLI+GHYTS+VNK+  H++   KQ W  FDD+ + +  +H D D   A
Sbjct: 627 RYKLYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQ--HHKDRDGFEA 684

Query: 953 GITSISSSDVYVLFYEKIDE 972
           G T +SSS+VYVLFYE++DE
Sbjct: 685 GKTKMSSSEVYVLFYERMDE 704

 Score =  116 bits (291), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 93/156 (59%), Gaps = 5/156 (3%)

Query: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70
           +++L  V+DVY  DI  ++ +LRL+ L  L++H  +LF+ Y   L  N+  + LTAF+ G
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTE-----VIESMSKDE 125
            +Y+YLIIP S+QFQ+R   Y+ YA LK  YQDE  M+ VL +V +     V + +S   
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 126 VETARIMRKRAYSVPYGKSPVTIQALSKANSATVEP 161
             T  I RKRAYS+P    PV + +LS  N +   P
Sbjct: 126 RITVTITRKRAYSLPLRPLPVHMASLSIHNQSDDPP 161

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score =  402 bits (1033), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 207/441 (46%), Positives = 284/441 (64%), Gaps = 21/441 (4%)

Query: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-SRKYT 598
           +P IE S +    LSITGL+N   TCY+NS++QCLF T  FRDLFL+ KY  +  + KY 
Sbjct: 282 LPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYP 341

Query: 599 NPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQL 658
              QLS+   VLFKKMY+NGG +++P  FLK C  LRPD  IP DQQDTQEFLL +L+++
Sbjct: 342 KEVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARI 401

Query: 659 HDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGL 718
           H+ELS  N V   YP               +Y+ W+E+++  +G+SPID+I++GQ+EN L
Sbjct: 402 HEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENIL 460

Query: 719 FCQRCGHSSFNYSVFYVLSLAIP--SSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDC 776
            CQRCG+SS++YS FYVLSLAIP  S  S  S+ +K++LEDCINLFT DE+L+ +NAWDC
Sbjct: 461 KCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDC 520

Query: 777 PKCGTSASGTGPEE--EKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQ 834
           P C  + S +  EE   +KKK  +    +R+                        ++S++
Sbjct: 521 PNCRITDSKSKKEEITSQKKKSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKK 580

Query: 835 QNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQI 894
                            +FI LP +L IHLSRF+YDLTKKN+ VITYPLIL+I+LKN ++
Sbjct: 581 ----------LTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKV 630

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV---KKDINHGDID 951
           ++Y+LY   NH GNLI+GHYTS+VNK+  H++   +Q W  FDD+ +   +KD N  + +
Sbjct: 631 IRYKLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRN--NFE 688

Query: 952 AGITSISSSDVYVLFYEKIDE 972
           AG T +SS +VYVLFYE++DE
Sbjct: 689 AGKTEMSSDEVYVLFYERMDE 709

 Score =  116 bits (290), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 91/150 (60%), Gaps = 5/150 (3%)

Query: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70
           +++L  V+ VY  DI  ++ +LRL+ L  LL+HA +LF  Y   L  NQ  + LTAF+ G
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMV----TEVIESMSKDEV 126
           C+Y+YLIIP S+QFQ+R+  Y+ YA LK  YQDE  M  VL +V    T +++    +  
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 127 ETAR-IMRKRAYSVPYGKSPVTIQALSKAN 155
              R I RKRAYS+P    PV + +LS  N
Sbjct: 126 GICRTIKRKRAYSLPLRPLPVHMASLSIHN 155

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  353 bits (905), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 208/476 (43%), Positives = 269/476 (56%), Gaps = 58/476 (12%)

Query: 519 EIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATK 578
           EI+KH+VP +    N  K                LS+ GLRN G TCY+NSM+QCLF TK
Sbjct: 216 EIKKHTVPIIDATDNIPK---------------MLSLVGLRNQGNTCYINSMVQCLFGTK 260

Query: 579 AFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDF 638
             RDLF+S      F +K     ++S+ F  L   MY NGG SV+P  FL+  + LRPD 
Sbjct: 261 VLRDLFISEXXYKDFIKKDAE-TKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDL 319

Query: 639 RIPHDQQDTQEFLLFLLSQLHDELSESNR-VANDYPGXXXXXXXXXXXXXXEYDTWFEKH 697
            IP DQQDTQEFL+ LL  LHDEL  ++  ++N+Y                EY  W + +
Sbjct: 320 NIPKDQQDTQEFLVILLDILHDELVYTDDLISNNY-------VSDDINLGKEYMPWLQNN 372

Query: 698 ISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLED 757
           +  NG SPID IFQGQ+EN L CQRCG++S+NYS+FY+LSLAIP      S + +V+LED
Sbjct: 373 LKANGKSPIDLIFQGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKENS-KNRVKLED 431

Query: 758 CINLFTSDEQLTNENAWDCPKCGTSASGTGPEE------EKKKKRFLLNP---------D 802
           CIN FTSDE LT ENAW+CPKC  +   T  E       E + K   +NP          
Sbjct: 432 CINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKNKSINPLNFFKLHKVL 491

Query: 803 TRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTI 862
           + +SGN                       S  +N               NFI LP +L I
Sbjct: 492 SPSSGN-----------HHRHHHHHHHHKSDGKNKNKYKNEKLITLKQLNFIKLPPILVI 540

Query: 863 HLSRFFYDLTKKNNKVITYPLILSIVLKNE-QIMKYRLYAIANHFGNLISGHYTSLVNKD 921
           HLSRF+Y+ TKKNN VITYPLIL+I++KN   ++KY+LY + NH G L  GHYTS+VNKD
Sbjct: 541 HLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLINHQGGLTKGHYTSIVNKD 600

Query: 922 LDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT------SISSSDVYVLFYEKID 971
           L+H L+  +Q+WY FDDE +KK  ++  I+   +         SS VYVLFYE+I+
Sbjct: 601 LNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEFDSSKVYVLFYERIE 656

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 96/175 (54%), Gaps = 14/175 (8%)

Query: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYR----HALAANQ 59
           ++S    ++L   V  ++  DI  Y+ KLRLE+L DLL+H  YL + ++    H     Q
Sbjct: 21  IFSDIEMDDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQ 80

Query: 60  AEDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIE 119
           A     AFV G FY++LIIP+ +QFQ+++K +  Y DLK  Y+ + +M N+L  V E   
Sbjct: 81  AT---LAFVNGSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSV 137

Query: 120 SMSKDEVE--TARIMRKRAYSVPYGKSPV-----TIQALSKANSATVEPDAPTET 167
           S+ + ++     RI++KRAY+ P  +S +     +   LS+  + +  P  P  T
Sbjct: 138 SILEQDLSGINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRT 192

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  323 bits (827), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 245/447 (54%), Gaps = 18/447 (4%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           SK   +P I  +  E   LS+ G+RN+G TCY+NSMLQCLF +  FRDLFL+ K+E + +
Sbjct: 192 SKQYTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKA 251

Query: 595 RKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFL 654
              +    ++   ++LFKKMY NGGC+++P  F++ C  LRPDF+IPH QQDTQEFL+F+
Sbjct: 252 ETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFV 311

Query: 655 LSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQM 714
           L +L  EL+ ++    D                  Y  W+ + IS N +SPID +F+G +
Sbjct: 312 LERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDV 371

Query: 715 ENGLFCQRCGHSSFNYSVFYVLSLAIPSSTST-FSQRKKVRLEDCINLFTSDEQLTNENA 773
           E+ L C+ C  S+  +S FY+LSL IP   S+ F + K +RLEDCINLFT  E LT EN+
Sbjct: 372 ESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTGENS 431

Query: 774 WDCPKCGTSASGTGPEEEKKKKRFLLNPDTRA----------SGNXXXXXXXXXXXXXXX 823
           W CP C T A     + +K  ++   N    +          +G                
Sbjct: 432 WACPSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKY 491

Query: 824 XXXXXXQSSQQQNLEXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPL 883
                 Q  +QQ                +F+SLP +L IHLSRF YD++KKN   I+YP+
Sbjct: 492 DNLENEQRHRQQK-------KSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPM 544

Query: 884 ILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
            L++   +   + YRLY   NH G+   GHYT+LVNK+ +H  +   QKW  FDD+ V  
Sbjct: 545 SLTVETLDNSSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFN 604

Query: 944 DINHGDIDAGITSISSSDVYVLFYEKI 970
             +       I SI+++D YVLFYE+I
Sbjct: 605 RTDFFKSKTEINSITNNDAYVLFYERI 631

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 43/98 (43%), Gaps = 2/98 (2%)

Query: 13  LLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAGCF 72
           L   V  V+   I   +  L L K+  LL  A    +           E     + AGCF
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAAGCF 72

Query: 73  YIYLIIPHSIQFQSRDKSYAIYADLKKYY--QDEANMT 108
           YIYL++P++ QFQ  D  Y  Y  LK  Y  + E ++T
Sbjct: 73  YIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLT 110

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  330 bits (847), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 154/254 (60%), Positives = 188/254 (74%), Gaps = 9/254 (3%)

Query: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTN 599
           IPTIE+SPN YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S+KY+ Y     +N
Sbjct: 593 IPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSN 652

Query: 600 PN----QLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655
            +    +LS   ++LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEFL+ LL
Sbjct: 653 GSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 712

Query: 656 SQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQME 715
            +LHDELS+   VANDYP               EY  WF+K++  NGISPID+IFQGQME
Sbjct: 713 DRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 772

Query: 716 NGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSDEQLTN 770
           N L C+RCG+++FNYS FYVLSLAIP  +   S+      K+V+LEDCIN+FTSDE L+ 
Sbjct: 773 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 832

Query: 771 ENAWDCPKCGTSAS 784
           ENAWDCP+CG +AS
Sbjct: 833 ENAWDCPRCGPTAS 846

 Score =  306 bits (785), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 199/455 (43%), Positives = 273/455 (60%), Gaps = 43/455 (9%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYSNELL+ V+D+Y +DI HY+P+L+LEKL+DLLEH EYLFE Y  ++  ++  D L
Sbjct: 17  FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDAL 76

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
           TAF+ GC+Y++LIIP S+QFQ+R+KSY+IY DLKK Y++E NMTNV+LMV + I  +  +
Sbjct: 77  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 136

Query: 125 EVETA-----RIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAP---TETEFENGTTMW 176
            V+       RI +KRA+SVP       + +LS   +A  +       TE + E  + +W
Sbjct: 137 SVKHGAGIEHRITKKRAFSVPADDLSGQVASLSLDTAAPQDHGLKGTFTEDDAEQSSPVW 196

Query: 177 TAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXXXXXX 236
           TAP LEPND LK+               E  P       +  F EPE             
Sbjct: 197 TAPNLEPNDQLKLALLP-----------EVIP-------TPAFREPERKTSVPVRPSVLL 238

Query: 237 XXVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHM--------SNDDY---- 284
             VP+    +  T+ AS +  F +   +R  THRKDSYHSV+M         NDD     
Sbjct: 239 EDVPS-IYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVE 297

Query: 285 -DAFTFNLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTNHILAPNLLNVD 342
            D F  +L  LQKQS++T  +L  IL ++ +R+ +LLIDLR  +R   NHI+APNL+NVD
Sbjct: 298 NDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVD 357

Query: 343 PTLLWNQNKGSPIESDVQLERTL-DNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQ 401
           P LLW++   +PI  D  LE  L +N+    R++F+YIVYYTD+KTFM ++FDY  +FF 
Sbjct: 358 PNLLWDKQTNTPIYKDDILEHLLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFY 417

Query: 402 LIYTSNK-NLKCTPKVLLGGYEQWKKFLSKSSQAY 435
           L+ TS K  L   P  LLGGYE+WKK L   +Q Y
Sbjct: 418 LMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEY 452

 Score =  172 bits (437), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 97/119 (81%), Gaps = 2/119 (1%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF++LP +L IHLSRF+YDLTKKNN V+TYPLIL+I+LKN   MKY+L+ + NH G LIS
Sbjct: 953  NFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTGTLIS 1012

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTSLVNKDL+H++N G+ KWYYFDDE VK D  HG  D  +  ISSSDVYVLFYE++
Sbjct: 1013 GHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGS-DKNL-KISSSDVYVLFYERV 1069

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  327 bits (837), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 153/249 (61%), Positives = 182/249 (73%), Gaps = 8/249 (3%)

Query: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTN 599
           IPTIEQS N YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S+KY+ Y  +   N
Sbjct: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645

Query: 600 ---PNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLS 656
                +LS   N+LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEFL+ LL 
Sbjct: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705

Query: 657 QLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMEN 716
           +LHDELS    VANDYP               EY  WF+K++  NGISPID+IFQGQMEN
Sbjct: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765

Query: 717 GLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSDEQLTNE 771
            L C+RCG+++FNYS FYVLSLAIP  +   S+      K+V+LEDCIN+FTSDE L+ E
Sbjct: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825

Query: 772 NAWDCPKCG 780
           NAWDCP+CG
Sbjct: 826 NAWDCPRCG 834

 Score =  305 bits (782), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 196/464 (42%), Positives = 272/464 (58%), Gaps = 44/464 (9%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYSNELL+ V+D+Y +DI HY+P+L+LEKL+DLLEH EYLFE Y  ++   +  D L
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
           TAFV GC+Y++LIIP S+QFQ+R+KSY+IY+DLKK Y++E NMTNV+LMV + I  +  D
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127

Query: 125 EVETA-----RIMRKRAYSVPYGKSPVTIQALS---KANSATVEPDAPTETEFENGTTMW 176
            V+       RI +KRA+SVP       + +LS         +   + TE + +  + +W
Sbjct: 128 SVKHVVGIEHRITKKRAFSVPGIDLSDQLASLSLDAAGPRGHLHKTSSTEEDADQSSPVW 187

Query: 177 TAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXXXXXX 236
           TAP LEPND LK+               E  P     + +FP  E               
Sbjct: 188 TAPNLEPNDQLKLALLP-----------EVIP-----TPAFP--ESGRKTSTPVRQSVLL 229

Query: 237 XXVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHM--------SNDDY---- 284
             VP   +   GT+ AS+   F +   +R  THRKDSYHSV+M         NDD     
Sbjct: 230 EDVPYTHNDNDGTS-ASSDQPFGEITADRSVTHRKDSYHSVYMVDSDTFKSDNDDLLDVE 288

Query: 285 -DAFTFNLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTNHILAPNLLNVD 342
            D F  +L  LQKQS++T  +L  IL +Q + + LLLIDLR  +R   N+I+APNL+ +D
Sbjct: 289 TDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNNIVAPNLVKID 348

Query: 343 PTLLWNQNKGSPIESDVQLERTLD-NKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQ 401
           P LLW++    P+  D  LE+ L+ N+    R +F+Y+V Y+D+KTFM ++FDY  +FF 
Sbjct: 349 PNLLWDKKTNKPVYQDDILEQLLEGNEHFINRDKFQYVVCYSDVKTFMTMNFDYSFIFFY 408

Query: 402 LIYTSNKN-LKCTPKVLLGGYEQWKKFLSKSSQAY-CDKDAFLY 443
           L+ TS K  L   P  LLGGYE+WKK L   +Q Y    D +LY
Sbjct: 409 LLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLY 452

 Score =  171 bits (433), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF++LP +L IHLSRF+YDLTKKNN VITYPLIL+I+LKN   MKYRL+ + NH G LIS
Sbjct: 944  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1003

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTSLVNKDL+H+++ G+ KWYYFDDE VK D  HG  D  +  ISSSD YVLFYE++
Sbjct: 1004 GHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGS-DKSL-KISSSDAYVLFYERV 1060

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  325 bits (833), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 152/255 (59%), Positives = 189/255 (74%), Gaps = 11/255 (4%)

Query: 536 KHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-- 593
           K  +IPTIE++PN YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S+ Y++Y   
Sbjct: 578 KDYSIPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEP 637

Query: 594 ---SRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEF 650
              +R + +P +LS   ++LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEF
Sbjct: 638 LASNRPHHSP-KLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEF 696

Query: 651 LLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIF 710
           L+ LL +LHDELS    VANDYP               EY  WF+K++  NGISPID+IF
Sbjct: 697 LMILLDRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIF 756

Query: 711 QGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSD 765
           QGQMEN L C+RCG+++FNYS FYVLSLAIP+ +   S+      K+V+LEDCIN+FTSD
Sbjct: 757 QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSD 816

Query: 766 EQLTNENAWDCPKCG 780
           E L+ ENAWDCP+CG
Sbjct: 817 EVLSGENAWDCPRCG 831

 Score =  315 bits (807), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 195/456 (42%), Positives = 272/456 (59%), Gaps = 43/456 (9%)

Query: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDL 63
           L++PEYS+ELL+ V+D+Y +DI HY+P+L+LEKL+DLLEH EYLFE Y  ++   +  D 
Sbjct: 7   LFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDA 66

Query: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSK 123
           LTAFV GC+Y++LIIP S+QFQ+R+KSY+IY DLKK Y++E NMTNV+LMV + I  +  
Sbjct: 67  LTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 124 DEVETA-----RIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAP---TETEFENGTTM 175
           + V+       RI +KRA+SVP       + +LS   +   + +     TE + +  + +
Sbjct: 127 ESVKHVVGIEHRINKKRAFSVPANDLSGQVASLSLDTAGPQQHNIKVPLTEDDMDQSSPV 186

Query: 176 WTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXXXXX 235
           WTAP LEPND LK+                  P++   S    F EPE  +         
Sbjct: 187 WTAPNLEPNDQLKLAL---------------LPEVIPTS---TFNEPERKSTSPARPSVL 228

Query: 236 XXXVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHM--------SNDDY--- 284
              VP        +T AS +  F D   +R  THRKDSYHSV+M         ND++   
Sbjct: 229 LEDVPCTYHDNDAST-ASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNV 287

Query: 285 --DAFTFNLARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTNHILAPNLLNV 341
             D F  +L  LQKQS++T  +L  IL ++ +R+ +LLIDLR  +R   NHI+APNL+ V
Sbjct: 288 ENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKV 347

Query: 342 DPTLLWNQNKGSPIESDVQLERTL-DNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFF 400
           DP LLW++   +P+  D  LE  L +N+    R +F+YIVYY+D+KTFM ++FDY  +FF
Sbjct: 348 DPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFF 407

Query: 401 QLIYTSNKN-LKCTPKVLLGGYEQWKKFLSKSSQAY 435
            L+ TS K  L   P  LLGGYE+WKK L   +Q Y
Sbjct: 408 YLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEY 443

 Score =  172 bits (436), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF++LP +L IHLSRF+YDLTKKNN VITYPLIL+I+LKN   MKYRL+ + NH G LIS
Sbjct: 942  NFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLIS 1001

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTSLVNKDL+H ++ G+ KWYYFDDE VK D  HG  D  +  ISSSDVYVLFYE++
Sbjct: 1002 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGS-DKNL-KISSSDVYVLFYERV 1058

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  323 bits (827), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 181/250 (72%), Gaps = 9/250 (3%)

Query: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF----SR 595
           IPTIEQS N YV+LSITGLRN+G TCY+NSM+QCLFA K FR LF+S  Y++Y       
Sbjct: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644

Query: 596 KYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLL 655
           +  + ++LS   N+LF KMY+NGGCSVVPTGFLK  N LRPD +IP DQQDTQEFL+ LL
Sbjct: 645 RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704

Query: 656 SQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQME 715
            +LHDELS    VANDYP               EY  WF+K++  NGISPID+IFQGQME
Sbjct: 705 DRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764

Query: 716 NGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQ-----RKKVRLEDCINLFTSDEQLTN 770
           N L C+RCG+++FNYS FYVLSLAIP  +   S+      K+V+LEDCIN+FT DE L+ 
Sbjct: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824

Query: 771 ENAWDCPKCG 780
           ENAWDCP+CG
Sbjct: 825 ENAWDCPRCG 834

 Score =  318 bits (816), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 197/469 (42%), Positives = 272/469 (57%), Gaps = 69/469 (14%)

Query: 4   LYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDL 63
           L++PEYSNELL+ V+D+Y +DI HY+P+L+LEKL+DLLEH EYL+E Y  ++  N+  D 
Sbjct: 7   LFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDA 66

Query: 64  LTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSK 123
           LTAF+ GC+Y++LIIP S+QFQ+R+KSY+IY DLKK Y++E NMTNV+LMV + I  +  
Sbjct: 67  LTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLD 126

Query: 124 DEVETA-----RIMRKRAYSVPYGKSPVTIQALSKANSATVEPDAP------TETEFENG 172
           + V+ A     RI +KRA+SVP       + +LS  N+    P         TE + E  
Sbjct: 127 ESVKHAVGIEHRITKKRAFSVPANDLSGQVASLSLENAG---PHGHGFKASFTEEDAEQS 183

Query: 173 TTMWTAPELEPNDHLKVXXXXXXXXXXXXXXNEQFPKIHNESHSFPFEEPELHAXXXXXX 232
           + +WTAP LEPND LK+                                PE+        
Sbjct: 184 SPVWTAPNLEPNDQLKLALL-----------------------------PEVIPTPIYPE 214

Query: 233 XXXXXXVPARASRKL----------GTTQASNSSDFNDQKINRYATHRKDSYHSVHM--- 279
                  P R S  L          G + AS +  F +  ++R  THRKDSYHS++M   
Sbjct: 215 SGRKTSSPVRPSVLLEDVPYNCYDGGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDS 274

Query: 280 -----SNDDY-----DAFTFNLARLQKQSVVTCDQLMRILC-SQDRDNLLLIDLRFSKRF 328
                 NDD      D F  +L  LQKQS++T  +L  IL  S +R+ +LLIDLR  +R 
Sbjct: 275 DTLKEDNDDLLNVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRS 334

Query: 329 QTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-DNKLLNARSQFEYIVYYTDMKT 387
           + NHI+APNL+ +DP LLW++   +P+  D  LE  L +N++   R +FEY+VYYTD+KT
Sbjct: 335 EINHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKT 394

Query: 388 FMKLDFDYQLVFFQLIYTSNK-NLKCTPKVLLGGYEQWKKFLSKSSQAY 435
           FM ++FDY  +FF L+ TS K +L   P  LLGGYE+WKK L   +Q Y
Sbjct: 395 FMYMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEY 443

 Score =  170 bits (431), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 97/119 (81%), Gaps = 2/119 (1%)

Query: 852  NFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLIS 911
            NF++LP +L IHLSRF+YDLTKKN+ VITYPLIL+I+LKN + MKYRL+ + NH G L+S
Sbjct: 945  NFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRLFGVVNHTGTLVS 1004

Query: 912  GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKI 970
            GHYTSLVNKDL+H ++ G+ KWYYFDDE VK D  HG  D  +  ISSSDVYVLFYE++
Sbjct: 1005 GHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGS-DKNL-KISSSDVYVLFYERV 1061

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  290 bits (741), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 174/459 (37%), Positives = 256/459 (55%), Gaps = 59/459 (12%)

Query: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64
           ++PEYS EL + V+D+Y  DI    P+LRL KLIDLLEH  YL E++ H L + + +D L
Sbjct: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70

Query: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESM--- 121
           +A++ GC+Y+YLIIP S QFQ+++KSY++Y D K  YQ+EANMTNV  MV   ++S+   
Sbjct: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130

Query: 122 SKDEVE-TARIM-RKRAYSV----PYGKSPVTIQALSKANSATVEPDAPTE------TEF 169
           S  E E T R++ R RA+SV    P   + +      + +S T  P +  +       E 
Sbjct: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPMEL 190

Query: 170 ENGTTMWTAPELEPNDHLKVXXXXXXXXXXXXXXNE-QFPKIHNESHSFPFEEPELHAXX 228
           ++ T +WTAP L PND LK+              ++ Q   I ++ ++F    P      
Sbjct: 191 DDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTIPLPH----- 245

Query: 229 XXXXXXXXXXVPARASRKLGTTQASNSSDFNDQK-------INRYATHRKDSYHSVHMSN 281
                     +P +             +DFN  K       ++R  THRKDSYHSV+M N
Sbjct: 246 -------QIPLPVKV------------TDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDN 286

Query: 282 DDYDAFTF----------NLARLQKQSVVTCDQLMRILCS-QDRDNLLLIDLRFSKRFQT 330
           D+   +             L RLQKQ+V+TC +L  IL     +D++LLI L   +R ++
Sbjct: 287 DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKS 346

Query: 331 NHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMK 390
           N+I+A N +N+DP +LW+     PI  D +LE+ L+++L N R  F Y+VYYTD+KT+MK
Sbjct: 347 NYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMK 406

Query: 391 LDFDYQLVFFQLIYTSNKN-LKCTPKVLLGGYEQWKKFL 428
           ++FDY    F L+ +S  + LK  P  LLGG E+WKK +
Sbjct: 407 INFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVI 445

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 142/553 (25%), Positives = 219/553 (39%), Gaps = 88/553 (15%)

Query: 294 LQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGS 353
           L   S ++   L +++ S + D+ LLIDLR    F   HI A N++ ++P     Q    
Sbjct: 156 LNTGSTISSSHLQQLIDSHN-DSTLLIDLRQRGEFSKLHINAKNVICIEPISFKAQYTDL 214

Query: 354 PIESDVQLERTLDN-KLLNARSQFEYIVYYT--DMKTFMK-LDFDYQLVFFQLI----YT 405
            IE    +    +   L  AR  F++IV YT  D ++  +  D   Q +   L+    + 
Sbjct: 215 EIEKKSLITSPKEEIGLFRARDTFKFIVLYTSEDKESHSRSFDLQQQAILLDLLINHSFA 274

Query: 406 SNKNLKCTPKVLLGGYEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXX 465
              N      VL  G+  W   +S+  Q   ++    Y+   NG   P  + S+      
Sbjct: 275 KPLNANTRVYVLKAGFSNW---VSEGRQCIGEEHHGTYT---NGATFPELTFSIGGSLKV 328

Query: 466 XXXXXXX-------------------------XXXXXXKTEEMTKTPY-----NRAPFPT 495
                                                 ++ +  +TP      N A +P 
Sbjct: 329 RQDIQEQPPLLSNGAYLSASSASSSPHLSPSNHYSRLNRSTQYPQTPQLTAGSNGAHYPG 388

Query: 496 PLVQ-----AQRADHFPA--SSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTI----- 543
           PL+      +  A+H P   + +  T D   I    VP    + +     AIP +     
Sbjct: 389 PLLPIDNAVSPMANHIPKLRAPRVFTADNEAI----VPVKMNDLSKPPSQAIPPLPKFPS 444

Query: 544 -EQSP-----NEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSR 595
            E SP     N+Y      GL N+G +CY+N ++QCL  T    ++FL+  YE +   + 
Sbjct: 445 RESSPALGSANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNS 504

Query: 596 KYTNPNQLSKYFNVLFKKMYMNG-------GCSVVPTGFLKACNALRPDFRIPHDQQDTQ 648
           +  +   L+KYF  L   MY N        G  V P  F  AC  +   FR    QQD Q
Sbjct: 505 RLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQDCQ 563

Query: 649 EFLLFLLSQLHDELSE--SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPI 706
           EF  FLL  LH++L++   N    +                     W E+ ++ +  S I
Sbjct: 564 EFCQFLLDGLHEDLNQCGGNPPLKELSDEAEKMREKLSLRIASSIEW-ERFLTTD-FSVI 621

Query: 707 DNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDE 766
            ++FQGQ  + L CQ CG +S  Y  F VLS+ +P +       K   + DC   FT  E
Sbjct: 622 VDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVPHA-------KSCNIIDCFKEFTKVE 674

Query: 767 QLTNENAWDCPKC 779
           +L  +  W CP+C
Sbjct: 675 KLETDEQWSCPRC 687

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 60/136 (44%), Gaps = 36/136 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVL-------------KNEQI-------- 894
           LP  L IHL RF  ++  KNN  + YP  L +                 E++        
Sbjct: 702 LPRNLIIHLKRF-DNMMNKNNVFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPP 760

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             Y+LY IA+H G+L  GHYTS V+K         K+ W YFDD + +   N        
Sbjct: 761 FNYKLYGIASHVGSLYGGHYTSYVDKG-------PKRGWCYFDDTSFRPVRN-------A 806

Query: 955 TSISSSDVYVLFYEKI 970
           T   + + YVLFY ++
Sbjct: 807 TECITPNAYVLFYHRV 822

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 119/448 (26%), Positives = 182/448 (40%), Gaps = 120/448 (26%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QCL +T     +FL+  YE +   + K  +   L+KYF  L   
Sbjct: 519 VGLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHT 578

Query: 614 MYMNGGCS--------VVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE- 664
           MY  G           + P  F  AC ++   F+  + QQD+QEF  FLL  LH++L++ 
Sbjct: 579 MYREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-DNTQQDSQEFCQFLLDGLHEDLNQC 637

Query: 665 -SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRC 723
            +N    +                     W E+ ++ +  S I ++FQGQ  + L C+ C
Sbjct: 638 GANPPLKELSEDAEKMREKLSMRIASSIEW-ERFLTTD-FSVIVDLFQGQYASQLKCKVC 695

Query: 724 GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSA 783
           G +S  Y  F VLS+ +P  +S         + DC N FT  E           K GT  
Sbjct: 696 GCTSTTYQTFSVLSVPVPHVSS-------CHILDCFNEFTKVE-----------KLGTDE 737

Query: 784 SGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXX 843
             + P  +KK+      P T+                                       
Sbjct: 738 LWSCPTCKKKQ------PSTKK-------------------------------------- 753

Query: 844 XXXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSI---------------- 887
                       LP  L IHL RF  ++  KNN  + YP +L +                
Sbjct: 754 -------LTITRLPRNLIIHLKRF-DNMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGV 805

Query: 888 ---VLKNEQI--MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVK 942
              +    Q+   +Y+L A+A+H G+L  GHYT+ VNK     +N+G   W+YFDD + +
Sbjct: 806 TDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNK----GINRG---WHYFDDTSYR 858

Query: 943 KDINHGDIDAGITSISSSDVYVLFYEKI 970
              N        T   + + YVLFY ++
Sbjct: 859 PIKNE-------TECITPNAYVLFYHRV 879

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 48/117 (41%), Gaps = 10/117 (8%)

Query: 316 NLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDN-KLLNARS 374
           +LLLID+R    F + HI A +++ V+P    N      +E    +        L  AR 
Sbjct: 185 SLLLIDVRPRAEFDSKHIKAKSVICVEPVSFKNSFTDLEVEKKSLITSPQKEIALFQARD 244

Query: 375 QFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSN-------KNLKCTPKVLLGGYEQW 424
           ++ YIV YT      +     QLV   ++   +       KN+K     L  G+  W
Sbjct: 245 KYNYIVIYTQQSEKTQFYMHQQLVLLDILMNKSFAKPLNEKNIKVF--TLDKGFSGW 299

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 141/536 (26%), Positives = 210/536 (39%), Gaps = 67/536 (12%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S +  ++L  +L S  R NLLLID+R  K F T HI AP +L + P    +      IE 
Sbjct: 167 SFILPEKLHDLLSSHKR-NLLLIDVRTRKEFDTLHIDAPIILPIGPLSFKSTFTDLQIEQ 225

Query: 358 DVQLERTLDNK-LLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQL--IYTSNKNL-KCT 413
              L  T   +     R+QF YIV YT         +   +  F +  I  S +N+ +  
Sbjct: 226 TSLLTSTFQERNYFKKRNQFRYIVLYTKDDNDTTYYYTQVISLFNILTIAASKRNIDQIC 285

Query: 414 PKVLL--GGYEQWKK--------FLSKSSQAYC------DKDAFLY-------SSTNNGR 450
           P + +  GG   W +           K++  Y        KD+ +Y       +S N G 
Sbjct: 286 PSIFILKGGITSWVQHSYECKTNLTGKTANQYNQNLFKRSKDSSIYKHVALSDNSLNEGS 345

Query: 451 NA--PVTSHSL---------PEHYXXXXXXXXXXXXXXXKTEEMTKTPYNRAPFPTPLVQ 499
               P+   S+         P H                   ++     +RAP  T   +
Sbjct: 346 KTCNPIVPASVQTVIPNFIPPSHSKSTICLMKNEQPQALYNHQVIPNLIHRAPLDT---E 402

Query: 500 AQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSI---T 556
           +    + P   +N      EI K++    SG     K   +P           L +   T
Sbjct: 403 SNNTQNVPMGFKNPIPQMYEIPKYNPSVNSG----PKLPLLPPTANPQQIVPKLDLDFTT 458

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKY--EHYFSRKYTNPNQLSKYFNVLFKKM 614
           GL N+  +CY+N ++QCL +T     L+L+  +  +     K  +   LSK F  L + M
Sbjct: 459 GLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVENKLGSKGFLSKNFANLIQTM 518

Query: 615 YMNGGCS---------VVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE- 664
           Y               V P  F  AC  +   +     +QD QEF  FLL  LH++L++ 
Sbjct: 519 YKKSAFQPYNPNFLHPVAPLEFKNACGMMNSIY-AESTEQDCQEFCEFLLDGLHEDLNQC 577

Query: 665 -SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRC 723
             N    +                     W E  ++ N  SPI N+FQGQ  + L C  C
Sbjct: 578 SGNPRPKELSANEAELRESLSMRIASEIEW-ESFLTTN-FSPIINLFQGQYASRLQCLIC 635

Query: 724 GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            H+S  Y  F +LS+ +PS    FS  +   + DC   FT  E+L N+  W CPKC
Sbjct: 636 QHTSTTYQPFSLLSIPVPS--MVFSNGQTCNILDCFKEFTKCERLDNDEKWFCPKC 689

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 63/138 (45%), Gaps = 36/138 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYP--LILSIVLKNE-------------------QI 894
           LP  L IH  RF  +   KNN  + YP  L L+ +  N+                     
Sbjct: 704 LPKNLIIHFKRF-DNFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPNFNEPPPSRGQTPP 762

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
            KY+L A++ H GNL SGHYT+ V+K L        + W+ FDD + +  +  G      
Sbjct: 763 FKYKLNAVSCHSGNLGSGHYTAYVDKGL-------YRGWFRFDDASYRP-VKFG------ 808

Query: 955 TSISSSDVYVLFYEKIDE 972
           T   + D Y+LFY++I E
Sbjct: 809 TEFLTPDAYLLFYQRIYE 826

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 174/736 (23%), Positives = 260/736 (35%), Gaps = 172/736 (23%)

Query: 315 DNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL--DNKLLNA 372
           D LLLID+R    F   HI   N++ +DP    +      IES V L  +   D    + 
Sbjct: 161 DALLLIDVRPRSEFVRAHIKCKNIICIDPASFKDSFTDQQIES-VSLITSPHSDITFFSN 219

Query: 373 RSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLK--CTPKVLL--GGYEQWKKFL 428
           R +F++I+ YTD +         Q      I + N  +K     K+L+   G+  W K  
Sbjct: 220 RDKFKFIILYTDTQLHNNFQ-QRQTRILAKILSQNSVIKPLSGTKILILENGFSNWVKLG 278

Query: 429 SKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTP- 487
                +  +      SS+     +P     L                    T+ +  T  
Sbjct: 279 GAYQSSVSETAHLTSSSSTPAFGSPQVPTGLFNQKSLSPNKDKSMPMVSMNTQPLLTTVQ 338

Query: 488 -------YNRAPF---PTPLVQAQRADHF-------------PASSQNH-------TRDK 517
                  Y+  P    P+P   +     F             P++ QN        + D 
Sbjct: 339 RPQLPLYYSDLPIIPQPSPNRNSPTVQKFSPHPPTTLSKLNTPSTIQNKANTVERISPDI 398

Query: 518 NEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALS---------ITGLRNIGCTCYVN 568
              Q H+    + N    +   +P    S +    L+         I GL NIG  CY+N
Sbjct: 399 RAAQAHAYLPPASNVFSPRIPPLPQQNLSSSRQTILNNSQVLDLDLIVGLENIGNCCYMN 458

Query: 569 SMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKKMYMNGG-----CS 621
            +LQCL  T     +FL   Y ++  F     +   L+K F +L   M+ +G        
Sbjct: 459 CILQCLVGTHDLVRMFLDNTYLNFINFDSSRGSKGLLAKNFAILVNNMHRHGAFTPPNVR 518

Query: 622 VVPTG---FLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN-----RVANDYP 673
            +P     F K C  + P +     QQD QEF  FLL  LH++L+++      +  +D  
Sbjct: 519 TIPVQTIQFKKICGHINPMYS-DSMQQDCQEFCQFLLDGLHEDLNQNGSKKHLKQLSDEE 577

Query: 674 GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVF 733
                          E++ +     S      I ++FQGQ  + L CQ C H+S  Y  F
Sbjct: 578 ERMREKMSIRKASALEWERFLLTDFSA-----IIDLFQGQYASRLQCQVCEHTSTTYQTF 632

Query: 734 YVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKK 793
            VLS+ +P       + K   + DC   FT            C + G     + P+  KK
Sbjct: 633 SVLSVPVP-------RVKTCNILDCFREFTK-----------CERLGVDEQWSCPKCLKK 674

Query: 794 KKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXXXNF 853
           +      P T+                                                 
Sbjct: 675 Q------PSTKQ---------------------------------------------LKI 683

Query: 854 ISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-----------VLKNEQI-------- 894
             LP  L I+L RF   + K NN  + YP  L +            + NE I        
Sbjct: 684 TRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWARDFNHEAIVNEDIPTRGQVPP 742

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
            +YRLY +A H G+L  GHYTS V K         K+ WY+FDD ++ + I         
Sbjct: 743 FRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDD-SLYRPITFS------ 788

Query: 955 TSISSSDVYVLFYEKI 970
           T   +   YVLFYE+I
Sbjct: 789 TEFITPSAYVLFYERI 804

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 210/521 (40%), Gaps = 84/521 (16%)

Query: 313 DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL------D 366
           D   +LL+D+R    F   HI   N++ ++P       K S  +SD+ L ++L      +
Sbjct: 170 DSSGILLVDIRPRMDFNDGHIKHNNVICIEPISF----KESYTDSDI-LRKSLITASDRE 224

Query: 367 NKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS---NKNLKCTPKVLL-GGYE 422
             L   R +F  IV YTD     K  +  QL   Q I  +   +K L  T  ++L  G  
Sbjct: 225 VDLFKNRDKFRLIVLYTDTDEHTKYYWQ-QLEVLQDILCNRSFDKPLHHTKVIVLQNGVN 283

Query: 423 QWK--------KFLSKSSQAYCDKDA------FLYSSTNNGRNAPVTSHSLPEHYXXXXX 468
            WK        K +  +      K           S+ NN   A   SHS    +     
Sbjct: 284 AWKEKYPMELKKIMESAISDIRTKPVEHNFHPMALSNNNNIEKANSPSHSQTTSFTHYPD 343

Query: 469 XXXXXXXXXXKTEEMTKTPYNRAPFPTPLVQA-QRADHF--------PASSQNHTRDKNE 519
                     KT  +   P    P  + L +A Q+ D          P   +NH ++ N 
Sbjct: 344 APFLTNGASIKTAGLV--PNQLLPSTSNLTKALQQNDEGNSEPYKLQPNGIKNHRQESNN 401

Query: 520 IQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSIT-GLRNIGCTCYVNSMLQCLFATK 578
               +   +S NGN S       + +S +  + L    GL N+G +CY+N ++QCL    
Sbjct: 402 HANGTNCIVSSNGNNS-------VAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCH 454

Query: 579 AFRDLFLSTKYEHYFSRKYTNPNQ-------LSKYFNVLFKKMYMNG-----------GC 620
               +FL+  Y     RK+ N N        L+ YF+ L +KMY  G             
Sbjct: 455 ELSYIFLTNSY-----RKHVNVNSRLGSKGLLANYFSQLVQKMYQQGKLQAYNNTNMEST 509

Query: 621 SVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SNRVANDYPGXXXX 678
           +V PT F  AC ++   F+    QQD QEF  FLL  LH++L++  +N    +       
Sbjct: 510 AVHPTQFKLACGSINSLFK-GKQQQDCQEFCQFLLDGLHEDLNQCGTNPPLKELSPEAEK 568

Query: 679 XXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSL 738
                         W E++++ +  S I ++FQGQ  + L C+ C H+S  Y  F VLS+
Sbjct: 569 MRETMPMRIASAIEW-ERYLTTD-FSVIVDLFQGQYASQLRCKICAHTSTTYQAFSVLSV 626

Query: 739 AIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            +P + S         + DC   FT  E L  +  W CP C
Sbjct: 627 PVPRARS-------CTIYDCFKEFTKLETLEKDELWYCPYC 660

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 63/137 (45%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLIL--------------------SIVLKNEQI- 894
           LP  L IHL RF  ++  KNN  + YP  L                    S+ L+ ++  
Sbjct: 675 LPNNLIIHLKRF-DNMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLPLRGQKPP 733

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             YRL+A+A+H G L  GHYTS V        +KG+  W  FDD + +K I   D     
Sbjct: 734 FNYRLFAVASHSGTLYGGHYTSFV--------DKGRVGWCSFDDVSWRK-IRRKD----- 779

Query: 955 TSISSSDVYVLFYEKID 971
               + + YVLFY +++
Sbjct: 780 -EYITPNAYVLFYRRVN 795

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 128/280 (45%), Gaps = 20/280 (7%)

Query: 509 SSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVN 568
           +S  H+   + IQ  S  +LS N +       PT   S + Y      GL N+G +CY+N
Sbjct: 519 NSNGHSSATSTIQP-SCLSLSNNDSLDHTDVTPT---SSHNYDLDFAVGLENLGNSCYMN 574

Query: 569 SMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKKMY---MNGG--CS 621
            ++QC+  T     +FL   Y  + +   K  +   L+KYF  L   MY   ++G    S
Sbjct: 575 CIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMMYKEQVDGSKKIS 634

Query: 622 VVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SNRVANDYPGXXXXX 679
           + P  F  AC ++   F+    QQD QEF  FLL  LH++L++  SN    +        
Sbjct: 635 ISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEAEAR 693

Query: 680 XXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLA 739
                        W E+ ++ +  S I ++FQGQ  + L C+ C H+S  Y  F VLS+ 
Sbjct: 694 REKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIP 751

Query: 740 IPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           IP   S    R  + +EDC   FT  E L  +  W CP C
Sbjct: 752 IPKKNS----RNNITIEDCFREFTKCENLEVDEQWLCPHC 787

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 62/137 (45%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------LKNEQI------- 894
           LP  L +HL RF  +L  KNN  + YP +L +               + ++++       
Sbjct: 802 LPRNLIVHLKRF-DNLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 860

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY LY +A HFG L  GHYT+ V K L       K+ W YFDD   K   N  D    
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPVKNKAD---- 909

Query: 954 ITSISSSDVYVLFYEKI 970
                +S+ YVLFY ++
Sbjct: 910 ---AINSNAYVLFYHRV 923

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  113 bits (282), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/244 (30%), Positives = 113/244 (46%), Gaps = 20/244 (8%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFK 612
           + GL N+G +CY+N ++QCL        +FL   +E Y   + K  +   L++YF+ L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 613 KMYMN------GG--CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE 664
            MY N      GG    V P  F  AC ++   F+    QQD QEF  FLL  LH++L++
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLNQ 737

Query: 665 --SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
              N+   +                     W E+ ++ +  S I ++FQGQ  + L C+ 
Sbjct: 738 CGGNKRLAELTEEAENLREKLSLRIASSIEW-ERFLTTD-FSVIGDLFQGQYASRLQCKT 795

Query: 723 CGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTS 782
           CG +S  Y  F VLS+ +PS         K  + DC + FT  E L  +  W CP+C + 
Sbjct: 796 CGKTSTTYQPFSVLSIPVPS-----KHISKCSIIDCFDEFTKVENLEVDEQWSCPRCKSK 850

Query: 783 ASGT 786
              T
Sbjct: 851 QPST 854

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 62/135 (45%), Gaps = 35/135 (25%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVL--------------------KNEQIM 895
           LP  L IHL RF   L K NN ++ YP  L +                        +   
Sbjct: 862 LPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWANDFDGKLPLNVSELPTRGQKPPF 920

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
            Y+LY +A HFG+L  GHYT+ V+K +       K  WYYFDD + +       I   + 
Sbjct: 921 NYKLYGVACHFGSLYGGHYTAYVDKGI-------KNGWYYFDDTSCRP------IKNSME 967

Query: 956 SISSSDVYVLFYEKI 970
            I+SS  YVLFY++I
Sbjct: 968 PITSS-AYVLFYKRI 981

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 5/134 (3%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S +  DQL  IL   D   +L ID+R    F   H   PN++ ++P    +      +E 
Sbjct: 175 SPIFLDQLDEILRDHDSSQVLFIDVRTRLDFNKGHFKVPNIICIEPVSFKSSYSDHDLEK 234

Query: 358 DVQLERTLDNKLL-NARSQFEYIVYY---TDMKTFMKLDFDYQLVFFQLI-YTSNKNLKC 412
              +  T D  +L + R +F +IV Y   TD K+ +       L+   L+ ++  K L  
Sbjct: 235 KSMITSTNDEIVLFHRRQEFAFIVLYSNDTDKKSGIVYKERKTLLANLLLNHSFEKPLSN 294

Query: 413 TPKVLLGGYEQWKK 426
              VL  G++ W K
Sbjct: 295 RLYVLENGFDSWTK 308

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 109/233 (46%), Gaps = 16/233 (6%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QC+  T     +FL   Y  + +   K  +   L+KYF  L   
Sbjct: 565 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 624

Query: 614 MYM-----NGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SN 666
           MY      +   S+ P  F  AC ++   F+    QQD QEF  FLL  LH++L++  SN
Sbjct: 625 MYKEQVDSSKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 683

Query: 667 RVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
               +                     W E+ ++ +  S I ++FQGQ  + L C+ C H+
Sbjct: 684 PPLKELSQEAEARREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLRCKVCNHT 741

Query: 727 SFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           S  Y  F VLS+ IP   S    + K+ +EDC   FT  E L  E  W CP C
Sbjct: 742 STTYQPFTVLSIPIPKKNS----QNKITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 61/137 (44%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------LKNEQI------- 894
           LP  L +HL RF  +   KNN  + YP +L +               + ++++       
Sbjct: 805 LPRNLIVHLKRF-DNFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 863

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY LY +A HFG L  GHYT+ V K L       K+ W YFDD   K   N  D    
Sbjct: 864 PFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDDTKYKPVKNQTD---- 912

Query: 954 ITSISSSDVYVLFYEKI 970
                +S+ YVLFY ++
Sbjct: 913 ---AINSNAYVLFYHRV 926

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 1/68 (1%)

Query: 318 LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDN-KLLNARSQF 376
           LLID+R    F  +HI + N++ ++P           +E    +    D  KL  +R+ F
Sbjct: 210 LLIDIRSRLEFNKSHIDSKNIICLEPISFKMSYSDHDLERKSLITSPNDEIKLFQSRNLF 269

Query: 377 EYIVYYTD 384
           ++IV YTD
Sbjct: 270 KFIVLYTD 277

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 122/263 (46%), Gaps = 25/263 (9%)

Query: 529 SGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTK 588
           S  G    H+ +P  ++   +Y      GL N+G +CY+N +LQC+  T     +FL+  
Sbjct: 559 SPTGRKFNHSVLPNTKK---DYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNS 615

Query: 589 YEHY--FSRKYTNPNQLSKYFNVLFKKMYMNG------GCSVVPTGFLKACNALRPDFRI 640
           YE +   + K  +   L++YF  L   M+            V PT F  A  ++   FR 
Sbjct: 616 YEKHININSKLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR- 674

Query: 641 PHDQQDTQEFLLFLLSQLHDELSESNRVANDYP----GXXXXXXXXXXXXXXEYDTWFEK 696
             +QQD QEF  FLL  LH++L   N+  N+ P                        +E+
Sbjct: 675 NTNQQDCQEFCQFLLDGLHEDL---NQCGNNPPLKELSEEAEKKRELLSLRIASSIEWER 731

Query: 697 HISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLE 756
            ++ N  S I ++FQGQ  + L C  C ++S  Y  F VLS+ +P+ T     +  V L 
Sbjct: 732 FLTTN-FSVIIDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPTGT-----KSSVNLM 785

Query: 757 DCINLFTSDEQLTNENAWDCPKC 779
           DC N FT  E+L ++  W+CP C
Sbjct: 786 DCFNEFTKCEKLEHDEYWNCPTC 808

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (48%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVL-----KNEQI---------------- 894
           LP  L IHL RF   + K N K+I YP  L +       K++++                
Sbjct: 823 LPRNLIIHLKRFDNRMNK-NTKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPARGQIP 881

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY LYA+ANHFG+L  GHYTS VNK L        + WYYFDD+  +       +   
Sbjct: 882 PFKYSLYAVANHFGSLYGGHYTSYVNKGLS-------RGWYYFDDQNYR-------LVKK 927

Query: 954 ITSISSSDVYVLFYEKI 970
            + + +S+ YVLFY ++
Sbjct: 928 TSEVVNSNAYVLFYRRV 944

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 113/243 (46%), Gaps = 25/243 (10%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFK 612
           I GL N+G +CY+N ++QC+  T     +FL+  YE +   S +  +   L+K F  L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 613 KMYMNGGCSVV------------PTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660
            MYM+   S +            P  F  AC ++   FR    QQD+QEF  FLL  LH+
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLDGLHE 722

Query: 661 ELSESNRVANDYP----GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMEN 716
           +L   N+   + P                        +E++++ +  S I ++FQGQ  +
Sbjct: 723 DL---NQCGGNPPLKELSLEAERLRENLSLRIASSIEWERYLTTD-FSVIVDLFQGQYAS 778

Query: 717 GLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDC 776
            L C+ C H+S  Y  F VLS+ +P       Q +K+ L DC N FT  E L  +  W C
Sbjct: 779 RLECKVCHHTSTTYQSFSVLSVPLPKKFD--PQTRKIDLIDCFNEFTKIENLEVDEQWSC 836

Query: 777 PKC 779
           P C
Sbjct: 837 PTC 839

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 65/136 (47%), Gaps = 36/136 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------LKNE-----QI-- 894
           LP  L IHL RF  ++  KNN  I YP  L +               + NE     QI  
Sbjct: 854 LPRNLIIHLKRF-DNMLNKNNSFIDYPFNLDLTEFWADDFDGNLPPGVSNELPARGQIKP 912

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             YRLY +A HFG+L  GHYT+ V+K + +        WYYFDD T +   N  +     
Sbjct: 913 FNYRLYGVACHFGSLYGGHYTAYVDKGIGNG-------WYYFDDTTYRPLKNDKE----- 960

Query: 955 TSISSSDVYVLFYEKI 970
             ISSS  YVLFY ++
Sbjct: 961 -PISSS-AYVLFYTRV 974

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 17/95 (17%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S +  ++LMR       D+LL+ID+R    F  +HI + N++ ++P    +        S
Sbjct: 187 STIQLNELMRNF----NDSLLIIDIRSRSEFIKSHIKSKNIICIEPISFKDS------YS 236

Query: 358 DVQLER----TLDN---KLLNARSQFEYIVYYTDM 385
           D +LER    T  N   +L N R  F++IV YT++
Sbjct: 237 DYELERKSIITSPNNEIRLFNNRQSFKFIVLYTEI 271

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 115/240 (47%), Gaps = 28/240 (11%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKK 613
            GL N G +CY++ ++QCL  T+    +FL+  Y+++   + +  +   L++YF+ L  +
Sbjct: 488 VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQ 547

Query: 614 MYMNG----------GCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
           MY  G            +V+PT F  AC ++   F+  + QQD QEF  FLL  LH++L 
Sbjct: 548 MYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL- 605

Query: 664 ESNRVANDYP----GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLF 719
             N+  N+ P                        +E++++ +  S I ++FQGQ  + L 
Sbjct: 606 --NQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTD-FSVIVDLFQGQYASQLQ 662

Query: 720 CQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           C+ C  +S  Y  F VLS+ +PS+       +   L DC   FT  E L  E  W CP C
Sbjct: 663 CKVCQRTSTTYQPFSVLSVPVPST-------RTCTLTDCFTEFTKIETLEQEEQWSCPSC 715

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 46/103 (44%), Gaps = 28/103 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV----------LKNEQI----------M 895
           LP  L IHL RF  ++  KNN  ++YP +L +           + N  +           
Sbjct: 730 LPRNLIIHLKRF-DNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPSRGQVPPF 788

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDD 938
            Y+LY IA H G L +GHYT+ VNK            W Y+DD
Sbjct: 789 NYQLYGIACHDGTLRAGHYTAYVNKG-------AVLGWCYYDD 824

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  111 bits (277), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 115/240 (47%), Gaps = 28/240 (11%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKK 613
            GL N G +CY++ ++QCL  T+    +FL+  Y+++   + +  +   L++YF+ L  +
Sbjct: 486 VGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQ 545

Query: 614 MYMNGG----------CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
           MY  G            +V+P  F  AC ++   FR    QQD QEF  FLL  LH++L 
Sbjct: 546 MYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHEDL- 603

Query: 664 ESNRVANDYP----GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLF 719
             N+  N+ P                        +E++++ +  S I ++FQGQ  + L 
Sbjct: 604 --NQCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTD-FSVIVDLFQGQYASQLR 660

Query: 720 CQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           C+ CG +S  Y  F VLS+ +PSS       ++  + DC   FT  E L  +  W CP C
Sbjct: 661 CKVCGRTSTTYQPFSVLSVPVPSS-------RQCTIIDCFTEFTKVETLDLDEQWSCPDC 713

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 60/139 (43%), Gaps = 36/139 (25%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-----------VLKNEQI---------- 894
           LP  L IHL RF  ++  KNN  ++Y  +L++           V+ N  +          
Sbjct: 728 LPRNLIIHLKRF-DNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPSRGQVPP 786

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             Y+LY +A H G L  GHYT+ VNK            W Y+D      D N   I +  
Sbjct: 787 FNYQLYGVACHTGTLYGGHYTAYVNKG-------ATLGWCYYD------DTNWRQIRSSN 833

Query: 955 TSISSSDVYVLFYEKIDES 973
             I S + YVLFY +I  S
Sbjct: 834 EYI-SQNAYVLFYHRIHGS 851

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 98/249 (39%), Gaps = 28/249 (11%)

Query: 316 NLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL---DNK--LL 370
           ++LLID+R    F   HI   +L+ ++P       K S  + D+  +  +   DN+  L 
Sbjct: 176 SVLLIDIRPRVDFVNFHIKFESLICIEPVSF----KDSHSDIDIAKKSMITSPDNEIALF 231

Query: 371 NARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSN--KNLKCTPKVLL-GGYEQWKKF 427
             R +FEYI+ YT        +   Q V   L+   +  K+L  T  + L GG+  W   
Sbjct: 232 QERDKFEYIILYTQGSEKNDYNIHQQEVLVDLLINRSFQKSLYNTKILTLDGGFSSWSTA 291

Query: 428 LSKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTP 487
                +++     ++     NG  + ++  S+P+                   E    T 
Sbjct: 292 YPNLCESFQGDSVYI-----NGDTSSLSLQSMPQAAPQNKYNPIFQSMFSKNGEANDIT- 345

Query: 488 YNRAPFPTPLVQAQRADHFPA-----SSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPT 542
             R+P   PL Q  +    P+        N T   NE +  SVP    NG ++ +   P 
Sbjct: 346 --RSPLHFPLQQQSKLKRTPSFKDYFKGSNSTLTLNE-RPGSVPPQFQNG-FANYPETPK 401

Query: 543 IEQSPNEYV 551
           +  S NEY+
Sbjct: 402 LISS-NEYM 409

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 109/233 (46%), Gaps = 16/233 (6%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QC+  T     +FL   Y  + +   K  +   L+KYF  L   
Sbjct: 562 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 621

Query: 614 MY-----MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SN 666
           MY      +   S+ P  F  AC ++   F+    QQD QEF  FLL  LH++L++  SN
Sbjct: 622 MYKEQVDASKKISISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 680

Query: 667 RVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
               +                     W E+ ++ +  S I ++FQGQ  + L C+ CGH+
Sbjct: 681 PPLKELSQEAEARREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLKCKICGHT 738

Query: 727 SFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           S  Y  F VLS+ IP        + ++ +EDC   FT  E L  +  W CP C
Sbjct: 739 STTYQPFTVLSIPIPRKVP----QNEITIEDCFKEFTKCENLEVDEQWLCPHC 787

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 64/137 (46%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------LKNEQI------- 894
           LP  L IHL RF  +L  KNN  + YP +L +               + ++++       
Sbjct: 802 LPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPVRGQIP 860

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY LY +A HFG L  GHYT+ V K L       ++ W YFDD   K   N  D    
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPVKNKTD---- 909

Query: 954 ITSISSSDVYVLFYEKI 970
              +++S+ YVLFY ++
Sbjct: 910 ---VTNSNAYVLFYHRV 923

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 318 LLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDN-----KLLNA 372
           LLID+R    F  +HI + N++ ++P       K S  + D++ +  + +     KL  +
Sbjct: 210 LLIDIRSRLEFDKSHIASKNIICLEPISF----KISYSDHDLEKKSLITSPNNEIKLFQS 265

Query: 373 RSQFEYIVYYTD 384
           R+ F++I+ YTD
Sbjct: 266 RNLFKFIILYTD 277

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  110 bits (275), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 118/257 (45%), Gaps = 29/257 (11%)

Query: 542 TIEQSPNEYVA-LSI---TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS--R 595
           TI QS N Y   L +    GL N+G +CY+N ++QCL        +FL+  YE + +   
Sbjct: 717 TISQSSNGYTPDLDLDFKVGLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININS 776

Query: 596 KYTNPNQLSKYFNVLFKKMYMNGGCS-----------VVPTGFLKACNALRPDFRIPHDQ 644
           K  +   L+K F  L   MY NG  S           V P  F  AC ++   F+   +Q
Sbjct: 777 KLGSKGILAKSFARLVHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GSNQ 835

Query: 645 QDTQEFLLFLLSQLHDELSE--SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENG 702
           QD QEF  FLL  LH++L++  +N    +                     W E+ ++ + 
Sbjct: 836 QDCQEFCQFLLDGLHEDLNQCGANPPLKELSTEAERMREKLSLRIASSIEW-ERFLTTD- 893

Query: 703 ISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLF 762
            S I +++QGQ  + L CQ CG +S  Y  F VLS+ +P       + K + L DC N F
Sbjct: 894 FSVIIDLYQGQYASQLKCQVCGTTSTTYQTFSVLSVPVP-------KNKSIHLLDCFNEF 946

Query: 763 TSDEQLTNENAWDCPKC 779
           T  E L  +  W C +C
Sbjct: 947 TKTEFLGKDELWSCTEC 963

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 61/132 (46%), Gaps = 36/132 (27%)

Query: 856  LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
            LP  L IHL RF  ++  KNN  + YPLIL +                   +    QI  
Sbjct: 978  LPKNLIIHLKRF-DNMLHKNNVFVKYPLILDLTNYWANDFDGKLPPGVTEELPARGQIPP 1036

Query: 895  MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             KY L  +A H G+L  GHYT+ VNK L       K  WYYFDD TV + I +       
Sbjct: 1037 FKYELSGVALHMGSLYGGHYTAYVNKGL-------KNGWYYFDD-TVYRSIKYS------ 1082

Query: 955  TSISSSDVYVLF 966
            + + + + YVLF
Sbjct: 1083 SEMITQNAYVLF 1094

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 14/94 (14%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S +T   L  IL + D D+ LLID+R    F+ NHI + +++ ++P    N        S
Sbjct: 178 SHITSSVLATILQT-DPDSTLLIDVRTRHDFELNHIKSNSIICIEPISFKNN------YS 230

Query: 358 DVQLER----TLDN---KLLNARSQFEYIVYYTD 384
           DV +ER    T  N   ++   R  +++I+ YTD
Sbjct: 231 DVDIERKSLITSPNSEIEIFKNRENYKFIILYTD 264

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 109/233 (46%), Gaps = 16/233 (6%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QC+  T     +FL   Y  + +   K  +   L+KYF  L   
Sbjct: 563 VGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHM 622

Query: 614 MYM-----NGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SN 666
           MY      +   S+ P  F  AC ++   F+    QQD QEF  FLL  LH++L++  SN
Sbjct: 623 MYKKQVDSSKKDSISPIKFKLACGSVNSLFKTA-SQQDCQEFCQFLLDGLHEDLNQCGSN 681

Query: 667 RVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
               +                     W E+ ++ +  S I ++FQGQ  + L C+ C H+
Sbjct: 682 PPLKELSQEAETRRERLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLKCKTCNHT 739

Query: 727 SFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           S  Y  F VLS+ IP   S    + K+ +EDC   FT  E L  +  W CP C
Sbjct: 740 STTYQPFTVLSIPIPKKNS----QNKITIEDCFKEFTKCENLEIDEQWLCPHC 788

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 61/137 (44%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------LKNEQI------- 894
           LP  L IHL RF  +L  KNN  + YP +L +               + ++++       
Sbjct: 803 LPRNLIIHLKRF-DNLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDELPIRGQIP 861

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY LY +A HFG L  GHYTS V K L        + W YFDD   +   N  D    
Sbjct: 862 PFKYELYGVACHFGTLYGGHYTSYVKKGL-------SRGWLYFDDTKYRPAKNQTD---- 910

Query: 954 ITSISSSDVYVLFYEKI 970
                +S+ YVLFY ++
Sbjct: 911 ---AINSNAYVLFYHRV 924

 Score = 32.7 bits (73), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 294 LQKQSVVTCDQLMRILCSQDRD-----NLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWN 348
           +Q  S +T DQL  ++ S           LLID+R    F+ +HI   N++ ++P     
Sbjct: 181 MQTGSHITPDQLNSLIVSSTNSSSSQMETLLIDIRSRLEFKKSHIDFKNIICLEPISFKT 240

Query: 349 QNKGSPIESDVQLERTLDN-KLLNARSQFEYIVYYTD 384
                 +E    +    D  KL  +R+ F++I+ YTD
Sbjct: 241 SYSDRDLEKKSLITSPNDEIKLFQSRNLFKFIILYTD 277

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 119/268 (44%), Gaps = 33/268 (12%)

Query: 535 SKHTAIPTIEQSPNEYVALSI---TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEH 591
           S+H+   T+ QSP       +    GL N+G +CY+N ++QCL  T     +FL+  Y++
Sbjct: 499 SQHSQSQTLIQSPRASAQYDLDFSVGLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKN 558

Query: 592 Y--FSRKYTNPNQLSKYFNVLFKKMYMNGGC----------------SVVPTGFLKACNA 633
           +  F+ K  +   L+KYF+ L   MY                     +V P  F  AC  
Sbjct: 559 HINFNSKLGSKGVLAKYFSQLVHNMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGT 618

Query: 634 LRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SNRVANDYPGXXXXXXXXXXXXXXEYD 691
           +   FR    QQD QEF  FLL  LH++L++   N    +                    
Sbjct: 619 INSLFR-DCSQQDCQEFCQFLLDGLHEDLNQCGGNPRLKELSEEAEKIREKLSMRIASSI 677

Query: 692 TWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRK 751
            W E++++ +  S I ++FQGQ  + L CQ CG +S  Y  F VLS+ +PS        K
Sbjct: 678 EW-ERYLTTD-FSVIVDLFQGQYASQLKCQVCGRTSTTYQPFSVLSVPLPS-------LK 728

Query: 752 KVRLEDCINLFTSDEQLTNENAWDCPKC 779
              + DC   FT  E L  +  W CP C
Sbjct: 729 SCNILDCFQEFTKVETLEKDEQWSCPDC 756

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 63/136 (46%), Gaps = 37/136 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI------------------VLKNEQI--M 895
           LP  L IHL RF  ++  KNN  ++YP  L +                  +    Q+   
Sbjct: 771 LPRNLIIHLKRF-DNMMNKNNVFVSYPHTLDLTPFWANDFDGRLPPGVTELPTRGQVPPF 829

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQK-WYYFDDETVKKDINHGDIDAGI 954
            Y+LYA+A+H G L  GHYT+ V        +KG Q+ W YFDD   ++  +  +     
Sbjct: 830 SYKLYAVASHTGTLYGGHYTAYV--------HKGSQRGWCYFDDTNWRRSRSDNE----- 876

Query: 955 TSISSSDVYVLFYEKI 970
               +S+ YVLFY ++
Sbjct: 877 --CITSNAYVLFYHRV 890

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 19/141 (13%)

Query: 294 LQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGS 353
           ++    + C  L  ++ +    ++LLIDLR    F  +HI +P+++ ++P    +     
Sbjct: 156 IRNGQTIACQHLQNLMAA---SSVLLIDLRPRMEFIKSHIKSPSVICIEPISFKD----- 207

Query: 354 PIESDVQLER-------TLDNKLLNARSQFEYIVYYT--DMKTFMKLDFDYQLVFFQLIY 404
              SD+ L +         + +L + R  F++IV YT  D +T        +L+   L  
Sbjct: 208 -TYSDLDLAKKSMITSPNCEIELFSKRDTFQFIVLYTHEDGRTQYYKQQQLKLLDLLLSR 266

Query: 405 TSNKNL-KCTPKVLLGGYEQW 424
           + +K L K    +L GG+E+W
Sbjct: 267 SFDKPLDKVKVLILEGGFEEW 287

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  109 bits (272), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 112/237 (47%), Gaps = 25/237 (10%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QCL  T    ++FL+  YE +   + K  +   L+K+F  L  +
Sbjct: 515 VGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQ 574

Query: 614 MYMNGGC-------SVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
           M+ +          +V P  F  AC ++   FR    QQD+QEF  FLL  LH++L   N
Sbjct: 575 MHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL---N 630

Query: 667 RVANDYP----GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
           +   + P                        +E++++ +  S I ++FQGQ  + L C+ 
Sbjct: 631 QCGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRD-FSVIVDLFQGQYASQLRCKV 689

Query: 723 CGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           C H+S  Y  F +L+  +P + S +       L DC   FT  EQL  +  W CP C
Sbjct: 690 CNHTSTTYQPFSILAAPVPHAKSCY-------LLDCFKEFTKLEQLEKDEEWLCPYC 739

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 65/136 (47%), Gaps = 36/136 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
           LP  L IHL RF  +L  KNN ++ YP  L +                   +    Q+  
Sbjct: 754 LPRNLIIHLKRF-DNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELPSRGQVAP 812

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
            KY+LYA+A+H G+L  GHYT+ V+K     LNKG   WYYFDD   +            
Sbjct: 813 FKYKLYAVASHSGSLYGGHYTAYVDK----GLNKG---WYYFDDTGYRPMRTP------- 858

Query: 955 TSISSSDVYVLFYEKI 970
           T   +S+ YVLFY ++
Sbjct: 859 TECITSNAYVLFYHRV 874

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 14/98 (14%)

Query: 294 LQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGS 353
           L+    ++  +L  +L S DR N+LL+D+R    F+  HI A N++ ++P    +     
Sbjct: 148 LKTGGFISAKELEFLLKSDDR-NILLVDVRQRSEFEETHIKASNVICIEPISFKSS---- 202

Query: 354 PIESDVQLER-------TLDNKLLNARSQFEYIVYYTD 384
              +D++LE+        ++  +   R++F +++ YTD
Sbjct: 203 --YTDLELEKKSMITSPNVEIDIFKRRNEFTFVILYTD 238

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 115/445 (25%), Positives = 161/445 (36%), Gaps = 114/445 (25%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFK 612
           I GL N G  CY+N +LQCL  T     +FL   Y ++  F     +   L+K F  L +
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGSKGLLAKNFATLVR 504

Query: 613 KMYMNGG--------CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE 664
            M+ N            V    F K C  +   +     QQD QEF  FLL  LH++L++
Sbjct: 505 NMHRNSAFMPVNSRTTPVQTIQFKKICGHINSIYS-DSMQQDCQEFCQFLLDGLHEDLNQ 563

Query: 665 SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
           +    +                  +      +       S I ++FQGQ  + L CQ C 
Sbjct: 564 NGGKEHLKQLTEEEEQKREKMTIRKASALEWERFLLTDFSAIIDLFQGQYASRLQCQACD 623

Query: 725 HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSAS 784
            +S  Y  F VLS+ +P  T+         + DC   FT            C K G    
Sbjct: 624 RTSTTYQTFSVLSVPVPRITT-------CNILDCFREFTK-----------CEKLGIDEL 665

Query: 785 GTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXX 844
            + P   KK+      P T+                                        
Sbjct: 666 WSCPRCLKKQ------PSTKQ--------------------------------------- 680

Query: 845 XXXXXXXNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-----------VLKNEQ 893
                      LP  L I+L RF   + K NN  + YP  L +            + NE 
Sbjct: 681 ------LKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLDLTPYWARDFNHEAIVNED 733

Query: 894 I--------MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDI 945
           I         +YRLY +A H G+L  GHYTS V K         K+ WY+FDD ++ + I
Sbjct: 734 IPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKG-------PKKGWYFFDD-SIYRPI 785

Query: 946 NHGDIDAGITSISSSDVYVLFYEKI 970
              D         + + YVLFYE+I
Sbjct: 786 RFND------EFITPNAYVLFYERI 804

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 315 DNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTL-DNKLLNAR 373
           D LLLID+R    F   HI   N++ ++P    +      +E+   +  +  D  L + R
Sbjct: 161 DTLLLIDVRPRSDFTKAHIKCKNIICIEPVSFKDSFTDRQLENVSLITSSQSDIDLFSNR 220

Query: 374 SQFEYIVYYTDMK 386
           + F+YIV YTD +
Sbjct: 221 NMFKYIVLYTDAQ 233

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  108 bits (269), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 110/235 (46%), Gaps = 22/235 (9%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKKM 614
           GL N+G +CY+N ++QCL ++  F  +FL+  YE + +   K  +   L++ F  L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 615 YMNGG--------CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE-- 664
           Y  G           V P  F  AC ++   FR    QQD+QEF  FLL  LH++L++  
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDLNQCG 727

Query: 665 SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
           +N    +                     W E++++ +  S I + FQGQ  + L C+ CG
Sbjct: 728 ANPPLKELSPNAEKMREKLSLRIASSIEW-ERYLTTD-FSVIVDQFQGQYASQLRCKVCG 785

Query: 725 HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            +S  Y  F VLS+ +P       + K   + DC N FT  E L  +  W CP C
Sbjct: 786 GTSTTYQAFSVLSVPVP-------RGKSCNIIDCFNEFTKVENLETDELWACPHC 833

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 62/136 (45%), Gaps = 37/136 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
           LP  L IHL RF  ++  KNN  + YP +L +                   +    QI  
Sbjct: 848 LPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGVTEELPTRGQIPP 906

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             Y+L A+A HFG+L  GHYTS V        +KGK  W YFDD  ++   N  +     
Sbjct: 907 FNYKLNAVAAHFGSLYGGHYTSYV--------DKGKFGWRYFDDTKIRPLKNSYE----- 953

Query: 955 TSISSSDVYVLFYEKI 970
               +S+ YVLFY ++
Sbjct: 954 --CITSNAYVLFYHRV 967

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 55/135 (40%), Gaps = 14/135 (10%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S +  + L++I      D LL+ID+R    F+ +HI   N++ ++P           ++ 
Sbjct: 185 SAIQLNHLIQIY----NDTLLVIDVRPRMEFEESHIKCKNIICIEPVSFNESFTDLELQK 240

Query: 358 DVQLERTLDN-KLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSN-------KN 409
              +    D  K    +  F YIV  TD     +     QLV   L+   +       KN
Sbjct: 241 KSMITSPSDEVKTFAKKDTFNYIVICTDTDEKKQFYLHQQLVLLDLLMNKSFTKPMFQKN 300

Query: 410 LKCTPKVLLGGYEQW 424
           +K    +L  G++ W
Sbjct: 301 VKIF--ILEKGFKNW 313

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  107 bits (268), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 111/239 (46%), Gaps = 25/239 (10%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKK 613
            GL N+G +CY+N ++QCL  T     +FL   Y+++   + K  +   L+KYF+ L   
Sbjct: 495 VGLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHT 554

Query: 614 MY---------MNGG--CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
           M           N G   +V P  F  AC ++   FR    QQD QEF  FLL  LH++L
Sbjct: 555 MQQQAASASTKQNSGDKTAVQPLHFKVACGSINSLFR-SSSQQDCQEFCQFLLDGLHEDL 613

Query: 663 SE--SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFC 720
           ++   N    +                     W E++++ +  S I ++FQGQ  + L C
Sbjct: 614 NQCGGNPALKELSEEAEGIREKLCMRIASSIEW-ERYLTTD-FSVIVDLFQGQYASQLTC 671

Query: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           + CG +S  Y  F VLS+ +PS +       K  + DC   FT  E L  +  W CP+C
Sbjct: 672 KVCGRTSTTYQPFSVLSVPVPSGS-------KCDIIDCFKEFTKVETLEKDEQWSCPRC 723

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 62/134 (46%), Gaps = 35/134 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI------------------VLKNEQI--M 895
           LP  L IHL RF  +L  KNN  ++YP  L +                  +    Q+   
Sbjct: 738 LPRNLVIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAELPTRGQVPPF 796

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
            Y LYA+A HFG L  GHYTS V+K         K  W YFDD + +K  + G+      
Sbjct: 797 NYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRKAKSQGE----CI 845

Query: 956 SISSSDVYVLFYEK 969
           ++S+   YVLFY +
Sbjct: 846 TLSA---YVLFYHR 856

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 67/150 (44%), Gaps = 24/150 (16%)

Query: 299 VVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESD 358
            ++  +L  +L +Q   N LLIDLR   +F  +HI    ++ ++P    +        SD
Sbjct: 163 AISPSELQSLLGAQ---NALLIDLRPRIKFVESHIKTDKIMCIEPISFKDSY------SD 213

Query: 359 VQLER----TLDN---KLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSN--KN 409
            ++ R    T  N   +L   R +F+YIV YTD     +     Q     L+   +  K 
Sbjct: 214 TEITRRSLITSPNEEVQLFQERDKFDYIVIYTDEHDRTQFCKQKQASLVDLLVNRSFEKP 273

Query: 410 LKCTPKVLL-GGYEQWKKFLSKSSQAYCDK 438
           L+ T  + L GG+E W +     ++  CDK
Sbjct: 274 LQRTIILTLQGGFENWCR-----NRGPCDK 298

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  103 bits (258), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 127/295 (43%), Gaps = 49/295 (16%)

Query: 524 SVPALSGNGNYSKHTAIPTIEQSPNEYVALSIT----------------------GLRNI 561
           S PA+S   N    +A P+ ++SP+     +++                      GL N+
Sbjct: 2   SPPAVSAFANGDGQSAFPSYKKSPSPLKETTLSSGPLQNHSMNSSLVKRGLNINVGLVNL 61

Query: 562 GCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKKMYM--- 616
           G +CY+N ++QCL  T+    +FL   Y+++   + +  +   L+KYF+ L   M     
Sbjct: 62  GNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNMQQQAI 121

Query: 617 ----------NGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE-- 664
                     N   +V P  F  AC ++   F+    QQD QEF  FLL  LH++L++  
Sbjct: 122 SASGRKSTSGNERNAVQPLHFKVACGSINSLFKTT-SQQDCQEFCQFLLDGLHEDLNQCG 180

Query: 665 SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
            N    +                     W E++++ +  S I ++FQGQ  + L C+ CG
Sbjct: 181 GNPALKELSEEAEAIREKLCMRIASSIEW-ERYLTTD-FSVIVDLFQGQYASQLMCKVCG 238

Query: 725 HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            +S  Y  F VLS+ +P          +  L DC   FT  E L  +  W CP+C
Sbjct: 239 RTSTTYQPFSVLSVPVPRGA-------RCNLLDCFEEFTKIETLEKDEQWSCPRC 286

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 57/134 (42%), Gaps = 35/134 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV--------------------LKNEQIM 895
           LP  L IHL RF  +L  KNN  ++YP  L +                            
Sbjct: 301 LPRNLIIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGVAELPTRGQTPPF 359

Query: 896 KYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
            Y LYA+A HFG L  GHYT+ VNK+        K  W YFDD   +K  +    D  IT
Sbjct: 360 HYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWRKAKSE---DECIT 409

Query: 956 SISSSDVYVLFYEK 969
               +  YVLFY +
Sbjct: 410 ----TSAYVLFYHR 419

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  105 bits (262), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 134/297 (45%), Gaps = 35/297 (11%)

Query: 512 NHTRDKN--EIQKHSVPALSGNGNY--SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYV 567
           N  R+K+   IQK  +   +G+ +     H  + T E+   EY    I GL+N+G +CY+
Sbjct: 702 NDEREKSPYNIQKLQIQNTAGSNDLIPHHHNNVTTHEK---EYDLDFIIGLQNMGNSCYL 758

Query: 568 NSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKKMY---------- 615
           N ++QCL  T     +FL+  +E Y   + K  +   L+K  + L   MY          
Sbjct: 759 NCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIHLMYNHSTLKNNGD 818

Query: 616 ----MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SNRVA 669
                +G   + P  F  AC ++   F+    QQD QEF  FLL  LH++L++  SN   
Sbjct: 819 KTKKKSGNNFIKPIQFRMACGSINNLFK-NCSQQDCQEFCQFLLDALHEDLNQCGSNPPL 877

Query: 670 NDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFN 729
            +                     W E++++ +  S I ++FQGQ  + L C+ C H+S  
Sbjct: 878 KELSTKAESMREKLSLRIASSIEW-ERYLTTD-FSVIVDLFQGQYASRLQCKTCIHTSTT 935

Query: 730 YSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
           Y  F VLS+ IP       ++K + L DC   FT  E L  +  W CP C +    T
Sbjct: 936 YQPFSVLSVPIP-------KKKNLNLLDCFKDFTKIENLEVDEQWFCPNCKSKQPST 985

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 63/136 (46%), Gaps = 36/136 (26%)

Query: 856  LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
            LP  L IHL RF  +   KNN +I YP IL +                   + K  QI  
Sbjct: 993  LPRNLIIHLKRF-DNNLNKNNNLIDYPFILDLTQFWADDFDGELPPGVTDELPKRGQIPP 1051

Query: 895  MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
             KYRLY  A HFG+L  GHYT+ VNK +       +  WYYFDD   +   N  +     
Sbjct: 1052 FKYRLYGAALHFGSLYGGHYTAFVNKGI-------RNGWYYFDDTNYRPIKNERE----- 1099

Query: 955  TSISSSDVYVLFYEKI 970
                SS+ YVLFY +I
Sbjct: 1100 --PISSNAYVLFYHRI 1113

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  103 bits (257), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 109/234 (46%), Gaps = 16/234 (6%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFK 612
           I GL+NIG +CY+N ++QCL  T     +FL+  YE +   + K  +   L+KYF  L  
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 613 KMYMNGGCS-----VVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--S 665
            M+ +         V P  F  A  ++   F+    QQD QEF  FLL  LH++L++  S
Sbjct: 618 LMHNHANPKLKNNYVRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQFLLDGLHEDLNQCGS 676

Query: 666 NRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGH 725
           N    +                     W E+ ++ +  S I ++FQGQ  + L C+ C H
Sbjct: 677 NPPLKELSSAAEKNREKLSLRIASSIEW-ERFLTTD-FSVIVDLFQGQYASRLQCEVCKH 734

Query: 726 SSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           +S  Y  F VLS+ IP       +  KV + DC   FT  E L  +  W CP C
Sbjct: 735 TSTTYQPFSVLSVPIPR----VPKGVKVNILDCFKDFTKLELLDTDEQWLCPTC 784

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 64/136 (47%), Gaps = 36/136 (26%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
           LP  L IHL RF  +   KNN  I YP IL +                   + K  QI  
Sbjct: 799 LPRNLIIHLKRF-DNNLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDELPKRGQIPP 857

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGI 954
            KY+LY +A+HFG+L  GHYT+ V+K   H        WYYFD      D N+  I    
Sbjct: 858 FKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFD------DTNYRSIKNKN 904

Query: 955 TSISSSDVYVLFYEKI 970
             I+SS  Y+LFY +I
Sbjct: 905 EPITSS-AYLLFYHRI 919

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 64/121 (52%), Gaps = 12/121 (9%)

Query: 291 LARLQKQSVVTCDQLMRILCSQ-DRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQ 349
           L  ++  S+++  QL ++L  + D  ++LLID+R    F  +HI    ++ V+P      
Sbjct: 156 LFSMKNGSLISSYQLKQLLYGKNDNTSVLLIDIRPRLEFSKSHIKHEEIICVEPISF--- 212

Query: 350 NKGSPIESDVQLERTLDN-----KLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIY 404
            K S  + +V  +  + +      L N R++FE+I+ YT+ K   K  ++ Q+VF +++ 
Sbjct: 213 -KDSYSDEEVAKKSLITSPNEEIDLFNKRNEFEFIILYTNDKE--KAYYNQQMVFLEILL 269

Query: 405 T 405
           T
Sbjct: 270 T 270

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 121/528 (22%), Positives = 201/528 (38%), Gaps = 80/528 (15%)

Query: 316 NLLLIDLRFSKRFQTNHILAPNLLNVDPTLL---WNQNKGSPIESDVQLERTLDNKLLNA 372
           ++L+ID+R    F   HI   N++ ++P      +   +   I      +  +D  L + 
Sbjct: 178 SILVIDIRPRSEFIKAHIKCKNIICIEPVSFKDSFTDQQVGKISLATSPQSEID--LFSN 235

Query: 373 RSQFEYIVYYTDMKTFMKLDFDYQLVFFQLI--YTSNKNLKCTPKVLLG-GYEQWKKFLS 429
           R  F+YIV YTD + +         +  +++  ++  K L  T  ++L  G+  W K L 
Sbjct: 236 RDTFKYIVLYTDTQLYGDFHQRQTRILTKILCQHSVLKPLGGTKVLILANGFSNWVK-LG 294

Query: 430 KSSQAYCDKDAFLYSSTNNGR--NAPVT-------SHSLPEHYXXXXXXXXXXXXXXXKT 480
            + Q++    A L SS++     N  V+       SHS P+                  T
Sbjct: 295 GAYQSFTPDPAQLTSSSSTPSFGNPRVSAELFNQRSHSPPKCKSPSLIVMNTQSQPLQVT 354

Query: 481 EEMTKTPYNRAPFPT-------------------PLVQAQRADH---FPASSQNHTRDKN 518
            +  + P      PT                   PL+   + +    FP       +   
Sbjct: 355 AQTPQLPLYYPEVPTISKSRPDKNSSAFQSLSSHPLIALPKVNSSSLFPTKVDGIEKLSA 414

Query: 519 EIQKHSV-PALSGNGNYSKHTAIPTIEQ--SPNEYVALS---------ITGLRNIGCTCY 566
            ++   + P L    N       P  +Q  SP ++   +         I GL N+G  CY
Sbjct: 415 NVRNQQIDPYLPSASNVIPPRIPPLPQQNLSPPKHAIFNNSQAFDLDFIVGLENMGNCCY 474

Query: 567 VNSMLQCLFATKAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKKMYMNGG----- 619
           +N +LQCL  T     +FL   Y ++  F     +   L+K +  L   M+ +G      
Sbjct: 475 MNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVHNMHRHGAFKPPH 534

Query: 620 ---CSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN-----RVAND 671
                V    F K C  +   +     QQD QEF  FLL  LH++L+++      +  ++
Sbjct: 535 SRTTPVQTLQFKKVCGHINSIYS-DSMQQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSE 593

Query: 672 YPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYS 731
                            E++ +     S      I ++FQGQ  + L CQ C H+S  Y 
Sbjct: 594 QEERMRESMSIRKASALEWERFLLTDFSA-----IIDLFQGQYASRLQCQACEHTSTTYQ 648

Query: 732 VFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            F VLS+ +P       + +   + DC   FT  E+L  +  W C KC
Sbjct: 649 TFSVLSVPVP-------RIRTCNILDCFREFTKCEKLGVDEQWSCSKC 689

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 61/134 (45%), Gaps = 34/134 (25%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV-----------LKNEQI--------MK 896
           LP  L I+L RF   + K NN  + YP  L +            + NE I         +
Sbjct: 704 LPKKLIINLKRFDNQMNK-NNVFVQYPCFLDLTPYWARDFNHESIVNEDIPTRGQIPPFR 762

Query: 897 YRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITS 956
           YRLY +A H G+L  GHYTS V         KG QK +YF D++V   I   D       
Sbjct: 763 YRLYGVACHSGSLYGGHYTSYV--------YKGPQKGWYFFDDSVYCPIRFND------E 808

Query: 957 ISSSDVYVLFYEKI 970
             + + YVLFYE+I
Sbjct: 809 FITPNAYVLFYERI 822

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 97.4 bits (241), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 113/254 (44%), Gaps = 23/254 (9%)

Query: 546 SPNEYVALSIT-GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSR--KYTNPNQ 602
           S N+ +  S T GL N+G +CY+N ++QC+FAT     +FL+  Y  + ++  K  +   
Sbjct: 514 SCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGV 573

Query: 603 LSKYFNVLFKKMYMNGGC--------SVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFL 654
           LS  F  L K MY             +V    F  AC ++   F+    QQD  EF  FL
Sbjct: 574 LSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFK-DASQQDCLEFCQFL 632

Query: 655 LSQLHDELSE--SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQG 712
           L  LH++L++  +N    +                     W E++++ +  S I ++FQG
Sbjct: 633 LDGLHEDLNQCGANPPLKELSPEAEKMRENLSLRVASSIEW-ERYLTTD-FSIIVDLFQG 690

Query: 713 QMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNEN 772
           Q  + L C+ C  +S  Y  F VLS+ +PS        K   L DC   FT  E L  + 
Sbjct: 691 QYASQLRCKVCNRTSTTYQAFSVLSVPVPSG-------KSCGLLDCFIEFTKTENLEVDE 743

Query: 773 AWDCPKCGTSASGT 786
            W CP C      T
Sbjct: 744 QWFCPSCKKKQPST 757

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 60/137 (43%), Gaps = 38/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSI-------------------VLKNEQI-- 894
           LP  L IHL RF  ++  KNN  + YP IL +                   +    Q+  
Sbjct: 765 LPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGITDEIPARGQVPP 823

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQK-WYYFDDETVKKDINHGDIDAG 953
             YRLY  A HFG L  GHYTS V        +KG +K W YFDD TV + +   +    
Sbjct: 824 FNYRLYGAACHFGTLYGGHYTSYV--------DKGPEKGWIYFDD-TVYRPVRFQN---- 870

Query: 954 ITSISSSDVYVLFYEKI 970
                S   YVLFY +I
Sbjct: 871 --EFISPSAYVLFYHRI 885

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 14/96 (14%)

Query: 298 SVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES 357
           S ++C +L+ ++     D+LLLID+R    +  +HI   N++ ++P             S
Sbjct: 188 SGISCSELLSLM-KMKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKES------YS 240

Query: 358 DVQLERTL-------DNKLLNARSQFEYIVYYTDMK 386
           D Q+E+T        + +L   RS+F+YI+ YTD++
Sbjct: 241 DQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 124/515 (24%), Positives = 192/515 (37%), Gaps = 73/515 (14%)

Query: 315 DNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIES-DVQLERTLDNKLLNAR 373
           D  LL+D+R    F   HI   +++ +DP    +    + +E   +     L+ +L + R
Sbjct: 163 DAFLLVDVRPRPEFIKAHIKCKHIMCIDPASFKDSYTDTLVERVSLAASPQLEIELFSKR 222

Query: 374 SQFEYIVYYTDMKTFMKLDFD-YQLVFFQLIYTSNKNLKCTPKVLLGGYEQWKK----FL 428
           + F+ IV YTD  T ++ DF   Q      I T +   K +  +L  G+  W K    F 
Sbjct: 223 NTFKNIVLYTD--TQLQGDFQQRQTRILANILTRHSVAKVS--ILENGFSNWVKLGGAFS 278

Query: 429 SKSSQAYCDKDAFLYSSTNNGRNAPVTSHSLPEHYXXXXXXXXXXXXXXXKTEEMTKTPY 488
           +   Q      +     T+ G  +   S S P+                  T +  + P 
Sbjct: 279 TGQPQLASLSSSVSSPRTSAGLFS-QNSRSPPKGKSPTLVSMKAQSQPLQATLQTPQVPL 337

Query: 489 NRAPFPTPLVQAQRADHF-PASSQNHTRDKNEI--------------QKHSVPALSGNGN 533
                PT         HF   SS  HT   + +              + +S+ ALS    
Sbjct: 338 YYPEVPT-------LSHFNKDSSALHTLSPHPLIAVPKEKPSTFVHGKVNSIEALSPGPQ 390

Query: 534 YSKHTAIPT-IEQSPNEYVALS---------------ITGLRNIGCTCYVNSMLQCLFAT 577
             +   IP  I   P + + +S               I GL N+G  CY+N +LQCL  T
Sbjct: 391 LPQANVIPPRIPPLPQQNLLVSKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGT 450

Query: 578 KAFRDLFLSTKYEHY--FSRKYTNPNQLSKYFNVLFKKMYMNGG--------CSVVPTGF 627
                +FL   Y ++  F     +   L+K F  L   M+ +G           V    F
Sbjct: 451 HDLTRMFLDNTYLNFINFDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQF 510

Query: 628 LKAC---NALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXX 684
            K C   N++  D      QQD QEF  FLL  LH++L+++    +              
Sbjct: 511 KKTCGHINSIYSDSM----QQDCQEFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTREN 566

Query: 685 XXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSST 744
               +      +       S + ++FQGQ  + L CQ C H+S  Y  F VLS+ +P   
Sbjct: 567 MSIRKASALEWERFLLTDFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRIM 626

Query: 745 STFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           +         + DC   FT  E+L     W C +C
Sbjct: 627 T-------CNVLDCFREFTKCEKLGIGEQWSCSRC 654

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 34/134 (25%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIV------LKNEQIM-------------K 896
           LP  L I+L RF   +  KNN  + YP  L +         +E I+             +
Sbjct: 669 LPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIIDEDIPTRGQIPPFR 727

Query: 897 YRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITS 956
           YRLY +A H G+L  GHYTS V         KG QK +YF D+T+ + I   +       
Sbjct: 728 YRLYGVACHSGSLYGGHYTSYV--------YKGPQKGWYFFDDTIYRLIRFNN------E 773

Query: 957 ISSSDVYVLFYEKI 970
             + + YVLFYE+I
Sbjct: 774 FITPNAYVLFYERI 787

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 116/523 (22%), Positives = 204/523 (39%), Gaps = 68/523 (13%)

Query: 300 VTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDV 359
           +T  QL  IL S  + ++LLID+R    F+ +HI +  +L +DP          P  +  
Sbjct: 160 LTVPQLQTIL-SDQKISVLLIDVRKRYEFEFSHINSVAVLPLDPISF------KPTYTID 212

Query: 360 QLERTL-------DNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTSNKNLKC 412
           QLE+         + +L   R++++ IV YT         +   +    ++     +   
Sbjct: 213 QLEKISFINSPMHELQLFQKRNEYDVIVLYTKDNDITAYYYKQMMSLLAILLNHLHHHHH 272

Query: 413 T--------PKVLL--GGYEQWKKFLSKSSQAYCDKDAFLYSSTNNGR----NAPVTS-- 456
                    PK+L   GG+ +W   +SKS       D +  ++ N+        PVT+  
Sbjct: 273 HHHHHNIKYPKILFLKGGFSEWVSHVSKSEIVSNLSDGYKNNNNNSNNIPCIKRPVTTSP 332

Query: 457 HSLPEHYXXXXXXXXXXXXXXXKTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRD 516
           H +P                        +  Y   P   P++   + +    +++N    
Sbjct: 333 HQIP--------ISMVGSAPQPPQIPPPRNIYPSPPQTIPII---KNNANVTNAKNLITP 381

Query: 517 KNEIQKHSVP--------ALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVN 568
           +  +   S+P          S          +    +S  +Y    I GL N+  +CY+N
Sbjct: 382 QGIMTNRSIPDAIVTAIPTPSPPPLPRIPMKVGGTNESIWKYNPTIIIGLENMSNSCYMN 441

Query: 569 SMLQCLFATKAFRDLFLSTKYEHYFS--RKYTNPNQLSKYFNVLFKKMY---MNGGCS-- 621
            ++QCL +      + L+  +  + +   K  +   + K+F  L + M+   +  G S  
Sbjct: 442 CIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQDMHSQQVKTGRSLF 501

Query: 622 ---VVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE--SNRVANDYPGXX 676
              V    F  AC ++   +     QQD QEF  FLL  LH++L++   N  A +     
Sbjct: 502 SYPVKTIDFKNACASVSSIYS-GSQQQDCQEFCEFLLDGLHEDLNQCGGNPPARELTDQE 560

Query: 677 XXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVL 736
                           W  ++   N  S I ++F GQ  + L C  C ++S  Y  F +L
Sbjct: 561 ERLREGLCMRVASSMAW--ENFLHNNFSLIIDLFAGQYGSQLRCCVCQYTSTTYQPFTLL 618

Query: 737 SLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           S+ +P S    S+  +  + DC   FT  E+L  +  W CP+C
Sbjct: 619 SVPVPLS----SRVSRCSIIDCFQEFTKCERLDKDEEWFCPQC 657

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 61/137 (44%), Gaps = 37/137 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLIL--------------------SIVLKNEQI- 894
           LP  L IH  RF  ++  KNN  I YP  L                    S++ K  Q+ 
Sbjct: 672 LPKNLIIHFKRF-DNMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGMTNSLLTKGGQVG 730

Query: 895 -MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953
             KY+L A+A H G L SGHYT+ VNK  D         WYYFDD + +       I   
Sbjct: 731 PFKYQLNAVACHMGTLGSGHYTAYVNKGPD-------VGWYYFDDSSHR-------IVKI 776

Query: 954 ITSISSSDVYVLFYEKI 970
            T   + D Y+LFY ++
Sbjct: 777 ATEYMNPDAYLLFYHRV 793

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 116/261 (44%), Gaps = 47/261 (18%)

Query: 520 IQKHSVPALSGNGNYSKHTAIPT---IEQSPNE--------YVAL-------SITGLRNI 561
           I+K  +PA+ GN    K T+ P+   IE  P E        Y A          TGL N+
Sbjct: 311 IKKLLIPAMFGN-RLDKITSNPSDLVIEIKPIEGHHHWASNYFAYNKLEPASGTTGLVNL 369

Query: 562 GCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLFKKMY-- 615
           G TCY+NS LQCL      RD FL   YE+  + +  NP      +++ F+ L +K++  
Sbjct: 370 GNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEE--NPLGYHGYVARAFSDLIQKIFQN 427

Query: 616 ----MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNR-VAN 670
               M    +  P+ F          F   + QQD+QEFL FLL  LH++L   NR +  
Sbjct: 428 RLSVMQRNGAFPPSMFKSTVGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDL---NRIIKK 483

Query: 671 DY-------PGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRC 723
           +Y       PG                DTW E H+  N  S I ++F G  ++ L+C  C
Sbjct: 484 EYIEKPSLSPGDDVDDWNVVKKLAD--DTW-EMHLKRN-CSVITDLFVGMYKSTLYCPEC 539

Query: 724 GHSSFNYSVFYVLSLAIPSST 744
            + S  +  +  ++L +P  T
Sbjct: 540 KNVSITFDPYNDVTLPLPVDT 560

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 53/120 (44%), Gaps = 25/120 (20%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLILSIVLKNEQIMK-------YRLYAIANHFG 907
            P +L IHL RF      + K +  + +P I  + L    + K       Y LYA+ NH+G
Sbjct: 1000 PDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSKNVVYKDDPRGSIYDLYAVDNHYG 1058

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+ V        N    KWYYFDD  V + +    I        +   Y+LFY
Sbjct: 1059 GLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPENSI--------AGSAYLLFY 1103

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 748 SQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           ++ + + L+DC+ LF+  E L   ++W CP C
Sbjct: 953 AKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 78.2 bits (191), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 96/211 (45%), Gaps = 28/211 (13%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYF 607
           A   TGL N+G TCY+NS LQCL      RD FL   YE   + +  NP      +++ F
Sbjct: 360 ASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEE--NPLGYHGYVARAF 417

Query: 608 NVLFKKMY------MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDE 661
           + L +K++      M    +  P+ F          F   + QQD+QEFL FLL  LH++
Sbjct: 418 SDLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHED 476

Query: 662 LSESNR-VANDY-------PGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQ 713
           L   NR +  +Y       PG                DTW E H+  N  S I ++F G 
Sbjct: 477 L---NRIIKKEYTEKPSLSPGDDVNDWNVVKKLAD--DTW-EMHLKRN-CSVITDLFVGM 529

Query: 714 MENGLFCQRCGHSSFNYSVFYVLSLAIPSST 744
            ++ L+C  C + S  +  +  ++L +P  T
Sbjct: 530 YKSTLYCPECQNVSITFDPYNDVTLPLPVDT 560

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLI---LS--IVLKNE-QIMKYRLYAIANHFGN 908
            P +L IHL RF      + K +  + +P+    LS  +V K++ + + Y LYA+ NH+G 
Sbjct: 1004 PDILLIHLKRFESQRSFSDKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLYAVDNHYGG 1063

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+ V        N    KWYYFDD  V +        A   SI+ S  Y+LFY
Sbjct: 1064 LGGGHYTAYVK-------NFADNKWYYFDDSRVTE-------TAPENSIAGS-AYLLFY 1107

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 20/32 (62%)

Query: 748 SQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           ++ + + L+DC+ LF+  E L   ++W CP C
Sbjct: 957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 94/204 (46%), Gaps = 22/204 (10%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLF 611
           TGL N+G TCY+NS LQCL      RD FL   YE   + +  NP      +++ F+ L 
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEE--NPLGYHGYVARAFSDLV 421

Query: 612 KKMYMNGGCSV-----VPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
           +K++ N   S+      P    K+           + QQD+QEFL FLL  LH++L   N
Sbjct: 422 QKLFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDL---N 478

Query: 667 RVAN----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQMENGLFC 720
           R+      + P               +   DTW E H+  N  S I ++F G  ++ L+C
Sbjct: 479 RIIKKAYIEKPSLSPDDDVNDWNVVKKLADDTW-EMHLKRN-CSVITDLFVGLYKSTLYC 536

Query: 721 QRCGHSSFNYSVFYVLSLAIPSST 744
             C + S  +  +  ++L +P  T
Sbjct: 537 PECKNVSITFDPYNDVTLPLPVDT 560

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 54/120 (45%), Gaps = 25/120 (20%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLILSIVLKNEQIMK-------YRLYAIANHFG 907
            P +L +HL RF      + K +  + +P + ++ L    + K       Y LYA+ NH+G
Sbjct: 1006 PDILLVHLKRFESQRSFSDKIDATVNFP-VTALDLSKHVVHKDDPRGSIYDLYAVDNHYG 1064

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+ V        N    KWYYFDD  V + +    I        S   Y+LFY
Sbjct: 1065 GLGGGHYTAYVK-------NFADSKWYYFDDSRVTETVPENSI--------SGSAYLLFY 1109

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 90/209 (43%), Gaps = 26/209 (12%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKK 613
            ITGL N+G TCY+NS LQCL      RD FL   +E   +    NP     Y    F  
Sbjct: 291 GITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEIN--CNNPLGYQGYVARAFSG 348

Query: 614 MYMN-GGCSVV-----------PTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDE 661
           +  N  GC  +           PTGF          F   + QQD+QEF+ FLL  LH++
Sbjct: 349 LVQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFNSMFS-GYMQQDSQEFITFLLDGLHED 407

Query: 662 LSESNRVAN----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQME 715
           L   NR+ +    + P                   DTW + H+  N  S I ++F G  E
Sbjct: 408 L---NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTW-KLHLQRND-SVITDLFVGLYE 462

Query: 716 NGLFCQRCGHSSFNYSVFYVLSLAIPSST 744
           + L C  C + S  +  +  L+L +P +T
Sbjct: 463 STLQCPECNNVSITFDPYNDLTLPLPVNT 491

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 55/119 (46%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRF--FYDLTKKNNKVITYPLI---LSIVLKNEQIMK---YRLYAIANHFGN 908
            P VL IHL RF      + K ++V+ +P+    +S  L N+   +   Y L A+ NH+G 
Sbjct: 922  PDVLLIHLKRFENLRSFSDKIDEVVHFPITGLDMSPYLVNKGDPRGTIYDLVAVDNHYGG 981

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+          N    KWYYFDD  V +      I        +S  Y+LFY
Sbjct: 982  LGGGHYTAYAK-------NVDDSKWYYFDDSRVTETTPERGI--------ASSAYLLFY 1025

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
           + KK+ L DC+ LF+  E L   ++W CP C      T
Sbjct: 876 EEKKITLHDCLKLFSKREVLGMNDSWYCPSCKEHRQAT 913

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 98/218 (44%), Gaps = 33/218 (15%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSR-KYTNP----NQLSKYFN 608
            ITGL N+G TCY+NS LQCL      RD FL   Y+ + S     NP      ++K F+
Sbjct: 300 GITGLTNLGNTCYMNSALQCLVHIPELRDYFL---YDGFTSEINSDNPLGYQGNIAKAFS 356

Query: 609 VLFKKMYMNGGCSVVPTGF--------LKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660
           +L K ++     S     F        +  CN +   +     QQD+QEFL FLL  LH+
Sbjct: 357 LLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDGLHE 412

Query: 661 ELSESNRVANDYP-------GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQ 713
           +L   NRV +D P                        DTW + H+  N  S + ++F   
Sbjct: 413 DL---NRV-HDKPYIEKPSLSPNSDVTDRDTIKKLAEDTW-KMHLLRND-SIVTDLFVAL 466

Query: 714 MENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRK 751
            E+ L C  C + S  +  +  L+L +P +T+  S+ K
Sbjct: 467 YESTLECPECRNVSITFDPYNDLTLPLPVNTTWHSKVK 504

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 56/126 (44%), Gaps = 24/126 (19%)

Query: 855  SLPTVLTIHLSRFF--YDLTKKNNKVITYP-----LILSIVLKNEQIMKYRLYAIANHFG 907
            S P VL IHL RF      + K +  + +P     +   +V ++ +   Y L A+ NHFG
Sbjct: 910  STPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIAVDNHFG 969

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+ V         K   KW+YFDD  V +      I        +   Y+LFY
Sbjct: 970  GLGGGHYTAYV---------KTNDKWFYFDDSRVTETKPESSI--------AGSAYLLFY 1012

Query: 968  EKIDES 973
             +  ES
Sbjct: 1013 LRRTES 1018

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           +++ + L DC+ LF+  E L+  ++W CP C
Sbjct: 866 EKRAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/209 (30%), Positives = 94/209 (44%), Gaps = 24/209 (11%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYF 607
           A   TGL N+G TCY+NS LQCL      RD FL   YE   + +  NP      +++ F
Sbjct: 357 ASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEE--NPLGYHGYVARAF 414

Query: 608 NVLFKKMY------MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDE 661
           + L +K++      M    +  PT F          F   + QQD+QEFL FLL  LH++
Sbjct: 415 SDLIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHED 473

Query: 662 LSESNRVAN----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQME 715
           L   NR+      + P               +   DTW E H+  N  S I ++F G  +
Sbjct: 474 L---NRIIKKAYIEKPSLSPDDDVNDWNVIKKLADDTW-ELHLKRNR-SVITDLFVGMYK 528

Query: 716 NGLFCQRCGHSSFNYSVFYVLSLAIPSST 744
           + L+C  C   S  +  +  ++L +P  T
Sbjct: 529 STLYCPECKDVSTTFDPYNDVTLPLPVDT 557

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 55/120 (45%), Gaps = 25/120 (20%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLILSIVLKNEQIMK-------YRLYAIANHFG 907
            P +L IHL RF      + K +  + +P I  + L    + K       Y LYA+ NH+G
Sbjct: 1003 PDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDLYAVDNHYG 1061

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+ V   +D+       KWYYFDD  V + +    +        +   Y+LFY
Sbjct: 1062 GLGGGHYTAYVKNFMDN-------KWYYFDDSRVTETVPENSV--------AGSAYLLFY 1106

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 90/198 (45%), Gaps = 15/198 (7%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLFK 612
           GL N+G TCY+NS LQCL      RD FL   +E   +    NP      +++ F +L +
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEIN--LDNPLGYQGHVARSFAILIQ 400

Query: 613 KMYMN---GGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE-SNRV 668
            ++ +      S  PT F          F   + QQD+QEF+ FLL  LH++L+  +N+ 
Sbjct: 401 NLFKDELLPSLSYSPTTFKSTVGHFNSMFS-GYLQQDSQEFIAFLLDGLHEDLNRITNKP 459

Query: 669 ANDYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
             + P               +   DTW   H+  N  S I +IF G  ++ L C  C + 
Sbjct: 460 VVEKPSLKPEDDVSNQEVIKKLADDTW-NSHLLRND-SIITDIFVGLYKSTLHCPECDNL 517

Query: 727 SFNYSVFYVLSLAIPSST 744
           S  +  +  L+L +P  T
Sbjct: 518 SVTFDPYNDLTLPLPVDT 535

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 56/121 (46%), Gaps = 23/121 (19%)

Query: 855  SLPTVLTIHLSRFF--YDLTKKNNKVITYPLI---LSIVLKNEQIMK---YRLYAIANHF 906
            S P +L IHL RF      + K +  + +P+    LS  + N    K   Y L ++ NH+
Sbjct: 949  STPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLVSVDNHY 1008

Query: 907  GNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLF 966
            G L  GHYT+ V   +D       +KWYYFDD  V + +    I        +   Y+LF
Sbjct: 1009 GGLGGGHYTAYVKNFVD-------KKWYYFDDSRVTETVPERSI--------AGSAYLLF 1053

Query: 967  Y 967
            Y
Sbjct: 1054 Y 1054

 Score = 38.5 bits (88), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 750 RKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
            KK+ L+DC+NLF   E L   ++W CP C      T
Sbjct: 906 EKKITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQAT 942

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 98/214 (45%), Gaps = 32/214 (14%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLFK 612
           GL N+G TCY+NS LQCL      RD F+   +E   +    NP      +++ F+ L +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEIN--VNNPLGFQGHMARSFHGLIQ 379

Query: 613 KMYMNGGCS----VVPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSES 665
            ++ +        V PT F   L   N++   F+    QQD+QEFL FLL  LH++L   
Sbjct: 380 SLFGDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ----QQDSQEFLAFLLDSLHEDL--- 432

Query: 666 NRVAND--------YPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENG 717
           NR+            PG              E  TW + H+  N  S I +IF G  ++ 
Sbjct: 433 NRIVEKPYVEKPSLKPGDDINDFDTIKKLANE--TW-KSHLMRND-SIITDIFVGMYKST 488

Query: 718 LFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRK 751
           L C  C + S  +  +  L+L +P ++S  +Q +
Sbjct: 489 LECPECSNVSITFDPYNDLTLPLPINSSWNAQVR 522

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (47%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRF--FYDLTKKNNKVITYP---LILS--IVLKNE-QIMKYRLYAIANHFGN 908
            P V  IHL RF      + K +  I +P   L +S  +V K++ +   Y L A+ NH+G 
Sbjct: 935  PDVFLIHLKRFENTRSFSDKIDATILFPIEDLDMSEYLVYKDDPRGSVYDLIAVDNHYGG 994

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            +  GHYT+ V        N   Q WYYFDD  V K        +   SI+ S  Y+LFY
Sbjct: 995  MGGGHYTAYVK-------NLTDQNWYYFDDSRVSK-------TSPEKSIAGS-AYLLFY 1038

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 750 RKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            ++  L+DC+NLF+  E L   ++W CP C
Sbjct: 890 EQETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKY------EHYFSRKYTNPNQLSKYFNVL 610
           GL N+G TCY+NS LQCL     F+D FL   Y      E+    K       +     L
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 611 FKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
           F K + +   S  P  F      L   F   + QQD+QEFL FLL  LH++L   NR+  
Sbjct: 407 FGKRH-SAATSYSPRNFKNTIGHLNSMFS-GYQQQDSQEFLAFLLDGLHEDL---NRIIE 461

Query: 671 ----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
               + P               +   DTW +  +  + +  I ++F G  ++ L C  C 
Sbjct: 462 KPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRNDSV--ITDLFVGLYKSTLICPVCK 519

Query: 725 HSSFNYSVFYVLSLAIPSSTSTFSQR 750
            +S  +  +  L+L +P + ST+S +
Sbjct: 520 KTSVTFDPYNDLTLPLPVN-STWSNK 544

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 58/125 (46%), Gaps = 24/125 (19%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYP-----LILSIVLKNEQIMK-YRLYAIANHFGN 908
            P +L IHL RF      + K    + +P     +   +V KNE     Y L A+ NH+G 
Sbjct: 1004 PDILLIHLKRFENQRSFSDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGG 1063

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
            L  GHYT+ V K++D        KWYYFDD  V + +    I        +   Y+LFY 
Sbjct: 1064 LGGGHYTAYV-KNID-------GKWYYFDDSRVSETLPERSI--------AGSAYLLFYR 1107

Query: 969  KIDES 973
            +  ES
Sbjct: 1108 RRVES 1112

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 16/91 (17%)

Query: 701 NGISPIDNIFQGQMENGLFCQ-------RCGHSSFNYS-----VFYVLSLAIPSSTSTFS 748
           +G +P+   FQ    N L C+          HSS  YS           L +       S
Sbjct: 902 SGPAPLLVDFQ----NALICEWKSEKYEEVFHSSVPYSWERPDTLRNEELEVIREKRRAS 957

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
             KK+ L DC+ LF++ E L   ++W CP C
Sbjct: 958 GEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 92/208 (44%), Gaps = 22/208 (10%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLF 611
            GL N+G TCY+NS LQCL     F+D FL   YE   +    NP      ++  F  L 
Sbjct: 349 VGLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEIN--VDNPLGHKGHIAWAFGTLI 406

Query: 612 KKMYM---NGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRV 668
           + ++    N   S  P  F      L   F   + QQD+QEFL FLL  LH++L   NR+
Sbjct: 407 QSLFGKRNNLISSYSPRHFKTTIGHLNSMF-AGYQQQDSQEFLAFLLDGLHEDL---NRI 462

Query: 669 AN----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
            +    + P               +   DTW +  +  + +  I ++F G  ++ L C  
Sbjct: 463 VDKPYVEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLFVGLYKSTLICPT 520

Query: 723 CGHSSFNYSVFYVLSLAIPSSTSTFSQR 750
           C   S  +  +  L+L +P   ST+S +
Sbjct: 521 CKKVSTTFDPYNDLTLPLPVD-STWSNK 547

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 23/125 (18%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLI---LS--IVLKNEQIMK-YRLYAIANHFGN 908
            P +L IHL RF      + K   ++ +P+    +S  +V K+++    Y L A+ NH+G 
Sbjct: 979  PDILLIHLKRFENQRSFSDKIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLIAVDNHYGG 1038

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
            L  GHYT+ V   LD+       KWYYFDD  V + +    I        +   Y+LFY 
Sbjct: 1039 LGGGHYTAYVKNFLDN-------KWYYFDDSRVNETVPERSI--------AGSAYLLFYR 1083

Query: 969  KIDES 973
            +  ES
Sbjct: 1084 RRTES 1088

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           + KK+ L DC+ LF++ E L   ++W CP C
Sbjct: 933 EEKKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 92/200 (46%), Gaps = 15/200 (7%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYF 607
           +L ITGL N+G TCY+NS LQC+     FR+ FL + YE   +    NP      +++ F
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTD--NPLGYQGHVAEAF 374

Query: 608 NVLFKKMYMNGGC---SVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSE 664
           + L + ++ +      +  P  F          F   + QQD+QEFL FLL  LH++L+ 
Sbjct: 375 SELIRCLFGDKLVQFSAYAPNHFKATIGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDLNR 433

Query: 665 SNR---VANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQ 721
            ++   V                      DTW + H+  N  S I ++F G  ++ L C 
Sbjct: 434 IDKKPYVEKPSLPSTADLNDFRIVKKLADDTW-KAHLLRND-SVITDLFVGLYKSTLECP 491

Query: 722 RCGHSSFNYSVFYVLSLAIP 741
            C + S  +  +  L+L +P
Sbjct: 492 ECQNISITFDPYNDLTLPLP 511

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 53/119 (44%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPLI-----LSIVLKNE-QIMKYRLYAIANHFGN 908
            P VL IHL RF      + K + V+ +P+        +V K++ +   Y L A+ NH+G 
Sbjct: 938  PDVLLIHLKRFENQQSFSDKIDDVVQFPITDFDISEHLVYKDDPRGNVYDLIAVDNHYGG 997

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+          N    KWYYFDD  V + +    I            Y+LFY
Sbjct: 998  LGGGHYTAYAK-------NSTDGKWYYFDDSRVTETVAENSITGA--------AYLLFY 1041

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
           + K++ L DC+NLF+  E L+  ++W CP C      T
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTCKEHRQAT 929

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/227 (29%), Positives = 98/227 (43%), Gaps = 34/227 (14%)

Query: 548 NEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQL 603
           N      I GL N+G TCY+NS LQCL      RD F    YE   +    NP      +
Sbjct: 281 NPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEIN--LDNPLGYNGTV 338

Query: 604 SKYFNVLFKKMY-----MNGGCSVVPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLL 655
           +  F  L + +Y          S  P  F   L   N++   +     QQD+QEFL FLL
Sbjct: 339 ATAFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYM----QQDSQEFLAFLL 394

Query: 656 SQLHDELSESNRVANDYPGXXXXXXXXXXXXXXE-------YDTWFEKHISENGISPIDN 708
             LH++L   NR+ +D P               E         TW + H++ N  S I++
Sbjct: 395 DSLHEDL---NRI-HDKPYIEKPTLETSEELADENAVKQLAKKTW-DAHLARND-SVIND 448

Query: 709 IFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRL 755
           +F G  ++ L C  C + S  +  +  L+L +P ST      KKV++
Sbjct: 449 LFVGMYKSTLKCPTCKNISITFDPYNDLTLPLPIST---VWNKKVKI 492

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 19/95 (20%)

Query: 857 PTVLTIHLSRFF--YDLTKKNNKVITYPL--------ILSIVLKNEQIMKYRLYAIANHF 906
           P +L IHL RF      + K + V+ +P+        ++  V+++  I  Y L+A+ NH+
Sbjct: 887 PEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YDLFAVDNHY 944

Query: 907 GNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           G L  GHYTS V  ++D+       +WYYFDD  V
Sbjct: 945 GGLGGGHYTSYVKNNIDN-------RWYYFDDSRV 972

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 15/213 (7%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRK--YTNPNQLSKYFNV 609
           A    GL N+G TCY+NS LQCL      RD FL + YE   +          ++K F+ 
Sbjct: 319 AKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSS 378

Query: 610 LFKKMY------MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
           L + ++           S  P  F          F   + QQD+QEFL FLL  LH++L+
Sbjct: 379 LVQNLFGDTITKQGTNSSFGPNHFKSTVGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDLN 437

Query: 664 E-SNRVANDYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQGQMENGLFC 720
              N+ + + P                   +TW + H+  N  S I ++F G  ++ L C
Sbjct: 438 RIINKPSTEKPSLKEGDDYNDPAVIKSLADETW-KMHLLRND-SVITDLFVGMYKSTLEC 495

Query: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKV 753
             C + S  +  +  L+L +P   ST+S + ++
Sbjct: 496 PECTNVSITFDPYSDLTLPLPVD-STWSSKVRI 527

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYP---LILS--IVLKNE-QIMKYRLYAIANHFGN 908
            P VL IHL RF      + K +  + +P   L +S  +V K++ +   Y LYA+ NH+G 
Sbjct: 914  PDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKDDPRGTVYDLYAVDNHYGG 973

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+ V   +D+       KWYYFDD  V +     D +  +    S   Y+LFY
Sbjct: 974  LGGGHYTAYVKNFIDN-------KWYYFDDSRVYE----TDPEKSV----SGSAYLLFY 1017

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 751 KKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           K++ L DC+NLF+  E L   ++W CP C
Sbjct: 870 KEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 86/200 (43%), Gaps = 23/200 (11%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLF 611
            GL N+G TCY+NS LQCL      RD F    Y++  +    NP      ++  F+ L 
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEIN--LDNPLGFQGNIANAFSALV 455

Query: 612 KKMYMNG---GCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRV 668
           + +Y N      S  P+ F          F   + QQD+QEFL FLL  LH++L   NR+
Sbjct: 456 QNLYKNQFIPSASYAPSQFKLTIGHYNQMFS-GYFQQDSQEFLAFLLDGLHEDL---NRI 511

Query: 669 ANDYP-------GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQ 721
             D P                        DT  E H+  N  S I ++F G  ++ L C 
Sbjct: 512 K-DKPYVEKPSLADGSDVNDYNIIARLAADT-LEAHLKRND-SIIIDLFVGLYKSTLKCP 568

Query: 722 RCGHSSFNYSVFYVLSLAIP 741
            C H S  +  +  L+L IP
Sbjct: 569 VCNHVSITFDPYCDLTLPIP 588

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 61/121 (50%), Gaps = 23/121 (19%)

Query: 855  SLPTVLTIHLSRFFY--DLTKKNNKVITYP---LILS--IVLKN-EQIMKYRLYAIANHF 906
            S P +LTIHL RF      + K + V+ +P   L LS  I+ K+  Q+  Y L A+ NH+
Sbjct: 1002 STPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLIAVDNHY 1061

Query: 907  GNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLF 966
            G L  GHYT+ +   +D+       KWYYFDD  V + +    +        +   Y+LF
Sbjct: 1062 GGLGGGHYTAYIKNLIDN-------KWYYFDDSRVSETVPERSV--------AGSAYLLF 1106

Query: 967  Y 967
            Y
Sbjct: 1107 Y 1107

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           + K + LED +NLF   E L   ++W CPKC
Sbjct: 958 EEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 93/213 (43%), Gaps = 36/213 (16%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP--------NQLSKYFN 608
           GL N+G TCY+NS LQCL     F + FL   Y+   +    NP        N   K  +
Sbjct: 415 GLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEIN--LDNPIGYQGNVANAFGKLIH 472

Query: 609 VLFKKMYMNGGC--------SVVPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQ 657
            LF++  ++           S  PT F   +  CN++   +     QQD+QEFL F+L  
Sbjct: 473 KLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL----QQDSQEFLAFILDG 528

Query: 658 LHDELSESNRVAN----DYPGXXXXXXXXXXXXXXEY--DTWFEKHISENGISPIDNIFQ 711
           LH++L   NR+      + P               +   DTW E H+  N  S + ++F 
Sbjct: 529 LHEDL---NRILKKPFVEKPSLPENSNYKDYKVIKKLADDTW-EAHLKRND-SIVTDLFV 583

Query: 712 GQMENGLFCQRCGHSSFNYSVFYVLSLAIPSST 744
           G  ++ L C  C + S  +  +  L+L +P  T
Sbjct: 584 GMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVET 616

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 57/119 (47%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYP-----LILSIVLKN-EQIMKYRLYAIANHFGN 908
            P +L IHL RF      + K + V+ +P     L   IV  + E+   Y L A+ NH+G 
Sbjct: 1112 PDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLIAVDNHYGG 1171

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+ V   +D       QKWYYFDD  V        +     SIS S  Y+LFY
Sbjct: 1172 LGGGHYTAYVKNFVD-------QKWYYFDDSRVS-------LADPQRSISGS-AYLLFY 1215

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 747  FSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
            F + K + L+DC+ LF+  E L  +++W CP C      T
Sbjct: 1064 FEKEKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQAT 1103

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 89/204 (43%), Gaps = 27/204 (13%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNV 609
            I GL N+G +CY+NS LQCL      RD FL   +E   +   +NP     Q+++ F  
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINT--SNPLGYQGQIAQAFAA 353

Query: 610 LFKKMYMNGGCSV---VPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
           L K ++ +   ++    P  F   +   N +   F     QQD+QE L FLL  LH++L 
Sbjct: 354 LVKSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFL----QQDSQELLAFLLDGLHEDL- 408

Query: 664 ESNRVAN----DYPGXXXXXXXXXXXXXXEYD--TWFEKHISENGISPIDNIFQGQMENG 717
             NR+      + P                    TW EKH   N  S I ++F G  ++ 
Sbjct: 409 --NRIMKKPFVEKPELASSDDVNDIDVIRNLASLTW-EKHKLRNE-SVIVDLFVGLYKST 464

Query: 718 LFCQRCGHSSFNYSVFYVLSLAIP 741
           L C  C   S  +  F  L+L +P
Sbjct: 465 LTCPACDRVSVTFDPFSDLTLPLP 488

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 58/127 (45%), Gaps = 25/127 (19%)

Query: 857  PTVLTIHLSRF--FYDLTKKNNKVITYPLI-------LSIVLKNEQIMKYRLYAIANHFG 907
            P +LTIHL RF   +  + K + V+ +P+        L     N+  M Y L A+ NH+G
Sbjct: 914  PDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSM-YDLIAVDNHYG 972

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+ V   +D        KWYYFDD  V +      I        S   Y+LFY
Sbjct: 973  GLGGGHYTAYVKNFMD-------GKWYYFDDSRVSETEAERAI--------SGAAYLLFY 1017

Query: 968  EKIDESQ 974
             +  E +
Sbjct: 1018 RRRIEGE 1024

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           ++  + L DC+ LF+  E L   ++W CP C
Sbjct: 868 EKGHISLTDCLELFSKSEVLGAADSWYCPNC 898

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 90/198 (45%), Gaps = 15/198 (7%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLFK 612
           GL N+G TCY+NS LQC+     FRD FL   ++   +    NP      +++ F+ L +
Sbjct: 331 GLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEVNEG--NPLGYQGYMARAFSDLIQ 388

Query: 613 KMYMNGGCSVV---PTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNR-- 667
            ++ +   S     P+ F          F   + QQD+QEFL FLL  LH++L+  ++  
Sbjct: 389 SLFGDNITSTTAYSPSYFKSTLGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDLNRIDKKP 447

Query: 668 -VANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
            V                      DTW + H+  N  S I ++F    ++ L C  C ++
Sbjct: 448 YVEKPSLPLTANLNDFDVVKRLADDTW-KAHLLRND-SVITDLFVAMYKSTLKCPECQNT 505

Query: 727 SFNYSVFYVLSLAIPSST 744
           S  +  +  L+L +P ++
Sbjct: 506 SVTFDPYNDLTLPLPVAS 523

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 52/119 (43%), Gaps = 23/119 (19%)

Query: 857  PTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIM--------KYRLYAIANHFGN 908
            P +L IHL RF    +  +  V T    ++    +E ++         Y L A+ NH+G 
Sbjct: 981  PDILLIHLKRFENQRSFSDKIVDTVFFPITDFDISEHLVYKEDPRGNVYDLIAVDNHYGG 1040

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
            L  GHYT+          N    KWYYFDD  V        + A   SI+ S  Y+LFY
Sbjct: 1041 LGGGHYTAYAK-------NANDNKWYYFDDSRVS-------VTAPEKSIAGS-AYLLFY 1084

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGT 786
           + + + L+DC+ LF+  E L++ ++W CP C      T
Sbjct: 935 EERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQAT 972

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 98/246 (39%), Gaps = 26/246 (10%)

Query: 547 PNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ---- 602
           PN      I G++N G  CY+N ++QCL     F + FL   Y    +      +Q    
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVV 394

Query: 603 --LSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660
              +K     F+    N   +V  T F +    L P++   + Q D  EF L LL ++H+
Sbjct: 395 KNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHE 453

Query: 661 ELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFC 720
           + S   R  N                  +Y   +  +   N  S I + F+GQ+++ L C
Sbjct: 454 D-SNWGRPQNS----------DAAMQVDDYREAWNLYRKGNS-SYIVDTFKGQIKSQLTC 501

Query: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCG 780
           Q C   S NY  F +L+L IP  +          + DC+        LT ++ W C  C 
Sbjct: 502 QVCQTQSNNYEPFSILNLPIPLVS-------MCHIYDCMKELFKVHVLTGDDRWYCSTCK 554

Query: 781 TSASGT 786
           T    T
Sbjct: 555 TKTHST 560

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 63/119 (52%), Gaps = 20/119 (16%)

Query: 855 SLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMK----YRLYAIANHFGNLI 910
           ++P VL IH +RF  +L  K    + YP +L +   N  + K    Y+L A+A H G L 
Sbjct: 567 NVPEVLIIHFNRF-DNLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLF 625

Query: 911 SGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEK 969
           SGHYT+   K+        +  WY+FDD T  K +++G+       IS S  Y+LFY+K
Sbjct: 626 SGHYTAYCFKN-------SENGWYHFDD-TQCKPVSNGE------CISQS-AYLLFYQK 669

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 64/137 (46%), Gaps = 32/137 (23%)

Query: 855  SLPTVLTIHLSRF--FYDLTKKNNKVITYPLI---LSIVLKNEQIMK------------Y 897
            S P +L +HL RF   Y  T K N  + +PL    +S  L                   Y
Sbjct: 973  STPEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDGGRENVY 1032

Query: 898  RLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSI 957
             L A+ NHFG L SGHYT+ V   +D        KWY FDD  V+      ++DA   S+
Sbjct: 1033 DLIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDSEVR------EVDA--ESV 1077

Query: 958  SSSDVYVLFYEKIDESQ 974
            +SS  Y+LFY + DE +
Sbjct: 1078 ASSFGYLLFYRRRDERK 1094

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 23/202 (11%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYT--NPNQLSKYFNVLFKKM 614
           GL N+G TC++NS+LQCL      RD FL   +    + + +     +++  F  + + +
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQAL 411

Query: 615 YMNGGCSVVPT----GFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS---ESNR 667
           + +   +  PT     F       RP    P+ QQD+ E + FLL  LH++L+   E  R
Sbjct: 412 FGD-KIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRAPEGPR 469

Query: 668 VA--------NDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLF 719
           V             G                DTW    +  + +  I ++F G +++ L 
Sbjct: 470 VGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQNDSV--ITDLFAGMLKSTLT 527

Query: 720 CQRCGHSSFNYSVFYVLSLAIP 741
           C  C  SS  +       LA+P
Sbjct: 528 CLTCRRSSVTFDP--CTELAVP 547

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 749 QRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           Q+++  LEDC++LFT+ E L   ++W CP C
Sbjct: 929 QKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNV 609
            I GL N+G TCY+NS LQCL       + FL   YE   +    NP      ++  F  
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREIN--INNPLGHKGDVAHAFGH 394

Query: 610 LFKKMYMNG-GCSV--VPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
           L   ++    G S    P  F          F   + QQD+QEFL FLL  LH++L   N
Sbjct: 395 LLYSLFAPSYGQSTFYAPRNFKNTIGHYNSLFA-GYGQQDSQEFLAFLLDGLHEDL---N 450

Query: 667 RVAN-------DYP--GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENG 717
           RV         ++P  G               +D     +I +   S I ++F G  ++ 
Sbjct: 451 RVIEKPYVNKPEFPNDGQIDDTDQIVLLAANMWD-----YIKKRNDSVIMDLFVGLYKST 505

Query: 718 LFCQRCGHSSFNYSVFYVLSLAIP 741
           L C  C H S  +  +  L+L +P
Sbjct: 506 LVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 53/122 (43%), Gaps = 25/122 (20%)

Query: 857  PTVLTIHLSRFF--YDLTKKNNKVITYPL-------ILSIVLKNEQIMKYRLYAIANHFG 907
            P +L IHL RF      + K +  + +P+        LS   + E  + Y L A+ NH+G
Sbjct: 944  PDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDV-YDLIAVDNHYG 1002

Query: 908  NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
             L  GHYT+     +D        KWYYFDD  V +      I        +   Y+LFY
Sbjct: 1003 GLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPENSI--------AGSAYLLFY 1047

Query: 968  EK 969
             +
Sbjct: 1048 RR 1049

 Score = 35.4 bits (80), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 25/44 (56%)

Query: 736 LSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           LSL+    T   +++  + L+ C+ LF+  E L + ++W CP C
Sbjct: 885 LSLSEVRKTRAQTEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 87/199 (43%), Gaps = 21/199 (10%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP----NQLSKYFNVLF 611
           TGL N+G +CY+NS LQCL      +D FL   YE   + +  NP      +++ F  L 
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQ--NPLGYKGLVAQAFAALI 391

Query: 612 KKMYMNGGCSVV---PTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS-- 663
           K ++     S     P  F   +   N++   F     QQD+QEFL FLL  LH++L+  
Sbjct: 392 KSLFDERSSSAFAFSPREFKSIIGQQNSMFAGFL----QQDSQEFLAFLLDGLHEDLNRI 447

Query: 664 -ESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
            E   V                       TW +KH   N  S I ++F G  ++ L C  
Sbjct: 448 IEKPFVEKPELSPDEDVNNREVIHRLASKTW-DKHKLRND-SVILDLFVGLYKSTLTCPV 505

Query: 723 CGHSSFNYSVFYVLSLAIP 741
           C  +S  +  +  L+L +P
Sbjct: 506 CDKTSVTFDPYSDLTLPLP 524

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 59/121 (48%), Gaps = 23/121 (19%)

Query: 857  PTVLTIHLSRF--FYDLTKKNNKVITYPLI---LS---IVLKNEQIMKYRLYAIANHFGN 908
            P +LTIHL RF   +  + K + V+ +P+    +S   +    EQ   Y L A+ NH+G 
Sbjct: 945  PDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGG 1004

Query: 909  LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
            L  GHYT+     +D        KWYYFDD  V +           TS+S +  Y+LFY 
Sbjct: 1005 LGGGHYTAFAKNPVDG-------KWYYFDDSRVSETDPE-------TSVSGA-AYLLFYR 1049

Query: 969  K 969
            +
Sbjct: 1050 R 1050

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 750 RKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            +++ L DC+ LF+  E L+  ++W CP C
Sbjct: 900 ERRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 110/259 (42%), Gaps = 43/259 (16%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           S  T+IPT+ Q      A  + GL N+G TCY++S+LQCL     F D  LS K  HY  
Sbjct: 122 SNETSIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVD--LSMKGVHYNY 173

Query: 595 RKYTNPNQ-LSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRI-----PHDQQDTQ 648
            K  +P + +S   + +  + Y  G     P   L   + L   +R+      + QQD  
Sbjct: 174 CKIQDPMKCMSCAIDNIISETY--GNKKTTPNEGLV--DILNCSWRVNKNLAGYTQQDAH 229

Query: 649 EFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPID- 707
           EFL F+L+Q+H          NDY                ++ T    + S+  +   + 
Sbjct: 230 EFLQFILNQMH----------NDYKLNEIHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNC 279

Query: 708 ---NIFQGQMENGLFCQRC-GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFT 763
               IFQG +++ + C  C   S      +  LSL +         + K  L +C+  F 
Sbjct: 280 LPHTIFQGFLKSIISCSECKAQSQTTIDPYMDLSLDV---------KGKSTLYECLESFH 330

Query: 764 SDEQLTNENAWDCPKCGTS 782
             E+L ++  ++C KC  S
Sbjct: 331 RTERL-HDFTYNCKKCNKS 348

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 59/127 (46%), Gaps = 15/127 (11%)

Query: 855 SLPTVLTIHLSRFFYDLTKKNN----KVITYPLIL--SIVLKNEQIMKYRLYAIANHFGN 908
           SLP  L++HL RF Y   K  N      I YPLIL  S    +     YRL  +  H GN
Sbjct: 563 SLPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGN 622

Query: 909 LI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
               GHY SL + +L          W  FDDETV+       +D   +  S +  YVLFY
Sbjct: 623 GPHHGHYVSLCHTEL--------FGWLLFDDETVESVDESYVLDFVGSHESPTTAYVLFY 674

Query: 968 EKIDESQ 974
            +ID S+
Sbjct: 675 SEIDGSE 681

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 54/122 (44%), Gaps = 15/122 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP  L +HL RF Y  TK +N      + YPL L +     N    KY L  I  H G  
Sbjct: 611 LPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGIVVHMGGG 670

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY SL   D     N G   W  FDDETV+       +D    S + +  YVLFY 
Sbjct: 671 PQHGHYVSLCKND-----NFG---WLLFDDETVESVSEKTVLDFVGDSSTLTTAYVLFYR 722

Query: 969 KI 970
           ++
Sbjct: 723 EL 724

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS---RKYTNPNQLSKYFN 608
           + G  N G TCY NS+LQCL+    FR   L     +  +   RK   P +  ++FN
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFRIQMLQHPERNSNTRRKRKVDMPGRKPRFFN 186

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 50/136 (36%), Gaps = 33/136 (24%)

Query: 644 QQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGI 703
            QD  EFL FLL++L D L+   +   D                            E+ +
Sbjct: 494 HQDAHEFLNFLLNELSDYLNNGAKSGKDD--------------------------EEHSL 527

Query: 704 SPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFT 763
           + I +IFQG + N + C  C + +     F    + +P  + T        ++  +  F 
Sbjct: 528 NFIKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDSET-------DIQALLQNFD 580

Query: 764 SDEQLTNENAWDCPKC 779
             E L+  N + C  C
Sbjct: 581 QREMLSGPNKFYCNVC 596

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIVLKNEQIM--KYRLYAIANHFGNL 909
           LP +L +HL RF Y   +  N      ITYPL L +  K +  +  KY L  +  H G  
Sbjct: 548 LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY S+   D     N G   W +FDDETV+       ++    + +S+  YVLFY+
Sbjct: 608 PQHGHYVSVCKTD-----NFG---WLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

Query: 969 KIDES 973
           + DE 
Sbjct: 660 ETDEG 664

 Score = 38.5 bits (88), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           I G  N G TCY NS+LQCLF    FR+  L
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 15/124 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIV--LKNEQIMKYRLYAIANHFGNL 909
           LP  L +HL RF Y   +  N      + YPL L +     +    KY L  +  H G  
Sbjct: 541 LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY SL   D        K  W  FDDETV+       ++    S + +  YVLFY+
Sbjct: 601 PQHGHYVSLCKND--------KFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYVLFYK 652

Query: 969 KIDE 972
           ++DE
Sbjct: 653 ELDE 656

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+     R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 51/144 (35%), Gaps = 47/144 (32%)

Query: 644 QQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGI 703
           QQD  EFL FLL    +ELSE                            + + HIS    
Sbjct: 422 QQDAHEFLNFLL----NELSE----------------------------YLQNHISHPSN 449

Query: 704 SPID--------NIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRL 755
            P D        ++FQG + N + C  C + +     F    + +          + + +
Sbjct: 450 KPTDIPFKNYVIDLFQGVLTNRIKCLTCDNITSRDEPFLDFPIGVKGD-------ENIDI 502

Query: 756 EDCINLFTSDEQLTNENAWDCPKC 779
           +D +  + + E L   N + C +C
Sbjct: 503 QDVLRCYHTREMLNGSNKFYCSQC 526

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 56/123 (45%), Gaps = 17/123 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV-----ITYPLILSIV--LKNEQIMKYRLYAIANHFGN 908
           LP  LT+HL RF Y   K+N  +     I YPL L++   + +E   KY L  I  H G 
Sbjct: 555 LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGG 613

Query: 909 LIS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
               GHY SL            K  W  FDDETV+       ++    S + +  YVLFY
Sbjct: 614 GPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEFTGESANMATAYVLFY 665

Query: 968 EKI 970
           + +
Sbjct: 666 KAV 668

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+     R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 97/235 (41%), Gaps = 51/235 (21%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKK 613
            + GL N+G TC+++S++Q +     F +  LS K+ +    K +    +S   + +   
Sbjct: 131 GLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIK-SGTKCVSCALDEIACD 189

Query: 614 MYMNG----GCSVVPTGFLKACNALRPDFRIPH-----DQQDTQEFLLFLLSQLHDELSE 664
            Y NG      S V  GF+   N L   + I H      QQD  E+  FLL+QLH   ++
Sbjct: 190 FYGNGPGTGKSSSVSKGFV---NLLSASWHINHHLVGSSQQDAHEYWQFLLNQLH---TD 243

Query: 665 SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG 724
             RV                         F    + +       IFQG ++N L C +CG
Sbjct: 244 HARV-------------------------FGSSKAPDCQCITHRIFQGYLKNTLQCSQCG 278

Query: 725 HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
            S         LSL I         +   +LEDC++ F  +E LT+ + ++C  C
Sbjct: 279 FSKTTIDPIMDLSLEI---------KNNPKLEDCLDHFQREETLTDFH-YECQSC 323

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 36/126 (28%)

Query: 857 PTVLTIHLSRFFYDLTKKNNKV---ITYPLILSIV-----LKNEQI--MKYRLYAIANHF 906
           P VL I L RF + L  ++ K+   + +PL L++      +++E I  + Y L  + +H 
Sbjct: 339 PNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIAYDLLNVVSHQ 398

Query: 907 GNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDV---- 962
           G +  GHYT+ V+K  D        +W+ F+D  V             TS++   V    
Sbjct: 399 GTVDQGHYTT-VSKTED-------GQWFKFNDSVV-------------TSVTEEQVLEQQ 437

Query: 963 -YVLFY 967
            Y+LFY
Sbjct: 438 AYLLFY 443

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV-----ITYPLILSIV--LKNEQIMKYRLYAIANHFGN 908
           LP  L +HL RF Y   K+N  +     I YPL L++   + +E   KY+L  I  H G 
Sbjct: 558 LPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGG 616

Query: 909 LIS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
               GHY SL   +        K  W  FDDETV+       ++    S + +  YVLFY
Sbjct: 617 GPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 668

Query: 968 EKI 970
           + +
Sbjct: 669 KAM 671

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+   + R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 55/121 (45%), Gaps = 17/121 (14%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV-----ITYPLILSIV--LKNEQIMKYRLYAIANHFGN 908
           LP  L +HL RF Y   K+N  +     I YPL L++   + +E   KY L  I  H G 
Sbjct: 557 LPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGG 615

Query: 909 LIS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
               GHY SL   ++          W  FDDETV+       ++    S + +  YVLFY
Sbjct: 616 GPQHGHYVSLCKHEI--------FGWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFY 667

Query: 968 E 968
           +
Sbjct: 668 K 668

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+   + R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV-----ITYPLILSIV--LKNEQIMKYRLYAIANHFGN 908
           LP  LT+HL RF Y   K+N  +     I YPL L++   + ++   KY L  I  H G 
Sbjct: 555 LPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGG 613

Query: 909 LIS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY 967
               GHY SL   +        K  W  FDDETV+       ++    S + +  YVLFY
Sbjct: 614 GPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLFY 665

Query: 968 EKI 970
           + +
Sbjct: 666 KAM 668

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+   + R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 169

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 57/126 (45%), Gaps = 15/126 (11%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIV--LKNEQIMKYRLYAIANHFGNL 909
           LP  L +HL RF Y   + +N      + YPLIL +    K    +KY L  I  H G+ 
Sbjct: 518 LPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGDG 577

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY +L   +        K  W ++DDETV+       +       + S  YVLFY+
Sbjct: 578 PQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFYK 629

Query: 969 KIDESQ 974
           K+ + +
Sbjct: 630 KLGDKE 635

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 544 EQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFR 581
           EQ P    +  + G  N G TCY NS+LQCL+    FR
Sbjct: 114 EQLPFGDGSNKVFGYENFGNTCYCNSVLQCLYNLPEFR 151

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 100/443 (22%), Positives = 160/443 (36%), Gaps = 118/443 (26%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRD-LF--LSTKYEHYFSRKYTNPNQLSKYFN 608
           AL   GL N G TCY N+ +Q +    A +  LF  L  KYE   SR     + +S    
Sbjct: 260 ALRPKGLLNHGVTCYTNAAVQAIVHIPAIQHYLFDILRGKYESTISR-----DSVSYVLA 314

Query: 609 VLFKKMYM--------NGGCSVVPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQ 657
              KKM++        NG   + P      L   N +  +++    Q+D+ E+ + L+S+
Sbjct: 315 ETSKKMWLPQDRSKKKNGPHHINPKKLIARLDDINCMMSEWQ----QEDSHEYFMSLMSR 370

Query: 658 LHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENG 717
           L +                              D+  + H     I  I +IF G ++  
Sbjct: 371 LQE------------------------------DSVPKGHKMTESI--IYDIFGGLLKQV 398

Query: 718 LFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCP 777
           + C+ CG  S     FY LSL +         +KK  L       + D Q  ++N     
Sbjct: 399 VTCKSCGSVSKTEQPFYDLSLHLKG-------KKKQSL-------SQDSQSDDQNKSSDA 444

Query: 778 KCGTSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNL 837
           K   SA       EK  + F  NP+                              Q+  +
Sbjct: 445 KSDDSAPSRRYSIEKSIRDF-FNPE-----------------------LIRVDKEQKGYV 480

Query: 838 EXXXXXXXXXXXXXNFISLPTVLTIHLSRFFYDLT--KKNNKVITYPLILSIV---LKNE 892
                         + I  P  L  HL +F ++ T   K  + ++YP+ L +      NE
Sbjct: 481 CEKCHQTTNAVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTEYCESNE 540

Query: 893 Q----IMKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINH 947
           +     +KY+L  +  H G +L SGHY  +V+        +    W  +DDE + K I  
Sbjct: 541 KDHVVPVKYQLTTVVVHEGRSLSSGHY--IVH------CKQPDGTWATYDDEYINK-ITE 591

Query: 948 GDIDAGITSISSSDVYVLFYEKI 970
            D+      +   + Y L Y ++
Sbjct: 592 RDV------LKEPNAYYLLYTRL 608

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 53/105 (50%), Gaps = 21/105 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLKNEQIMK---YR 898
           F S P VL + L RF YD     L K N++      +   P +   VLKNE   +   Y+
Sbjct: 390 FESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETESHIYK 449

Query: 899 LYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
           L+ +  H G++ +GHY +++  DL      G Q WY FDDE V K
Sbjct: 450 LHGVLVHTGDISTGHYYTMIKPDL------GDQ-WYRFDDERVWK 487

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G RN G TCY+NS+LQ  F TK FR L
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKL 236

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 96/254 (37%), Gaps = 63/254 (24%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFR-DLFLSTKYEHYFSRKYTNPN-----QLSKYFNVL 610
           G  N+G +CY+NS+LQCLF          L+    + F      P      QL K  N  
Sbjct: 334 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNA- 392

Query: 611 FKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
           FK    N    + P  F         +F+  ++QQD  EFL FLL QL   L        
Sbjct: 393 FKLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTL-------- 443

Query: 671 DYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730
                                  F+K  + N      NI +  ME+ + CQ CG+  ++Y
Sbjct: 444 -----------------------FKKDNNPN------NIMKFIMEDKIQCQSCGNVKYSY 474

Query: 731 SVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENA-WDCPKCGTSASGTGPE 789
                + L +  + +      +  +E   N F        EN  +DCP C  +   T   
Sbjct: 475 EPTEYIQLPLDGTNN-----PQNLVETLTNFFNG------ENIDFDCPTCKKTVVAT--- 520

Query: 790 EEKKKKRFLLNPDT 803
              K++RF  +P+T
Sbjct: 521 ---KRQRFKTSPNT 531

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 59/126 (46%), Gaps = 19/126 (15%)

Query: 856 LPTVLTIHLSRFFYDL-----TKKNNKVITYPLILSIVLKNEQIM--KYRLYAIANHFGN 908
           LP  L +HL RF Y        K  NK++ YPL L++       +  KY+L  I  H G+
Sbjct: 625 LPNTLALHLKRFKYSEEHFTNIKLFNKIV-YPLELNVSSSFTSSISKKYKLQGIVVHMGS 683

Query: 909 L-ISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSD-VYVLF 966
               GHY ++   D        K  W  FDDET    IN  ++ + I    S +  YVLF
Sbjct: 684 SPQQGHYVAICKTD--------KYGWLLFDDETASW-INEEEVLSFIGDEKSQNTAYVLF 734

Query: 967 YEKIDE 972
           YE++ +
Sbjct: 735 YEEVKD 740

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 9/95 (9%)

Query: 498 VQAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALS--- 554
           +Q  +  H  A+S N T    ++        S N +  K+     +    ++Y+      
Sbjct: 96  LQQMQKQHLDANSNNETTFHYDVSNEE----SANEDMDKNKFSSILSTMTDDYIPFGDGS 151

Query: 555 --ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLST 587
             I G  N G TCY NS+LQCL+    F+   L T
Sbjct: 152 NKIFGYENFGNTCYCNSVLQCLYHLDDFKLNLLKT 186

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 55/123 (44%), Gaps = 15/123 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIVLKNEQIM--KYRLYAIANHFGNL 909
           LP +L++HL RF Y    ++N      I YPL L +  K++ I+   Y L  I  H G  
Sbjct: 590 LPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGG 649

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY ++   D+          W  +DDETV+                 +  YVLF++
Sbjct: 650 PQHGHYVAICKHDM--------FGWLLYDDETVESIDEETVFKFVGDEKDMTTAYVLFFK 701

Query: 969 KID 971
           ++D
Sbjct: 702 EVD 704

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + GL N G TCY NS+LQCLF     R
Sbjct: 132 VFGLENFGNTCYCNSVLQCLFNLSELR 158

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 100/255 (39%), Gaps = 38/255 (14%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATK---AFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLF 611
           I GL N G TC++NS+LQ L ++K   AF D  +    E+    K+T    L +   +L 
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIENGSENNGDIKFT--ETLRELLLILN 114

Query: 612 KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL--------S 663
           KK Y                N    +  + +DQ+D QEF   +LS L   +         
Sbjct: 115 KKYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKE 174

Query: 664 ESNRVA-NDYPGXXXXXXXXXXXXXXEY---DTWFEKHISENG----------ISPIDNI 709
           E N +  +D P                Y   +      + EN           I+P+D I
Sbjct: 175 ERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQKLYSPFKLITPLDGI 234

Query: 710 FQGQMENGLFCQRCG-HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQL 768
              +    + C  CG +    YSVF  LSL +PS +   S    ++L + +N +   E +
Sbjct: 235 TAER----IGCLTCGENGGIRYSVFSGLSLNLPSESLNQS---TLKLSELLNEWVKPEII 287

Query: 769 TNENAWDCPKCGTSA 783
                 +C +C  +A
Sbjct: 288 E---GVECNRCSLNA 299

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 19/103 (18%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLK-NEQIMKYRLY 900
           F S P +L + L RF YD     L K N++      +   P +    L+ N++  KY L+
Sbjct: 388 FESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCKYTLH 447

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
            +  H G++ +GHY +++  DL       + +WY FDDE V K
Sbjct: 448 GVLVHTGDISTGHYYAMIKPDL-------QDQWYRFDDEKVWK 483

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      E+       +PN       +  ++ +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIPTEN------ESPND---SVPLALQRAF 257

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   L+   +   D      Q D QE    L+ +L + +
Sbjct: 258 YQLQVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 304

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 15/124 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIVLKNEQIMK--YRLYAIANHFGNL 909
           LP +L +HL RF Y   K  N      + YPL L++    +  ++  Y L  +  H G+ 
Sbjct: 645 LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY SL   D        K  W  FDDETV+       ++      + +  YVLFY+
Sbjct: 705 PQHGHYVSLCKND--------KFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYK 756

Query: 969 KIDE 972
           +I +
Sbjct: 757 EIKD 760

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 522 KHSVPALSGNGNYSKHTAI---PTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATK 578
           K  VPA   N + + ++AI   P  +  P    +  + G  N G TCY NS+LQCL+   
Sbjct: 135 KKQVPATIVNNDDTLNSAILFTPVSDLIPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLY 194

Query: 579 AFRDLFLSTKYEHYFSRKYTN 599
            FR   L  +Y  +    Y N
Sbjct: 195 EFRLNML--EYSDHLPHNYAN 213

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 63/179 (35%), Gaps = 46/179 (25%)

Query: 601 NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHD 660
           N L   F  + +  Y+ G   V PT F+K        F     QQD+ EFL FLL++L D
Sbjct: 498 NSLKDIFESITENRYLTG--IVAPTEFVKILKKENVLFN-SMMQQDSHEFLNFLLNELRD 554

Query: 661 ELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFC 720
            L  +    N++                                 I N+FQG + N + C
Sbjct: 555 YLPST---TNNF---------------------------------ITNLFQGILTNQIKC 578

Query: 721 QRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
             C + +     F    + +     T        +E  +  + + E L   N + C +C
Sbjct: 579 LTCDNITSRDEPFLDFPIGVKDDEET-------NIETLLRNYHTREMLNGSNKFYCNQC 630

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 50/236 (21%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ-LSKYFNVLFKKMY 615
           G  N+G TC+++S+LQ L          +S    HY S K  NPN  +S   + +  + Y
Sbjct: 122 GFVNMGSTCFMSSILQVLIHNPFIVQNSMSQ--SHYSSCKIRNPNNCISCALDEIIAESY 179

Query: 616 -----MNGGCSV--VPTGFLKA--CNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
                 N G  +     GF+    C+    D    + QQD  EFL F+L++LH +   ++
Sbjct: 180 GNFVKYNNGKPINQYHDGFISMLNCSWKINDNFAGYSQQDAHEFLQFILNRLHRDYKLTS 239

Query: 667 RVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHS 726
              N+                           +++    I +IFQG++++ + C  C  +
Sbjct: 240 TYTNN---------------------------TDSCSCLIHSIFQGKLKSSIVCPECHDN 272

Query: 727 SFNYSVFYV-LSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGT 781
           S   +  Y+ LSL I         + K  L  C++ F   E L + N + CP C T
Sbjct: 273 SKTVTDPYIDLSLDI---------KDKATLYQCLDSFHKKETLHDYN-YHCPNCDT 318

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 51/125 (40%), Gaps = 34/125 (27%)

Query: 856 LPTVLTIHLSRFFYDLTKKN---NKVITYPLILSI-----VLKNEQIMKYRLYAIANHFG 907
           LP VL + L RF +    +N   N  I +P  L++       +N   + Y L  + +H G
Sbjct: 331 LPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYELNGVISHIG 390

Query: 908 NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDV----- 962
            +  GHY + +  D           W+ F+D  V             TSIS  +V     
Sbjct: 391 TVNEGHYIATLKLD--------SNNWFKFNDSMV-------------TSISEEEVLKDQA 429

Query: 963 YVLFY 967
           Y+LFY
Sbjct: 430 YLLFY 434

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 35/201 (17%)

Query: 479 KTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDKNEIQKHSVP-ALSGNGNYSKH 537
           + EE+T+ P +R  F   +V+   +D   A+ Q   +  + +     P A   +    KH
Sbjct: 33  QVEELTQVPRSRQKF---MVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKH 89

Query: 538 TAIPTIEQSPNEYVAL---SITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
             +  +  SP++ V     +  GL+N+G TCY+N+ LQ LF     +DL L      Y  
Sbjct: 90  RFVEDL--SPDQQVQQFNSTPLGLQNMGNTCYLNATLQALFRADELKDLIL-----QYDP 142

Query: 595 RKYTNPN-----------QLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDF--RIP 641
            K TN +           +L + F  L K+ +     SV+P   L       P F  R P
Sbjct: 143 SKVTNSDANDEIHYKIVLELKRTFETLKKRSFK----SVLPIMLLNTLRKCYPQFAERDP 198

Query: 642 ----HDQQDTQEFLLFLLSQL 658
               + QQD +E    L   L
Sbjct: 199 QGGFYKQQDAEELFTQLFHTL 219

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa] {ON}
            Anc_8.202 YER151C
          Length = 1080

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 62/142 (43%), Gaps = 36/142 (25%)

Query: 856  LPTVLTIHLSRF-FYDLTKKNNKVITY----------------------PL--ILSIVLK 890
            LP VL I L RF F     K+N +  Y                      P+  + S +LK
Sbjct: 945  LPQVLLIQLKRFSFVSNIGKDNGMTNYNSYNGRIEKIRKKINYNHELLVPVESVSSAILK 1004

Query: 891  N-EQIMKYRLYAIANHFGNLI-SGHYTS-LVNKDLDHDLNKGKQKWYYFDDETVKKDINH 947
            N E   KY+L A+  H G+    GHYT+ + NKDL        +KW+  DD  + +  + 
Sbjct: 1005 NNESSRKYKLRAVVYHHGSSPDGGHYTADIYNKDL--------KKWFMIDDVNITELEDA 1056

Query: 948  GDIDAGITSISSSDVYVLFYEK 969
              ++ G   + +   Y+L YEK
Sbjct: 1057 DVVNGGDNGLDTRTAYILMYEK 1078

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 49/113 (43%), Gaps = 14/113 (12%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF----SRKYTNPNQLSKYFNVLFK 612
           GL N+G TCY+NS LQ L+     RD+ L  K +          Y   ++L + F  L K
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKRCFENLQK 169

Query: 613 KMYMNGGCSVVPTGFLKACNALRPDFRIPHD------QQDTQEFLLFLLSQLH 659
           K Y     SV+P  FL       P F    +      QQD +E    L S L+
Sbjct: 170 KSYE----SVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 8/75 (10%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
           Y L  +  H G N  SGHY S +  + D +      KWY F+D+ V   +    I+A   
Sbjct: 427 YDLIGVITHQGANSESGHYQSFIRDEKDEN------KWYKFNDDKVSV-VEREKIEALAG 479

Query: 956 SISSSDVYVLFYEKI 970
              S    +L Y+ +
Sbjct: 480 GGESDSALILIYKGL 494

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 76/384 (19%), Positives = 135/384 (35%), Gaps = 69/384 (17%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRD-LFLSTKYEHYFSRKYTNPNQLSKYFNVL 610
            L   GL N G TCY N+ +Q +    A +  LF   +    +      PN +S   +  
Sbjct: 299 GLKPCGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDILRNNKDYITDIIKPNSVSYILSQT 358

Query: 611 FKKMYMNGGCSVVPT-----------GFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLH 659
            KKM+         T             L+  N +  +++    Q+D+ E+ + L+S+L 
Sbjct: 359 SKKMWWKDSKKTSKTSANYIDPKKLIAALEQINCMMSEWQ----QEDSHEYFMSLMSRLQ 414

Query: 660 DELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLF 719
           ++           P                      K ++E   S I +IF G ++  + 
Sbjct: 415 ED---------SVPKG--------------------KKMTE---SIIYDIFGGLLKQEVT 442

Query: 720 CQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           C+ CG  S     FY LSL +    +                 ++D   TN  A +  K 
Sbjct: 443 CKSCGEISKTEQPFYDLSLHLKGKHNRHQTN------------STDSATTNYPAGNSNKI 490

Query: 780 GTSASGTGPEEEKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEX 839
             S++  G  +        LNP+                              +++    
Sbjct: 491 EESSTKEGAADSVNNANNQLNPENGIQDASTSRFSIEKSIGDFFNPELIKMDKEKKGYVC 550

Query: 840 XXXXXXXXXXXXNFI-SLPTVLTIHLSRFFYD--LTKKNNKVITYPLILSIV-----LKN 891
                       N I   P  L +HL +F ++   + K  + ++YP+ L +       K+
Sbjct: 551 EKCKKTTNAVKRNTILRAPETLLVHLKKFRFNGQSSSKMKQAVSYPMFLDLTSYCDKTKS 610

Query: 892 EQIMKYRLYAIANHFG-NLISGHY 914
           + ++ Y+L ++  H G +L SGHY
Sbjct: 611 KLLVMYQLISVVVHEGRSLSSGHY 634

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 108/265 (40%), Gaps = 48/265 (18%)

Query: 525 VPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLF 584
           +  +  +   SK  ++PT  +    Y      GL N+G TC+++S+LQ L      +  F
Sbjct: 112 IAGVPWDSAMSKQVSLPTSLRRDGLY------GLLNLGSTCFMSSILQSLIHNTYIQYWF 165

Query: 585 LSTKYEHYFSRKYTNPNQ-LSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRI--- 640
           L++ +    + +  +P+  +S   + +  + Y +        GFL   + L   ++I   
Sbjct: 166 LNSGHARRCALR--DPSSCISCALDRIISECYGSLSERNDHAGFL---SLLTCSWKINQN 220

Query: 641 --PHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHI 698
              + QQD  EFL FLL+QLH +     +V  D                           
Sbjct: 221 FAGYSQQDAHEFLQFLLNQLHCDYKRERQVDEDKE--------------------VRSSS 260

Query: 699 SENGISPIDNIFQGQMENGLFCQRCGHSSFNY-SVFYVLSLAIPSSTSTFSQRKKVRLED 757
           S+     + + FQG + + + C  C   S      F  LSL I        QR    L D
Sbjct: 261 SQLCHCIVHSSFQGTLRSSIVCPECQDDSKTMLDPFLDLSLDIK------GQRT---LYD 311

Query: 758 CINLFTSDEQLTNENAWDCPKCGTS 782
           C++ F   EQL + + + CP+C TS
Sbjct: 312 CLDSFHRREQLHDFD-YHCPRCQTS 335

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 16/94 (17%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSI---VLKNEQI--MKYRLYAIANHFG 907
           L   L + L RF +  + +N K+   + +PL L +       E    + YRL  + +H G
Sbjct: 347 LAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRLSGVVSHSG 406

Query: 908 NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
            +  GHYT+++       LN G  +W+ F+D  +
Sbjct: 407 TVNEGHYTAVLQ------LNSG--EWFKFNDSMI 432

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 52/121 (42%), Gaps = 15/121 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIVLK-NEQIMK-YRLYAIANHFGNL 909
           LP  L +HL RF Y   + +N      ++YPL L +    N  I K Y L  I  H G  
Sbjct: 566 LPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGG 625

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY SL   +        K  W  FDDETV+       +       + +  YVLFY+
Sbjct: 626 PQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMTTAYVLFYQ 677

Query: 969 K 969
           +
Sbjct: 678 E 678

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 71/182 (39%), Gaps = 31/182 (17%)

Query: 601 NQLSKYFNVLFKKMYMNGGCSVVPTGF---LKACNALRPDFRIPHDQQDTQEFLLFLLSQ 657
           N L   F  + +  Y+ G   V P+ F   LK  N L          QD  EFL+FLL++
Sbjct: 398 NGLKDIFECITEHSYLTG--VVTPSAFIEMLKRENVLFSSMM----HQDAHEFLIFLLNE 451

Query: 658 LHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENG 717
           + D L + N+ A                    YD+   +  S    + + +IFQG + N 
Sbjct: 452 ISDFLDKQNKNA---------------LNSKIYDSSQGRRNSGTVKNFVSDIFQGTLTNR 496

Query: 718 LFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCP 777
           + C  C +++     F    + +        +   + +++ +  F   E L   N + C 
Sbjct: 497 IKCLTCDNTTARDEPFLDFPIEV-------QENVDIDIQEILESFHQKEMLHGPNKFYCD 549

Query: 778 KC 779
           +C
Sbjct: 550 EC 551

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           I G  N G TCY NS+LQCL+    FR+  L
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 80/198 (40%), Gaps = 43/198 (21%)

Query: 550 YVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNV 609
           +  L   GL N G TCY N+ +Q +    A +          Y   K  +PN +S     
Sbjct: 436 FANLRPKGLINHGVTCYTNAAVQAMVHIPAVQHYLFDILRGKY---KNIDPNSVSYTLAE 492

Query: 610 LFKKMYMN---GGCSVV----PTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
             ++M+++   G   V+    P   ++  + +      P++Q+D+ E+ + L+S+L +  
Sbjct: 493 TTRRMWLSNKKGNKKVIAYYNPNELIERLDDINWSMN-PYNQEDSHEYFMSLMSKLQE-- 549

Query: 663 SESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
                  N  P                      ++++E   S I +IF G +E  + C+ 
Sbjct: 550 -------NSVP--------------------IGRNMTE---SIIYDIFGGLLEQTVTCKS 579

Query: 723 CGHSSFNYSVFYVLSLAI 740
           CG  S     FY LSL +
Sbjct: 580 CGGVSKTEQEFYDLSLDL 597

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 56/127 (44%), Gaps = 17/127 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLIL--SIVLKNEQIMKYRLYAIANHFGNL 909
           LP  L +HL RF Y   +  N      I YPL L       +    KY L  I  H G  
Sbjct: 568 LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISS-SDVYVLFY 967
              GHY SL   D     N G   W  FDDETV+  ++   +   I    S +  YVLFY
Sbjct: 628 PQHGHYVSLCKND-----NFG---WLLFDDETVEA-VHESTVSKFIGDRDSLTTAYVLFY 678

Query: 968 EKIDESQ 974
           ++I +S+
Sbjct: 679 KEIAQSE 685

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+    FR L L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 56/119 (47%), Gaps = 22/119 (18%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS------RKYTNPNQLSKYFNVL 610
           GL+N+G TCY+N+ LQCLF  +  R++ L+ K     S      +K     +L   F+ L
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYKQSSSVSPADEVHQKIV--LELRNCFDSL 167

Query: 611 FKKMYMNGGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLFLLSQLHDELS 663
            KK +     +V+P   L       P F  R P    + QQD +E    L +QL   LS
Sbjct: 168 DKKKFQ----AVMPLMLLNVLRKAYPQFAERDPQGGFYKQQDAEE----LFTQLFHSLS 218

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 21/102 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYP--LILSIVLKNE------QIMKYRL 899
           F S P VL + L RF YD     L K N++   +P  + LS  L  E      + M Y L
Sbjct: 380 FESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEVRKIRPESMMYNL 438

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           + +  H G++ +GHY +++   LD        KWY FDD+ V
Sbjct: 439 HGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKV 473

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDL 583
              GL+N G TCY+NS+LQ  + TK FR L
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKL 226

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 59/126 (46%), Gaps = 15/126 (11%)

Query: 856 LPTVLTIHLSRFFY-DLTKKNNKV---ITYPLILSIVLK-NEQIMK-YRLYAIANHFG-N 908
           LP  L IHL RF Y D    N K+   I YP+ L +    +E + K Y L  +  H G  
Sbjct: 527 LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 909 LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY S V K  D+        W  FDDETV+       +     S S+   YVLFY+
Sbjct: 587 PQHGHYIS-VCKTSDY-------GWLLFDDETVECISEDTVLSFVGDSNSAGTAYVLFYK 638

Query: 969 KIDESQ 974
           +I+ S+
Sbjct: 639 EINSSR 644

 Score = 39.7 bits (91), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           + GL N G TCY NS+LQCL+    FR+  L 
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENILG 161

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 21/102 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYP--LILSIVLKNEQIMK------YRL 899
           F S P VL + L RF YD     L K N++   +P  + LS  +  E + K      Y L
Sbjct: 440 FESFPEVLHLQLKRFEYDFNYDQLVKVNDR-FEFPETIDLSPYMDKEVLKKQKGPNNYNL 498

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           + +  H G++ +GHY +++    D        KWY FDDE V
Sbjct: 499 HGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKV 533

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G RN G TCY+NS+LQ  F TK FRDL
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDL 286

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 51/113 (45%), Gaps = 10/113 (8%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKM-- 614
           GL N+G +CY+NS+LQCLF  + +         E + +      N L      L++ M  
Sbjct: 321 GLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNNLRCQLIKLYRAMKL 380

Query: 615 ----YMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELS 663
               Y  G   + P  F K  +A   +F     QQD  EFL +++  L  +LS
Sbjct: 381 EPELYPQG---IKPQSFKKCFSAGHEEF-ASQRQQDAMEFLTYMIDNLDKKLS 429

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP  L++HL RF Y   K  N      I YP  L++     ++   +Y L +   H G+ 
Sbjct: 512 LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY SL   +           W  FDDETV+  ++   +    T  +S   YVLFY 
Sbjct: 572 PQYGHYISLCKTE--------TFGWLLFDDETVEA-VDEQTV-LSFTGENSDTAYVLFYN 621

Query: 969 KIDE 972
           ++ E
Sbjct: 622 EVSE 625

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 537 HTAIPTIEQS---PNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           +TAI  +++S   P    +  I G  N G TCY NS+LQC F    FR   LS
Sbjct: 105 NTAILDVKESNLMPYGDGSNKIFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 59/142 (41%), Gaps = 35/142 (24%)

Query: 856  LPTVLTIHLSRF-FYDLTKKNNKVITYPLILS--------------IVLKNEQIMK---- 896
            LPTVL IHL RF F + T K+N +  Y                   +V+  E I      
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 897  ------YRLYAIANHFG-NLISGHYTS-LVNKDLDHDLNKGKQKWYYFDDETVKKDINHG 948
                  Y L  +  H G +   GHYT+ + +K++D        KWY  DD TV +     
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTADIYHKEVD--------KWYRIDDVTVTELEKDD 997

Query: 949  DIDAGITSISSSDVYVLFYEKI 970
             +  G  S  S   Y+L Y+K+
Sbjct: 998  VLKGGENSTDSRTAYILMYQKL 1019

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      EH       +PN       +  ++ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH------ESPNNSVP---LALQRAF 255

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   L+   +   D      Q D QE    L+ +L + +
Sbjct: 256 YQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 26/108 (24%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLK--------NEQ 893
           F S P VL + L RF YD     + K N+K      +   P +   VLK        ++ 
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKN 445

Query: 894 IMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
              Y L+ +  H G++ +GHY +L+   ++        +WY FDDE V
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      EH       +PN       +  ++ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH------ESPNNSVP---LALQRAF 255

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   L+   +   D      Q D QE    L+ +L + +
Sbjct: 256 YQLQVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 25/107 (23%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLK-------NEQI 894
           F S P VL + L RF YD     + K N+K      +   P +   VLK       N   
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGDNGNP 445

Query: 895 MKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
             Y L+ +  H G++ +GHY +L+   ++        +WY FDDE V
Sbjct: 446 YIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 485

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (48%), Gaps = 19/103 (18%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNN------KVITYPLILSIVLKNEQIMK-YRLY 900
           F S P VL + L RF YD     L K N+      K+   P +   +LK     K Y+L+
Sbjct: 385 FESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKNYKLH 444

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
            +  H G++ +GHY +++   L+        +WY FDDE V K
Sbjct: 445 GVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKVWK 480

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 80/232 (34%), Gaps = 53/232 (22%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L              TN    +    +  ++ +
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIP---------TNGENPNDSVPLALQRAF 254

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGX 675
                S  P   L+   +   D      Q D QE    L+ +L + +  +N         
Sbjct: 255 YQLQVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGTN--------- 305

Query: 676 XXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYV 735
                              E  ++E        IF G+M++ + C+   + S     F+ 
Sbjct: 306 ------------------VEGKLNE--------IFVGKMKSYIRCKNVDYESSRVEDFWD 339

Query: 736 LSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTG 787
           + L + +  S         L++    +   E +  EN +  P  G   +  G
Sbjct: 340 IQLNVKNFKS---------LQESFENYIEVELMNGENQYAAPDFGLQDAYKG 382

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 51/121 (42%), Gaps = 15/121 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP +L++HL RF Y   +K+N      I YPL L +          KY L  +  H G+ 
Sbjct: 554 LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY  +   +        K  W  +DDETV+       +         +  YVLFY+
Sbjct: 614 PQHGHYVCICRNE--------KFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFYK 665

Query: 969 K 969
           +
Sbjct: 666 E 666

 Score = 35.8 bits (81), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 18/102 (17%)

Query: 853 FISLPTVLTIHLSRFFYDLTK----KNNKVITYP--LILSIVLKNEQIMK-----YRLYA 901
           F S P VL + L RF YD       K N    +P  + LS  L++ +  K     Y L+ 
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVYNLHG 443

Query: 902 IANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
           +  H G++ +GHY +L+   L+        +WY FDDE V K
Sbjct: 444 VLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERVWK 478

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 44/107 (41%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      E+  S   + P  L + F  L     
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIPTENE-SPNNSVPLALQRSFYQL----- 256

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S  P   L+   +   D      Q D QE    L+ +L + +
Sbjct: 257 ---QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 300

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 104/260 (40%), Gaps = 60/260 (23%)

Query: 538 TAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKY 597
           T +P++E+         + GL N+G TC+++S+LQ L     F +  +S  +    S+K 
Sbjct: 125 TVVPSVERRD------GLHGLLNLGSTCFMSSILQILIRNPYFFNFSISQSH----SKKC 174

Query: 598 TNPNQLSKYFNVLFKKMYMNGGCSVVPTG------------FLKACNALRPDFRIPHDQQ 645
              +  S     L K +    G S   TG             L  C+    +    + QQ
Sbjct: 175 PIQDPKSCISCALEKMVCEFYGSSAYSTGDVEPQAMYSGFIGLLVCSWKINENLAGYSQQ 234

Query: 646 DTQEFLLFLLSQLHDELSE-SNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGIS 704
           D  EF  FLL+QLH +    S +  ND                          IS++  +
Sbjct: 235 DAHEFWQFLLNQLHHDFQVCSGKGVNDA-------------------------ISDDLCT 269

Query: 705 PI-DNIFQGQMENGLFCQRCGH-SSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLF 762
            I  + FQG +++ + C  C + S      F  LSL I         + K  L +C++ F
Sbjct: 270 CIAHSTFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDI---------KDKSNLYNCLDSF 320

Query: 763 TSDEQLTNENAWDCPKCGTS 782
              E+L + N + CP C TS
Sbjct: 321 HKKERLHDFN-YHCPNCNTS 339

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 54/134 (40%), Gaps = 24/134 (17%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP +L++HL RF Y   +K+N      I YPL L +          KY L  +  H G+ 
Sbjct: 552 LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFY- 967
              GHY  +   +        K  W  +DDETV+       +         +  YVLFY 
Sbjct: 612 PQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLQFTGHPGDQTTAYVLFYK 663

Query: 968 --------EKIDES 973
                   EKID S
Sbjct: 664 ESQVNNRTEKIDAS 677

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      EH       +PN       +  ++ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH------ESPNNSVP---LALQRAF 255

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   ++   +   D      Q D QE    L+ +L + +
Sbjct: 256 YQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 49/108 (45%), Gaps = 26/108 (24%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVL--------KNEQ 893
           F S P VL + L RF YD     + K N+K      +   P +   VL        K++ 
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGDKDKN 445

Query: 894 IMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
              Y L+ +  H G++ +GHY +L+   ++        +WY FDDE V
Sbjct: 446 PYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      EH       +PN       +  ++ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEH------ESPNNSVP---LALQRAF 255

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   ++   +   D      Q D QE    L+ +L + +
Sbjct: 256 YQLQVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNM 302

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 48/108 (44%), Gaps = 26/108 (24%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLK--------NEQ 893
           F S P VL + L RF YD     + K N+K      +   P +   VLK        +  
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGDKSRN 445

Query: 894 IMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
              Y L+ +  H G++ +GHY +L+   ++        +WY FDDE V
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERV 486

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 49/103 (47%), Gaps = 19/103 (18%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLK-NEQIMKYRLY 900
           F S P VL + L RF YD     L K N++      +   P +   VL+ N     Y L+
Sbjct: 384 FESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRWYGLH 443

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
            +  H G++ +GHY +L+   L+        +WY FDDE V K
Sbjct: 444 GVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWK 479

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G RN G TCY+NS+LQ  F TK FR L
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRL 230

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 56/129 (43%), Gaps = 27/129 (20%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP  L +HL RF Y   K  N      + YP  L+I  V  +    KY L +I  H G  
Sbjct: 540 LPKHLVVHLKRFKYCEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGES 599

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQ-KWYYFDDETVKKDINHGDIDAGITSI-----SSSDV 962
              GHY +L          K K   W  +DDETV+        D  ++ I      S+  
Sbjct: 600 PQLGHYVTLC---------KHKSYGWLIYDDETVQ-----AVSDELVSRILNNEQRSATA 645

Query: 963 YVLFYEKID 971
           Y+LFYE++D
Sbjct: 646 YLLFYEEVD 654

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 551 VALSITGLRNIGCTCYVNSMLQCLFATKAFRD 582
           V   + G +N G TCY NS+LQ LF   +FRD
Sbjct: 101 VGERVFGFQNFGYTCYCNSILQALFNIGSFRD 132

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/261 (21%), Positives = 105/261 (40%), Gaps = 62/261 (23%)

Query: 534 YSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF 593
           Y ++T +PT++Q         + GL N+G TCY++S++QC+         F+  ++ +  
Sbjct: 121 YEEYTNVPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHSNNC 174

Query: 594 SRKYTNPNQLSKYFNVLFKKMYMNG---------GCSVVPTGFLKACNALRPDFRI---- 640
           + K  + N  S   + +    Y N            +    GF+   N L   +++    
Sbjct: 175 TLKMAS-NCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFI---NLLTCSWKVNENL 230

Query: 641 -PHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHIS 699
             + QQD  E+  F+L+ +H +   S    +D                       +K  +
Sbjct: 231 AGYSQQDAHEYWQFILNHIHQDYKSSMHSHSD-----------------------DKLCN 267

Query: 700 ENGISPIDNIFQGQMENGLFCQRCGH-SSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDC 758
                 + + FQG +++ + C  C + S   +  F  LSL I         + K  L +C
Sbjct: 268 ----CVVHSSFQGSLKSSIVCPECNNDSKTTFDPFIDLSLGI---------KDKHTLTEC 314

Query: 759 INLFTSDEQLTNENAWDCPKC 779
           ++ F   EQL + + + C KC
Sbjct: 315 LDNFHKKEQLHDYDFF-CKKC 334

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSI--VLKNEQ------IMKYRLYAIAN 904
           LP VL + L RF + ++  N K+   I +P IL +   LK+ Q       + Y L  I +
Sbjct: 349 LPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIIS 408

Query: 905 HFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYV 964
           H G++  GHY +    +          +W+ F+D  V K +           +     Y+
Sbjct: 409 HTGSVNEGHYVAFCKIE--------NGEWFKFNDSMVTKILE--------KDVLKEQAYL 452

Query: 965 LFY 967
           LFY
Sbjct: 453 LFY 455

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 105/267 (39%), Gaps = 65/267 (24%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           S  T +P +E+         ++GL N+G TC+++S+LQCL     F          H  S
Sbjct: 122 STKTTVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF--------IRHSMS 167

Query: 595 RKYTNPNQLS---KYFNVLFKKMYM-------------NGGCSVVPTGF--LKACNALRP 636
           + ++N  ++    K F+    K+               +   +   TGF  L  C     
Sbjct: 168 QIHSNKCKVGSPDKCFSCALDKIIQELYGVLNTDQPSPSSSATNRQTGFIYLLTCAWKIN 227

Query: 637 DFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEK 696
                + QQD  EF  F+++Q+H   +      +D P               E D    K
Sbjct: 228 QNLAGYSQQDAHEFWQFIINQIHQSYT------HDSPN------------AKEIDRVNNK 269

Query: 697 HISENGISPIDNIFQGQMENGLFCQRC-GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRL 755
                    + ++F+G +E+ + C  C  +S      F  LSL I         + K +L
Sbjct: 270 RCE----CIVHSVFEGSLESSIVCPGCQKNSKTTIDPFMDLSLDI---------KDKKKL 316

Query: 756 EDCINLFTSDEQLTNENAWDCPKCGTS 782
            +C++ F   EQL + N + C +C ++
Sbjct: 317 YECLDSFHKKEQLKDFN-YHCGECNST 342

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 56/133 (42%), Gaps = 42/133 (31%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSIV-----------LKNEQI--MKYRL 899
           LP+VL + L RF + L   N K+   I +P  L++              N ++  + Y L
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNGKVPDIIYEL 413

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISS 959
             I +H G +  GHY +         ++ G  +W+ F+D  V             TSI+ 
Sbjct: 414 IGIVSHRGTVNEGHYIAFCK------ISGG--QWFKFNDSVV-------------TSIAQ 452

Query: 960 SDV-----YVLFY 967
            +V     Y+LFY
Sbjct: 453 GEVLKEQAYLLFY 465

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 56/139 (40%), Gaps = 15/139 (10%)

Query: 544 EQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQL 603
           EQ   ++  L + G +N+G TCY+N+ LQ L+     RD+ L+       S       ++
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEI 156

Query: 604 SKYFNVLFKKMYMN----GGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLF 653
            K   +  K+ + N       SV+P   L       P F         + QQD +E    
Sbjct: 157 HKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQDAEELFTQ 216

Query: 654 LLSQLH----DELSESNRV 668
           L   +     D+ SE  R+
Sbjct: 217 LFHSMSIVFGDKFSEDFRI 235

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY + +  +LD +      KWY F+D+ V
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 39/84 (46%), Gaps = 12/84 (14%)

Query: 710 FQGQMENGLFCQRCGHSS-FNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQL 768
           F+G + N L C +CG +S  N   FY+  L +P       Q+  V+L D +N     EQ+
Sbjct: 191 FKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLP-------QQGSVKLSDLVN----GEQM 239

Query: 769 TNENAWDCPKCGTSASGTGPEEEK 792
                + C  C T A  T   EEK
Sbjct: 240 ETIENYSCMYCKTVAMLTNEREEK 263

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 51/119 (42%), Gaps = 26/119 (21%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN-----------QLSK 605
           G +N+G TCY+N+ LQ LF     R+L L     +Y  + +TN N           +L  
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELIL-----NYDPKAFTNLNPQDEMHHKLILELKH 163

Query: 606 YFNVLFKKMYMNGGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLFLLSQL 658
            F  L +K Y     SV+P   +     + P F  R P    + QQD +E    L   +
Sbjct: 164 CFESLKQKNYQ----SVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELFTQLFHSM 218

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 56/130 (43%), Gaps = 26/130 (20%)

Query: 853 FISLPTVLTIHLSRFFYD--LTKKNNKVITYPLILSI--VLKNEQIMKYRLYAIANHFG- 907
           F  LP  L +HL RF  D  +  K    I YPL L++     N     Y L  +  H G 
Sbjct: 535 FEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVLHVGA 594

Query: 908 NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK------DINHGDIDAGITSISSSD 961
           +   GHY S+   +        K  W  +DDET++         + G+ +  IT+     
Sbjct: 595 SPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNNPITA----- 641

Query: 962 VYVLFY-EKI 970
            YVLFY EKI
Sbjct: 642 -YVLFYSEKI 650

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQC++    FR   L
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFRKSIL 150

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP-NQLSKYFNVLFKKMY 615
           G +N+G TCY+N+ LQ L+  +  RD+ L      Y     T P ++  K   V  K+ +
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMILD-----YNQNSTTTPVDETHKKIVVEMKRCF 164

Query: 616 MNGGC----SVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLFLLSQLHDELS 663
            N       SV+P   L A     P F  R P    + QQD +E    L +QL   +S
Sbjct: 165 ENLKSKSYKSVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEE----LFTQLCQSMS 218

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY S +  D+D D      KWY F+D+ V
Sbjct: 425 YELIGVITHQGANSESGHYQSFIRDDMDED------KWYNFNDDKV 464

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 112/272 (41%), Gaps = 55/272 (20%)

Query: 531 NGNY-SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKY 589
           N NY +++T+ P+ ++         ++GL N+G TCY++ ++QCL     F  L  S   
Sbjct: 117 NWNYIAENTSFPSYDRKD------GLSGLVNMGSTCYMSCIIQCLVRNPYF--LKHSFNQ 168

Query: 590 EHYFSRKYTNP-NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHD----- 643
            HY   K  +P + LS   + +  ++Y       V        + L   ++I  D     
Sbjct: 169 THYKECKIRDPVSCLSCALDSVVFELYGKTQKKAVDDKNGGLIDILNCTWKINEDLVGYS 228

Query: 644 QQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGI 703
           QQD  EF  FL++++H E   +N    + P                     + H   N I
Sbjct: 229 QQDAHEFWQFLMNRIHSEYKLNNNTI-EVPK--------------------DTHQLCNCI 267

Query: 704 SPIDNIFQGQMENGLFCQRCGHSSFNYSVFYV-LSLAIPSSTSTFSQRKKVRLEDCINLF 762
                +FQG +E+ + C  C   S   +  Y+ LSL +         + K  L +C+N F
Sbjct: 268 --YHKVFQGFLESTIECANCRKESKTTTEAYMDLSLDL---------KDKKTLYECLNSF 316

Query: 763 TSDEQLTNENAWDCPKCGTSASGTGPEEEKKK 794
              E+L  +  + C  CG      GP+   K+
Sbjct: 317 HMKEEL-KDFTFHCSNCG------GPQGALKQ 341

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 9/121 (7%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN---QLSKYFNVLF- 611
            GL N+G +CY+NS+LQC +              E   S  Y + N   QL K  N +  
Sbjct: 326 VGLINLGNSCYLNSILQCFYNGGIPNWSVEELGTEFPLSVVYPSNNLKCQLLKLTNAMKI 385

Query: 612 -KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
              +Y NG   + PT F K       +F   + QQD  EFL +++  L +++  +    N
Sbjct: 386 ESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTANNPN 441

Query: 671 D 671
           D
Sbjct: 442 D 442

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI-VLKNEQIMK-YRLYAIANHFGNL 909
           LP  L +HL RF Y   + +N      I YPL+L +    N  I K Y L  I  H G  
Sbjct: 520 LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
              GHY S+   +        K  W  FDDE V
Sbjct: 580 PQHGHYVSICKNE--------KYGWLLFDDEVV 604

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRD 582
           + G  N G TCY NS+LQCL+     RD
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRD 138

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 15/122 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           +P +L++HL RF Y   + +N      I YPL L +          +Y L  +  H G+ 
Sbjct: 557 VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY  +   +        K  W  +DDETV+       +     S   +  YVLFY+
Sbjct: 617 PQHGHYVCICKNE--------KFGWLLYDDETVESVSEETVLKFTGHSGDQTTAYVLFYK 668

Query: 969 KI 970
           +I
Sbjct: 669 EI 670

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+    FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 58/125 (46%), Gaps = 19/125 (15%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN------KVITYPLILSIVLKNEQIM--KYRLYAIANHFG 907
           LP +L++HL RF Y  +++NN        ITYP  L +    ++ +  KY L  I  H G
Sbjct: 549 LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 908 -NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLF 966
                GHY ++   +        K  W  +DDETV+  +    +     S   +  Y+LF
Sbjct: 607 AGPQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILF 658

Query: 967 YEKID 971
           Y+ I+
Sbjct: 659 YKTIE 663

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRD 582
           + G  N G TCY NS+LQCL+     RD
Sbjct: 126 VFGFENFGNTCYCNSVLQCLYNFSELRD 153

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 79/402 (19%), Positives = 136/402 (33%), Gaps = 107/402 (26%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYM 616
           GL N G TCY N+ +Q L    A +          Y  +    P  +++      K+M+ 
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEY--KSTIAPQSVTQVLAETTKRMWS 182

Query: 617 NGGCS---VVP---TGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
           N       + P    G L   N +  +++    Q+D+ E+ + L+S+L +          
Sbjct: 183 NESSKNQFINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLISRLQE---------- 228

Query: 671 DYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730
                               D+    H     I  + +IF G +   + C+ CG  S   
Sbjct: 229 --------------------DSVPRGHKLTESI--LYDIFGGLLRQEVTCKSCGEVSKTE 266

Query: 731 SVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEE 790
              Y LSL +    ++ SQ                              G SA  +   E
Sbjct: 267 QPIYDLSLHLKGKKNS-SQ------------------------------GESAKNSSEYE 295

Query: 791 EKKKKRFLLNPDTRASGNXXXXXXXXXXXXXXXXXXXXXQSSQQQNLEXXXXXXXXXXXX 850
           E+ ++RF +    R   N                       + ++               
Sbjct: 296 EEPQRRFSIEKSIRDFFN---------------PELIKADKATKEGYVCEKCHKTTNASK 340

Query: 851 XNF-ISLPTVLTIHLSRFFYDLT--KKNNKVITYPLILSIVLKNEQI-----MKYRLYAI 902
            NF +  P  L +HL +F ++ T   K  + ++YP+ L +    E       +KY+L ++
Sbjct: 341 HNFLLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLISV 400

Query: 903 ANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
             H G +L SGHY +           +    W  +DDE + K
Sbjct: 401 VVHEGRSLSSGHYIA--------HCKQPDGSWSTYDDEYINK 434

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 22/103 (21%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYPLILSIV---------LKNEQIMKYR 898
           F S P VL + L RF YD     L K N++   +P  + +          L N++   Y 
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPETIDVSPYIEKGSEQLSNKEACIYN 442

Query: 899 LYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           L+ +  H G++ +GHY +++   +         +WY FDD+ V
Sbjct: 443 LHGVLVHAGDISTGHYYTMIRPGV-------SDEWYRFDDDKV 478

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G +N G TCY+NS+LQ  F TK FR L
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRL 230

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 45/109 (41%), Gaps = 7/109 (6%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKY-TNPNQLSKYFNVLFKKMY 615
           G+ N+G TCY+N+ LQ LF     R+  L    +        T   QL +   V F+K+ 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLK 162

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLFLLSQL 658
              G ++ P   L+    + P F         + QQD +E    L   L
Sbjct: 163 DRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELFTQLFHTL 211

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
           Y L  +  H G N  SGHY + +  D D       +KWY FDD+ V   I    I++   
Sbjct: 415 YDLIGVITHQGANSESGHYQAFIRDDAD-------EKWYRFDDDKVTA-IEKEKIESLAG 466

Query: 956 SISSSDVYVLFYEKI 970
              S    +L Y+ +
Sbjct: 467 GGESDSALILIYKGL 481

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 61/131 (46%), Gaps = 31/131 (23%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV-----ITYPLILSIVLK-NEQI-MKYRLYAI-ANHFG 907
           LP  L +HL RF Y L +KN        I YPLILS+    N+ I  KY L +I  +  G
Sbjct: 504 LPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLGG 562

Query: 908 NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINH-------GDIDAGITSISSS 960
               GHY S+   D        K  W  FDDETV + IN        GD +   T+    
Sbjct: 563 GPHHGHYVSICKSD--------KFGWLLFDDETV-ESINEETVLKFVGDPEDQTTA---- 609

Query: 961 DVYVLFYEKID 971
             YVLFY +ID
Sbjct: 610 --YVLFYREID 618

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR-DLFLSTKYEHYFSRK 596
           I G  N G TCY NS+LQCLF    FR D+    + E    RK
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFRIDILKHPRKESIDGRK 163

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 15/139 (10%)

Query: 544 EQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQL 603
           EQ   ++  L + G +N+G TCY+N+ LQ L+     R++ L+       S       + 
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEET 156

Query: 604 SKYFNVLFKKMYMN----GGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLF 653
            K   +  K+ + N       SV+P   L       P F  R P    + QQD +E    
Sbjct: 157 HKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQ 216

Query: 654 LLSQLH----DELSESNRV 668
           L   ++    D+ SE  R+
Sbjct: 217 LSHSMNVVFGDKFSEDFRI 235

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY + +  +LD +      KWY F+D+ V
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 11/82 (13%)

Query: 891 NEQIMKYRLYAIANHFGNLISG-HYTSLV-NKDLDHDLNKGKQKWYYFDDETVKKDINHG 948
           +E+  KY L  +  H G   SG HYT  V +KDLD        KWY  DD  V +  N  
Sbjct: 699 SEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLD--------KWYRIDDVNVDEIKNKE 750

Query: 949 DI-DAGITSISSSDVYVLFYEK 969
           DI  +G ++  S   Y+L YEK
Sbjct: 751 DILRSGDSASDSRTAYILLYEK 772

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 74/198 (37%), Gaps = 46/198 (23%)

Query: 548 NEYVALSITGLRNIGCTCYVNSMLQCLF--ATKAFRDLFLSTKYEHYFSRKYTN-PNQLS 604
           NEY      GL N+G +CY+NS++Q L      ++   FL +++         N   Q  
Sbjct: 319 NEYGC----GLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVVYPANNLKCQWI 374

Query: 605 KYFNVLF--KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
           K  N +    K+Y NG   + PT F K       +F   + QQD  EFL FLL  L    
Sbjct: 375 KLLNAMKHEPKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSLDRNF 430

Query: 663 SESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQR 722
              N                                   G S  +++ +  ME+ L C +
Sbjct: 431 FSDNSA---------------------------------GASNPNDLMRFMMEDRLQCNK 457

Query: 723 CGHSSFNYSVFYVLSLAI 740
           CG   ++Y     + L +
Sbjct: 458 CGKVKYSYEPAEAIQLPL 475

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 15/120 (12%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKM 614
           + GL N G TC++NS+LQ L +++     FL    E       + PN+    F+V FK +
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAH-FLDDIIEE------SEPNKNELNFSVAFKTL 117

Query: 615 -------YMNGGCSVVPTGFLKAC-NALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
                  Y        P   LK   +    +  + +DQ+D QEF   ++SQL  +L + +
Sbjct: 118 LDKLNAKYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKKED 177

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
           YER151C
          Length = 917

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 33/140 (23%)

Query: 856 LPTVLTIHLSRFFY------------------DLTKKNNKVI-----TYPL--ILSIVLK 890
           LP VL I L RF +                   + K   K+I     T P+  + S  L+
Sbjct: 783 LPRVLLIQLKRFAFVTNSNKDSNMSNYNAYSGRIEKIRKKIIYGHDLTIPIESVSSTSLR 842

Query: 891 NEQIMKYRLYAIANHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGD 949
           ++   +Y+L  +  H G+    GHYT+ V        ++   KWY  DD  + +  N   
Sbjct: 843 DDANREYKLTGVIYHHGSSPDGGHYTADV-------FHQQTNKWYRIDDVNISELKNDHV 895

Query: 950 IDAGITSISSSDVYVLFYEK 969
           +DA    + +   Y+L YEK
Sbjct: 896 LDADDNDMGTRTAYILIYEK 915

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 50/121 (41%), Gaps = 15/121 (12%)

Query: 856  LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSIVLK-NEQIMK-YRLYAIANHFGNL 909
            LP  L++HL RF Y   +  N      + YPL L +    N  I K Y L  I  H G  
Sbjct: 959  LPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGGG 1018

Query: 910  IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
               GHY ++   D        K  W   DDETV+       +     S   +  YVLFY+
Sbjct: 1019 PQHGHYVAICKND--------KFGWLLMDDETVETISEETVLRCKGDSKDLTTAYVLFYK 1070

Query: 969  K 969
            +
Sbjct: 1071 E 1071

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           G  N G TCY NS+LQCL+     R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVL-KNEQIMKYRLY 900
           F S P VL + L RF YD     L K N++      +   P + S  L +N     Y+L+
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKIYKLH 443

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
            +  H G++ +GHY +L+           K +WY FDD+ V
Sbjct: 444 GVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRV 477

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 42/107 (39%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  + TK FR L      E        NPN       +  ++ +
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQIPTEG------ENPND---SVTLALQRAF 253

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S  P   ++   +   D      Q D QE    L+ +L   +
Sbjct: 254 YQLQVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRM 300

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           GL+N+G TCY+N+ LQ LF   + RDL L+
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILN 137

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 21/102 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYPLILS--------IVLKNEQIMKYRL 899
           F S P+VL + L RF YD     L K N++   +P  +         ++ KN     Y L
Sbjct: 383 FESFPSVLHLQLKRFEYDFNYDQLVKINDRY-EFPETIDLSPYLDPDVLKKNPGPCVYNL 441

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           + +  H G +  GHY +++  D+      G Q W+ FDD+ V
Sbjct: 442 HGVLVHSGEISVGHYYAMIKPDV------GDQ-WFRFDDDKV 476

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDL 583
           GL+N G TCY+NS+LQ  F TK FR +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKI 229

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 7/122 (5%)

Query: 544 EQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQL 603
           E +  ++++ +  GL+N+G TCY+NS LQ L+  K  RD  L+ K       +  + +QL
Sbjct: 48  EGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPREKPSEEQH-HQL 106

Query: 604 SKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLFLLSQ 657
                  F+++      SV P   L       P F         + QQD +E    + + 
Sbjct: 107 VSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIFNS 166

Query: 658 LH 659
           L 
Sbjct: 167 LR 168

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 101/237 (42%), Gaps = 24/237 (10%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP-NQLSKYFNVLFKKMY 615
           GL N+G TC+++S+LQ L       +   S    HY   +  NP +  S   +++  + Y
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNY--SMCQTHYNMCQSKNPLSCTSCALDLIITEFY 195

Query: 616 M--NGGCSVVPTGFLKACNAL---RPDFRIPHDQQDTQEFLLFLLSQLHDELS-ESNRVA 669
              + G +   TGF+   N+L     +F   + QQD  EFL F+L+Q+H++    S    
Sbjct: 196 ATESKGNNSSHTGFISLLNSLLQVNENFA-GYSQQDAHEFLQFILNQIHNDYKLNSMEDV 254

Query: 670 NDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISP---IDNIFQGQMENGLFCQRCGH- 725
           N                    +     HI  N +S      + FQG +++ + C +C + 
Sbjct: 255 NSGNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVSCKCLSHSNFQGSLKSSILCPQCNND 314

Query: 726 SSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKCGTS 782
           S      F  LSL +         + K  L  C++ F   E+L + N + C +C ++
Sbjct: 315 SKTTIDPFMDLSLDV---------KDKSNLYQCLDSFHKLEKLHDFN-FHCSECNST 361

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 15/121 (12%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAIANHFGNL 909
           LP +L++HL RF Y   +++N      I YPL L +     +    KY L  +  H G+ 
Sbjct: 546 LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 910 IS-GHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYE 968
              GHY  +   +        K  W  +DDETV+       +         +  YVLFY+
Sbjct: 606 PQHGHYVCICKNE--------KFGWLLYDDETVESIREETVLKFTGHPGDQTTAYVLFYK 657

Query: 969 K 969
           +
Sbjct: 658 E 658

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + G  N G TCY NS+LQCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFR 151

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 43/107 (40%), Gaps = 9/107 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G RN G TCY+NS+LQ  F TK FR L      E         PN       +  ++ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYKIPTES------ETPNS---SVPLALQRAF 251

Query: 616 MNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
                S +P   L+   +   D      Q D QE    L+ +L + +
Sbjct: 252 YQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 298

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 21/104 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYPLILSIV--------LKNEQIMKYRL 899
           F S P +L + L RF YD     L K N++   +P                N +   Y L
Sbjct: 382 FESFPPILHLQLKRFEYDFNFDQLIKINDRY-EFPESFDTSPYMEKKEDGSNNEPCIYNL 440

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
           + +  H G++ +GHY +++  DL+        +WY FDDE V K
Sbjct: 441 HGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKVWK 477

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/29 (58%), Positives = 20/29 (68%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           GL NIG TCY+NS+LQ  F+ K  RD  L
Sbjct: 763 GLNNIGNTCYLNSLLQYYFSIKPLRDFIL 791

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 70/188 (37%), Gaps = 42/188 (22%)

Query: 557 GLRNIGCTCYVNSMLQCLF--ATKAFRDLFLSTKYEHYFSRKYTN-PNQLSKYFNVLFKK 613
           GL N+G +CY+NS+LQCLF    K +    L   +         N   QL K  N + K 
Sbjct: 324 GLINLGNSCYLNSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAM-KV 382

Query: 614 MYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYP 673
              N    + P  F K       +F     QQD+ EFL +L+  L               
Sbjct: 383 EPQNYPEGIRPKSFKKCVGQSHEEFSSGR-QQDSMEFLGYLVDVL--------------- 426

Query: 674 GXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVF 733
                                +K I +NG +P D + +  ME+ L C  CG   ++    
Sbjct: 427 ---------------------DKKIFKNGSNPND-LMKFTMEDRLQCTNCGKVKYSSEAA 464

Query: 734 YVLSLAIP 741
             L L +P
Sbjct: 465 ESLQLPMP 472

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 101/261 (38%), Gaps = 53/261 (20%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           S  T +P +E+         ++GL N+G TC+++S+LQCL     F  +  S    H+  
Sbjct: 122 STKTVVPIMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF--IKHSMSQSHFNK 173

Query: 595 RKYTNP-NQLSKYFNVLFKKMYMNGGCSVVPT---------GF--LKACNALRPDFRIPH 642
            K  +P N  S   + +  ++Y        P+         GF  L  C          +
Sbjct: 174 CKVRSPDNCFSCALDKIVHELYGVLNTDQPPSSSSATNRQAGFIYLLTCAWKINQNLAGY 233

Query: 643 DQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENG 702
            QQD  EF  F+++Q+H     S                       E D    KH     
Sbjct: 234 SQQDAHEFWQFIINQIHQNYVLS------------------LPSTKESDKENIKHCD--- 272

Query: 703 ISPIDNIFQGQMENGLFCQRC-GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINL 761
              +  +F+G +E+ + C  C  +S      F  LSL I         + K +L +C++ 
Sbjct: 273 -CIVHTVFEGSLESSIVCPSCQNNSKTTIDPFMDLSLDI---------KDKKKLYECLDS 322

Query: 762 FTSDEQLTNENAWDCPKCGTS 782
           F   E L + N + C +C ++
Sbjct: 323 FHKKELLKDFN-YHCGECNST 342

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 42/133 (31%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSIV-----------LKNEQI--MKYRL 899
           LP+VL + L RF + L   N K+   I +P  L++            + N+++  + Y L
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNKKVPDIIYEL 413

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISS 959
             I +H G +  GHY +         ++ G  +W+ F+D  V             +SIS 
Sbjct: 414 IGIVSHKGTVNEGHYIAFCK------ISGG--QWFKFNDSMV-------------SSISQ 452

Query: 960 SDV-----YVLFY 967
            +V     Y+LFY
Sbjct: 453 EEVLKEQAYLLFY 465

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 38/94 (40%), Gaps = 19/94 (20%)

Query: 551 VALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFL-----STKY---EHYFSRKYTNPNQ 602
           VA    G+ N+G TCY+NS+LQ  F  K  RD  L     S K      Y SR+     +
Sbjct: 693 VATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGGRE 752

Query: 603 LSK-----------YFNVLFKKMYMNGGCSVVPT 625
           +SK           +   LF  M       V PT
Sbjct: 753 VSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPT 786

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 51/131 (38%), Gaps = 14/131 (10%)

Query: 552 ALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLF 611
           A S  G +N+G TCY+N+ LQ L+     RD+ L+       S       +  K   +  
Sbjct: 105 AQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEM 164

Query: 612 KKMYMN----GGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLFLLSQLH-- 659
           K+ + N       SV+P   L       P F         + QQD +E    L   +   
Sbjct: 165 KRCFENLHNKSFKSVLPIVLLNTLRKCYPQFAERDQQGGFYKQQDAEELFTQLFHSMSVV 224

Query: 660 --DELSESNRV 668
             D+ SE  R+
Sbjct: 225 FGDKFSEDFRI 235

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 8/73 (10%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
           Y L  +  H G N  SGHY + +  +LD +      KWY F+D+ V   +    I++   
Sbjct: 431 YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKVTA-VEKEKIESLAG 483

Query: 956 SISSSDVYVLFYE 968
              S    +L Y+
Sbjct: 484 GGESDSALILMYK 496

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 100/258 (38%), Gaps = 53/258 (20%)

Query: 538 TAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKY 597
           T +P++E+         ++GL N+G TC+++S+LQCL     F  +  S    H  + K 
Sbjct: 125 TMVPSMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF--IRHSMSQIHSNNCKV 176

Query: 598 TNPNQ-----LSKYFNVLFKKMYMNGGCSVVP-----TGF--LKACNALRPDFRIPHDQQ 645
            +P++     L K  + L+  +      S        TGF  L  C          + QQ
Sbjct: 177 RSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQ 236

Query: 646 DTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISP 705
           D  EF  F+++Q+H           D P                                
Sbjct: 237 DAHEFWQFIINQIHQSY------VLDLPNAKEVSRANNKQCE----------------CI 274

Query: 706 IDNIFQGQMENGLFCQRC-GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTS 764
           +  +F+G +E+ + C  C  +S      F  LSL I         + K +L +C++ F  
Sbjct: 275 VHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDI---------KDKKKLYECLDSFHK 325

Query: 765 DEQLTNENAWDCPKCGTS 782
            EQL + N + C +C ++
Sbjct: 326 KEQLKDFN-YHCGECNST 342

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 55/135 (40%), Gaps = 46/135 (34%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSIVLKNEQIMK---------------Y 897
           LP+VL + L RF + L   N K+   I +P  L+  +KN    K               Y
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLN--MKNYCSTKEKDKHSENGKVPDIIY 411

Query: 898 RLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSI 957
            L  I +H G +  GHY +         ++ G  +W+ F+D  V             +SI
Sbjct: 412 ELIGIVSHKGTVNEGHYIAFCK------ISGG--QWFKFNDSMV-------------SSI 450

Query: 958 SSSDV-----YVLFY 967
           S  +V     Y+LFY
Sbjct: 451 SQEEVLKEQAYLLFY 465

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
           similar to uniprot|Q01477 Saccharomyces cerevisiae
           YER151C UBP3 Ubiquitin-specific protease that interacts
           with Bre5p to co-regulate anterograde and retrograde
           transport between endoplasmic reticulum and Golgi
           compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 63/146 (43%), Gaps = 43/146 (29%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLILSI-------VL 889
           LP VL I L RF F + T K+N ++ Y                   LI+ I         
Sbjct: 693 LPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELIIPIESISSANAY 752

Query: 890 KNEQIMKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV----KKD 944
           K+E   +Y L  +  H G +   GHYT+    D+ H   +   KWY  DD ++    K+D
Sbjct: 753 KDEN-RRYHLTGVIYHHGVSSDGGHYTA----DVYH---RESDKWYRIDDVSIIELEKED 804

Query: 945 INHGDIDAGITSISSSDVYVLFYEKI 970
           +  G  ++G     S   Y+L Y+KI
Sbjct: 805 VLKGGEESG----DSRTAYILMYQKI 826

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 86/232 (37%), Gaps = 52/232 (22%)

Query: 557 GLRNIGCTCYVNSMLQCLF--ATKAFRDLFLSTKYEHYFSRKYTNPN-----QLSKYFNV 609
           GL N+G +CY+NS++QCL       + D  L     H F +    P      Q+ K  N 
Sbjct: 343 GLINLGNSCYLNSVMQCLLNGGVPNWSDK-LGNIIGHDFPKDVIYPTGNLRCQMIKLLNA 401

Query: 610 --LFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNR 667
             L  + Y  G   + P  F +       +F+  ++QQD+ EFL F+  +L   L     
Sbjct: 402 FKLNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEELEKGL----- 452

Query: 668 VANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSS 727
               +P                        I +  I+P +N+ +  ME+ L C  C +  
Sbjct: 453 ----FP-----------------------KIQDASINP-NNLLKFIMEDKLQCVECKNVK 484

Query: 728 FNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           + Y     + L +           +  +E   + F  +E       + CP C
Sbjct: 485 YTYQPNECIQLPLKEGNDLVGTTTQNLMELITDYFQGEEI-----EFSCPTC 531

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 21/30 (70%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           G +N+G TCY+NS LQ L+  K  R+L LS
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILS 138

 Score = 36.2 bits (82), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY S +  D D D      KWY F+D+ V
Sbjct: 431 YELVGVITHQGANSESGHYQSFIRDDYDED------KWYKFNDDKV 470

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRD 582
           TGL NIG TCY+NS+LQ  FA    RD
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYE 590
           G +N+G TCY+NS LQ LF     +D+ L+ K E
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYKTE 143

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  I  H G N  SGHY S +  + D D      KWY F+D+ V
Sbjct: 436 YDLIGIITHQGANSESGHYQSFIRDENDED------KWYKFNDDKV 475

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 88/229 (38%), Gaps = 54/229 (23%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHY-FSRKYTNPN---QLSKYFNV--L 610
           GL N+G +CY+NS+LQCL      +   LS   E +     Y + N   QL K  N   L
Sbjct: 323 GLINLGNSCYINSVLQCLL-NGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIKL 381

Query: 611 FKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
             ++Y +G   + P  F K       +F     QQD  EFL F                 
Sbjct: 382 EPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFF---------------- 421

Query: 671 DYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730
                               DT  +K  S +  +P D + +  +EN L C +CG     Y
Sbjct: 422 -------------------NDTLDKKIFSRSENNPSD-LMRYIIENRLQCTKCG--KVKY 459

Query: 731 SVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
           +     S+ +P   ++ SQ  +  L+  +  F  +E       + CP+C
Sbjct: 460 TTDINESMLVPLEENSDSQHSQSLLDRLVEYFHGEEL-----DFKCPQC 503

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 52/122 (42%), Gaps = 17/122 (13%)

Query: 542 TIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP- 600
           T EQ   ++  + I G +N+G TCY+N+ LQ L+     RD  L+        +   N  
Sbjct: 94  TPEQQVQQFNDIPI-GFKNMGNTCYLNATLQALYRIDDLRDAVLNFDVSINNDKNGENET 152

Query: 601 -----NQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQE 649
                 +L + F  L  K +     SV+P   L A     P F  R P    + QQD +E
Sbjct: 153 HIKLVTELKRCFEGLKNKSFK----SVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEE 208

Query: 650 FL 651
            L
Sbjct: 209 LL 210

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL--STKYEHYFSRK 596
           TG+ NIG TCY+NS+LQ  F+    R+  L  S  YE ++  K
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 40.0 bits (92), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 49/104 (47%), Gaps = 21/104 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYP--LILSIVLKNE------QIMKYRL 899
           F S P VL + L RF YD     L K N++   +P  + LS  L  E         KY L
Sbjct: 371 FESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEVQEDSPANAKYNL 429

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
           + +  H G++ +GHY +++   L+         WY FDD+ V +
Sbjct: 430 HGVLVHTGDISTGHYYAMIKPGLE-------DAWYRFDDDKVWR 466

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            GL+N G TCY+NS+LQ  + TK FR L
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKL 217

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 39.7 bits (91), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 87/229 (37%), Gaps = 54/229 (23%)

Query: 557 GLRNIGCTCYVNSMLQCLFA--TKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKM 614
           GL N+G +CY+NS+LQ LFA     + D+ + T  + +        N +      L   M
Sbjct: 320 GLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSNNVKCQLIKLLNAM 379

Query: 615 YMNGGCSVVPTGF----LKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
            +N   S  P G      K C          + QQD  EFL + +++L  +L        
Sbjct: 380 KINP--SRYPEGIKPRSFKNCIGQNNKEFTSNKQQDALEFLSYFVNELDKKL-------- 429

Query: 671 DYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730
                                  F+K ++  G     ++ +  ME+ L C RC H  ++Y
Sbjct: 430 -----------------------FKKELTNPG-----DLMRCYMEDRLQCLRCKHVKYSY 461

Query: 731 SVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779
                 S+ +P   +   Q  + RL+     F   E +     ++CP C
Sbjct: 462 QANE--SIQLPLKDNNEPQDIRERLD----AFFKGEVI----EFNCPHC 500

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 39.7 bits (91), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 49/127 (38%), Gaps = 14/127 (11%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMY 615
            G +N+G TCY+N+ LQ L+     RD+ L+       S       +  K   +  K+ +
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCF 168

Query: 616 MN----GGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLFLLSQLH----DE 661
            N       SV+P   L       P F         + QQD +E    L   +     D+
Sbjct: 169 ENLQNKSFKSVLPIVLLNTLRKCYPQFAERDAQGGFYKQQDAEELFTQLFHSMSVVFGDK 228

Query: 662 LSESNRV 668
            SE  R+
Sbjct: 229 FSEEFRI 235

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY + +  +LD +      KWY F+D+ V
Sbjct: 430 YNLIGVITHQGANSESGHYQAFIRDELDEN------KWYKFNDDKV 469

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 44/120 (36%), Gaps = 21/120 (17%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN-----QLSKYFNVLF 611
           GLRN+G TCY N+ LQ L+  K  R+  L+          Y  PN     QL       F
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA----------YNEPNPDLHGQLVIQLRNCF 156

Query: 612 KKMYMNGGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLFLLSQLHDELSES 665
                       P   L     + P F  + P    + QQD +E    LL  +     ES
Sbjct: 157 NAFAQRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTIDTVFGES 216

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 7/46 (15%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           Y L  +  H G N  SGHY + V  D D +      KWY ++D+ V
Sbjct: 415 YNLIGVVTHQGANSDSGHYQAFVRDDADEN------KWYKYNDDKV 454

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQL 603
           TG+ NIG TCY+NS+LQ  FA    R+  +  +Y+   +   +NP+ +
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV--QYQKTIADLSSNPDSI 767

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
           YER151C
          Length = 795

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 58/141 (41%), Gaps = 35/141 (24%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLILSI-------VL 889
           LP VL I L RF F + T K+N +I Y                   L++ I        L
Sbjct: 662 LPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIESISSTNAL 721

Query: 890 KNEQIMKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHG 948
           ++E   +Y L  +  H G +   GHYT+    D+ H   K   KWY  DD  + +     
Sbjct: 722 RDED-RQYSLSGVIYHHGLSSDGGHYTA----DVYH---KETDKWYRIDDINITEVQKDS 773

Query: 949 DIDAGITSISSSDVYVLFYEK 969
            +  G   + S   Y+L Y+K
Sbjct: 774 VLKGGEDGVDSRTAYILMYQK 794

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           TGL NIG TCY+NS+LQ  F+    RD  L+
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVLN 731

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 17/101 (16%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKV-----ITYPLILSIVLKNEQIMKYRLYAI 902
           F S P VL + L RF YD     L K N++      I     L      +    Y L+ +
Sbjct: 377 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 903 ANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
             H G++ +GHY +++  D           WY FDD+ V K
Sbjct: 437 LVHSGDISTGHYYAMIQPD-------AHGSWYRFDDDRVIK 470

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 554 SITGLRNIGCTCYVNSMLQCLFATKAFRDL 583
              G +N G TCY+NS+LQ    TK FR L
Sbjct: 195 GFVGFKNQGATCYLNSLLQSYHFTKLFRKL 224

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G +N G TCY+NS+LQ  F TK FR L
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKL 233

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 46/102 (45%), Gaps = 21/102 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYP--------LILSIVLKNEQIMKYRL 899
           F S P VL + L RF YD     L K N++   +P        L   I   N     Y L
Sbjct: 387 FESFPPVLHLQLKRFEYDFNYDQLIKINDRY-EFPESIDLSPYLDPEISSSNADSYIYDL 445

Query: 900 YAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           + +  H G++ +GHY +++   ++        +WY FDD+ V
Sbjct: 446 HGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKV 480

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 18/96 (18%)

Query: 856 LPTVLTIHLSRFFYDL---TKKNNKVITYPLILSIVLKNEQI-------MKYRLYAIANH 905
           LP VL + L RF + +   + K N+ I YP  L++     Q        M Y L A+ +H
Sbjct: 343 LPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMYELVAVISH 402

Query: 906 FGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
            G++  GHYTS+           G Q W+ F+D  +
Sbjct: 403 EGSVNQGHYTSMCKI-------PGGQ-WFRFNDSMI 430

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 54/127 (42%), Gaps = 36/127 (28%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKV---ITYPLILSIV-------LKNEQIMKYRLYAIANH 905
           LP VL + L RF + +   N K+   ITYP  L++         ++   M Y L A+ + 
Sbjct: 342 LPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVYELVAVISQ 401

Query: 906 FGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDV--- 962
            G++  GHYT +           G Q W+ F+D               I SI+  DV   
Sbjct: 402 EGSVNQGHYTCMCKV-------PGGQ-WFRFNDTM-------------IVSITEEDVLRQ 440

Query: 963 --YVLFY 967
             Y+LFY
Sbjct: 441 QAYLLFY 447

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 57/134 (42%), Gaps = 30/134 (22%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDL--FLSTKYEHYFSRKYTNPNQL---------SK 605
           G+ N G  C+++S+LQ L   + F  L   +S K     S K  N   L          K
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKT----SAKMGNTGFLLLDACLELYRK 65

Query: 606 YFNVLF---KKMYMNGGCSVV---------PTGFLKACNALRP--DFRIPHDQQDTQEFL 651
           +  V F   K   +N G S +         P  F K  + L    D R  H Q+D +EFL
Sbjct: 66  FDKVTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRWGH-QEDAEEFL 124

Query: 652 LFLLSQLHDELSES 665
             LL QLH+E  +S
Sbjct: 125 THLLDQLHEEFVQS 138

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 38.9 bits (89), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 65/149 (43%), Gaps = 41/149 (27%)

Query: 857 PTVLTIHLSRFFYDLTK--KNNKVITYPLILSIVLKNE------QIMKYRLYAIANHFGN 908
           P++L++HLSR  ++     +N   + YP  L IVL+ +      + + YRL ++  H G 
Sbjct: 328 PSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERITYRLRSMIKHTGT 386

Query: 909 LISGHYTSLVNK-DLDHDLNKG-------------------------KQKW-YYFDDETV 941
             SGHY    +K DL   +  G                          ++W Y+F  + V
Sbjct: 387 HYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAV 446

Query: 942 KKDINHGDIDAGITSISSSDVYVLFYEKI 970
            ++ N G +        S  VY+LFYE++
Sbjct: 447 VRESNAGKMLR-----ESKYVYMLFYERV 470

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 23/99 (23%)

Query: 856 LPTVLTIHLSRFFYDL---TKKNNKVITYPLILSI--------VLKNEQIMKYRLYAIAN 904
           LP VL + L RF + +   + K N  I++PL L++         L     M Y+L AI +
Sbjct: 357 LPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMMYKLSAIIS 416

Query: 905 HFGNLISGHYTSL--VNKDLDHDLNKGKQKWYYFDDETV 941
           H G +  GHYT++  +N D+          W  F+D  V
Sbjct: 417 HHGTVHQGHYTTICRINGDI----------WAKFNDSMV 445

>Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON}
           YER151C (REAL)
          Length = 909

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 59/145 (40%), Gaps = 37/145 (25%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLIL------SIVLK 890
           LP VL I L RF F +   K+N +  Y                   LI+      SI LK
Sbjct: 771 LPQVLLIQLKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 830

Query: 891 NEQI----MKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDI 945
           N        +Y+L  +  H G +   GHYT+    D+ H   K   KWY  DD  + +  
Sbjct: 831 NHTSGVDDRRYKLTGVIYHHGVSSDGGHYTA----DVYH---KEHNKWYRIDDVNITELE 883

Query: 946 NHGDIDAGITSISSSDVYVLFYEKI 970
           +   +  G  +  S   Y+L Y+K+
Sbjct: 884 DDDVLKGGEEASDSRTAYILMYQKV 908

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 58/144 (40%), Gaps = 40/144 (27%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITYPLILS--------------IVLKNEQI------ 894
           LP VL + L RF F +   K+N ++ Y  I                +V+  E +      
Sbjct: 722 LPQVLLVQLKRFSFVNNEDKDNNMMNYNSINGRIEKIRKKISYGHELVIPEESLSPHSWS 781

Query: 895 ---MKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDD----ETVKKDIN 946
               KY+L  +  H G +   GHYT+ V        NK   KWY  DD    E  K D+ 
Sbjct: 782 QTNRKYQLTGVIYHHGLSSDGGHYTADV-------FNKTADKWYRIDDINITELKKDDVL 834

Query: 947 HGDIDAGITSISSSDVYVLFYEKI 970
            G  D   T  +    Y+L Y+K+
Sbjct: 835 KGGEDGTDTRTA----YILMYQKL 854

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDL 583
            G +N G TCY+NS+LQ  F TK FR L
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRL 220

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNKVITYPLILSIVLKNEQIMK---------YR 898
           F S P VL + L RF YD     L K N++   +P  + +    +++           Y+
Sbjct: 374 FESFPPVLHLQLKRFEYDFNYDQLIKVNDRY-EFPDSIDVSSYIDKMGTEDTEMPPCIYK 432

Query: 899 LYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
           L+ +  H G++ +GHY +++    +        +WY FDDE V K
Sbjct: 433 LHGVLVHAGDISTGHYYAMIKPSTE-------DQWYRFDDEKVWK 470

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLF 584
           TG+ NIG TCY+NS+LQ  F+   FR+  
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFREFI 786

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 38.5 bits (88), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 103/258 (39%), Gaps = 59/258 (22%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCL----FATKAFRDLFLSTKYE 590
           S  ++IP++E+         + GL N+G TC+++S++Q L    +  K   D   ST  +
Sbjct: 121 STKSSIPSVEKRN------GLAGLVNMGSTCFMSSIIQTLIHNPYILKHSMDQLHSTTCD 174

Query: 591 HYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPT---GF--LKACNALRPDFRIPHDQQ 645
              S        +S   + +    Y         T   GF  L +C+  +      + QQ
Sbjct: 175 LQNSSSC-----MSCAVDQIISDFYGASKSETSETNQQGFVNLLSCSWRKNKNLAGYSQQ 229

Query: 646 DTQEFLLFLLSQLH-DELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGIS 704
           D  EF  FLL+QLH D L  +N+ A+                  + D     H S     
Sbjct: 230 DAHEFWQFLLNQLHNDHLRATNQKAS-----------------LKNDCNCISHRS----- 267

Query: 705 PIDNIFQGQMENGLFCQRCGHS-SFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFT 763
                FQG +++ + C  C +       +   LSL I         + K  L +C++ F 
Sbjct: 268 -----FQGFLKSSIVCPECQNDRKTTIDLMMDLSLDI---------KNKSTLHECLDNFH 313

Query: 764 SDEQLTNENAWDCPKCGT 781
             EQLT+ N + C KC T
Sbjct: 314 KKEQLTDFN-YHCEKCNT 330

 Score = 35.4 bits (80), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 36/127 (28%)

Query: 856 LPTVLTIHLSRFFYDL---TKKNNKVITYP--LILSIVLKNEQI-----MKYRLYAIANH 905
           LP VL + L RF + +   + K N  I +P  L +S   + +++     + Y L  + +H
Sbjct: 343 LPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIVYELIGLISH 402

Query: 906 FGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISSSDV--- 962
            G++  GHYTS+           G Q W+ F+D  V             T+++  DV   
Sbjct: 403 QGSVNQGHYTSICKI-------PGGQ-WFKFNDSMV-------------TAVAEIDVLKE 441

Query: 963 --YVLFY 967
             Y+LFY
Sbjct: 442 QAYLLFY 448

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 38.5 bits (88), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 23/101 (22%)

Query: 710 FQGQMENGLFCQRCGH-SSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFTSDEQL 768
            +G + N L C RCGH S     +F +  L +P  +S+       +L D I+    + QL
Sbjct: 191 MKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQCSSS-------KLTDIIH----NNQL 239

Query: 769 TNENAWDCPKCGT-----------SASGTGPEEEKKKKRFL 798
                + C  C             S   TG +EEK+K R+L
Sbjct: 240 EKIEGYSCLYCEINMILKNENYRNSDGFTGDDEEKRKLRYL 280

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 38.1 bits (87), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 48/120 (40%), Gaps = 17/120 (14%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN------QLSKYFNVL 610
           G+ N+G TCY+N+ LQ L+     R+  L+     +  +K T         QL +     
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILA-----FDDKKATAEGMDLYHVQLIREIQAT 115

Query: 611 FKKMYMNGGCSVVPTGFLKACNALRPDFRIP------HDQQDTQEFLLFLLSQLHDELSE 664
           F+K+    G ++ P   L+    + P F         + QQD +E    L   +     E
Sbjct: 116 FRKLRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQTVFGE 175

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 50/246 (20%), Positives = 90/246 (36%), Gaps = 61/246 (24%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYM 616
           GL N G TCY N+ +Q L    A +          Y  +   +PN +++      K+M+ 
Sbjct: 378 GLLNHGVTCYTNAAVQALIHIPAIQHYLFDVLRGEY--KSTISPNSVTQVLAETSKRMWS 435

Query: 617 NGGCS---VVPT---GFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
                   + P    G L+  N +  +++    Q+D+ E+ + L+S+L +          
Sbjct: 436 TDASKNQFINPKKLIGRLEDINCMMSEWQ----QEDSHEYFMSLISRLQE---------- 481

Query: 671 DYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNY 730
                               D+    H     I  + +IF G +   + C+ CG  S   
Sbjct: 482 --------------------DSVPRGHKLTESI--LYDIFGGMLRQEVTCKSCGEVSKTE 519

Query: 731 SVFYVLSLAIPS-----------STSTFSQRKKVR--LEDCINLFTSDEQL----TNENA 773
              Y +SL +             ++S F +  + R  +E  I  F + E +     N+  
Sbjct: 520 QPIYDISLHLKGKKNSDSADTAKNSSDFEEEPQRRFSIEKSIRDFFNPELIKVDKANKEG 579

Query: 774 WDCPKC 779
           + C KC
Sbjct: 580 YVCEKC 585

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ 602
           TGL NIG TCY+NS+LQ  F     RD      YE   S    N NQ
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRDYI--QNYEDTASDLLLNMNQ 740

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 53/124 (42%), Gaps = 15/124 (12%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN---QLSKYFNVLF- 611
            GL N+G +CY+NS+LQ LF              E      Y + N   QL K  N +  
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMKI 381

Query: 612 -KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAN 670
             + Y NG   + PT F K C A   +      QQD+ EF  FL+ QL        +V N
Sbjct: 382 EPERYPNG---IKPTSF-KRCIAQAHEEFSSSRQQDSMEFFTFLIEQL------DKKVLN 431

Query: 671 DYPG 674
            + G
Sbjct: 432 KFVG 435

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 19/141 (13%)

Query: 542 TIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDL---FLSTKYEHYFS---- 594
           ++   P++Y     TGL N G  CY NS++Q L +   F D    F+    E+  S    
Sbjct: 62  SLASRPDKYT----TGLVNKGNYCYANSVIQALSSIDYFSDYINKFVIGIDENEISSAGL 117

Query: 595 -RKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTG----FLKACNALRPDFRIPHDQQDTQE 649
            +  T    L +    L +K+ M       PT      L +    +   R+   Q D  E
Sbjct: 118 EKTDTEALLLHRALADLLRKLQM---VIFEPTNADIKHLVSVLEWKVSGRLSRAQNDAHE 174

Query: 650 FLLFLLSQLHDELSESNRVAN 670
           FL  LL QLH ELS S++ ++
Sbjct: 175 FLQVLLEQLHVELSNSHKTSS 195

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTN 599
           TG+ NIG TCY+NS+LQ  F     R+  L+  Y+H  S    N
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA--YDHTASNLLNN 718

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 89/223 (39%), Gaps = 53/223 (23%)

Query: 531 NGNYSKHTAIPT---IEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFR----DL 583
           N N + H ++ +   I+   +++  L   GL N G TCY N+ +Q +    A +    D+
Sbjct: 316 NENANDHGSLNSTRVIKNWGDQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDV 375

Query: 584 FLSTKYEHYFSR---KYTNPNQLSKYFNVLFKKMYMNGGCSVV-PTGF---LKACNALRP 636
            L  KY+   S+    YT      K +  L K    N   S + P      L   N +  
Sbjct: 376 LLG-KYDSTISKNSVSYTLAETSKKMWLPLSKNYKKNSPASYINPKHLISRLDDINCMMS 434

Query: 637 DFRIPHDQQDTQEFLLFLLSQLH-DELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFE 695
           +++    Q+D+ E+ + L+S+L  D + + +++                           
Sbjct: 435 EWQ----QEDSHEYFMSLMSRLQEDSVPKGHKLIE------------------------- 465

Query: 696 KHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSL 738
                   S I +IF G ++  + C+ CG +S     FY LSL
Sbjct: 466 --------SIIYDIFGGLLKQIVTCKSCGSTSKTEQPFYDLSL 500

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 54/141 (38%), Gaps = 33/141 (23%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNN----------------KVITYPLILSI--------VLK 890
           LP +L I L RF F     K+N                K I+Y   L I         L+
Sbjct: 681 LPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR 740

Query: 891 NEQIMKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGD 949
           N     Y L  +  H G +   GHYT+ V        +K  + WY  DD  + K  +   
Sbjct: 741 NNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDDVNITKLEDDDV 793

Query: 950 IDAGITSISSSDVYVLFYEKI 970
           +  G  ++ S   Y+L Y+ +
Sbjct: 794 LKGGEDNMDSRTAYILMYQNV 814

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDL 583
           G +N G TCY+NS+LQ  F TK FR +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKM 229

 Score = 36.2 bits (82), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 19/103 (18%)

Query: 853 FISLPTVLTIHLSRFFYD-----LTKKNNK------VITYPLILSIVLKN-EQIMKYRLY 900
           F S P VL + L RF YD     L K N++      +   P +   V  N      Y L+
Sbjct: 383 FESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCIYNLH 442

Query: 901 AIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKK 943
            +  H G++ +GHY +++  ++         +W+ FDD+ V K
Sbjct: 443 CVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWK 478

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TGL NIG TCY+NS+LQ  F+  + R   L
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLRQYVL 762

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
            GL+N+G TCY+NS LQ L+  +  R+  L
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLREEIL 135

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
            GL NIG TCY+NS+LQ  FA    R+  ++
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLIN 792

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 21/114 (18%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN---------QLSKYF 607
           G +N+G TCY+N+ LQ L+ T   R + L   Y+        NP          ++ + F
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILD--YKPPAQSSTYNPEDEMHHKIVLEIKRCF 169

Query: 608 NVLFKKMYMNGGCSVVPTGFLKACNALRPDF--RIP----HDQQDTQEFLLFLL 655
             L KK +     SV+P   L       P F  R P    + QQD +E    L 
Sbjct: 170 ENLEKKNFK----SVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELFTQLF 219

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 9/111 (8%)

Query: 557 GLRNIGCTCYVNSMLQCLF--ATKAF-RDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKK 613
           GL N+G +CY+NS LQCLF    K +  D+  ++   +         +QL+K    L ++
Sbjct: 332 GLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEE 391

Query: 614 --MYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
             +Y  G   + P  F K       +F     QQD  EF  + + +L  +L
Sbjct: 392 PTIYKQG---IRPKSFKKCIGGSHEEFSSGR-QQDALEFFTYFVDELDKKL 438

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTK 588
           GL NIG TCY+NS+LQ  F+    R+  L+ K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 31/71 (43%), Gaps = 10/71 (14%)

Query: 511 QNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSM 570
           +N T   NE   H  P LS +          T +  P    +  + G  N G TCY NS+
Sbjct: 111 ENFTESPNESVDHCFPVLSTH----------TTDLLPYGDGSNKVFGYENFGNTCYCNSV 160

Query: 571 LQCLFATKAFR 581
           LQCL+    FR
Sbjct: 161 LQCLYNLTEFR 171

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 56/126 (44%), Gaps = 17/126 (13%)

Query: 856 LPTVLTIHLSRFFYDLTKKNN----KVITYPLILSI--VLKNEQIMKYRLYAI-ANHFGN 908
           LP +L +HL RF Y  T+  N      I YPL L +     +    +Y L  I  +  G 
Sbjct: 558 LPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMGGG 617

Query: 909 LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISS-SDVYVLFY 967
              GHY SL   +        K  W  FDDETV+  ++   +      +   +  YVLFY
Sbjct: 618 PHHGHYVSLCKNE--------KFGWLLFDDETVES-VDESSVMKFCGDLHDLTTAYVLFY 668

Query: 968 EKIDES 973
           ++I+ S
Sbjct: 669 KEINGS 674

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 6/47 (12%)

Query: 896 KYRLYAIANHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           KY+L A+  H GN + SGHY + + K ++     GK++W  ++DE +
Sbjct: 704 KYKLTAVICHKGNSVHSGHYVAFIKKVVE-----GKEQWVLYNDEKI 745

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 47/111 (42%), Gaps = 10/111 (9%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN---QLSKYFNV--LF 611
           GL N+G +CY+NS+LQ L      R+  L           Y   N   QL K  N   L 
Sbjct: 317 GLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLHCQLIKIRNAMTLQ 375

Query: 612 KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
           +  Y  G   + PT F K       +F     QQD+ EF  +L  +L  E+
Sbjct: 376 QSRYPEG---IKPTTFKKVIGGSHEEFSSGR-QQDSLEFFSYLSDKLDREI 422

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 15/93 (16%)

Query: 856 LPTVLTIHLSRFFYDL---TKKNNKVITYPLILSI--VLKNEQI--MKYRLYAIANHFGN 908
           LP VL + L RF + L   + K N ++ +PL L++      + +  + + L  I  H G 
Sbjct: 357 LPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFELIGIIAHRGT 416

Query: 909 LISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
           +  GHY +       H        W+ F+D  V
Sbjct: 417 VNEGHYIAFTKVTTGH--------WFKFNDSMV 441

 Score = 35.4 bits (80), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 106/264 (40%), Gaps = 62/264 (23%)

Query: 538 TAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKY 597
           T IP +E+         + GL N+G TC+++S++QCL     F    ++  +    S++ 
Sbjct: 125 TQIPKLERRD------GLQGLLNMGSTCFMSSIVQCLIHNPYFFQFSINQLH----SQRC 174

Query: 598 TNPNQLSKYFNVLFKKMY-MNGGCSVVPTGFLKACNALRPD------------FRIPHD- 643
              + LS     L + ++   G   ++  G   + N+   D            ++I  + 
Sbjct: 175 PLQDPLSCISCALDRMVWEFYGHPELIKNGEDDSNNSRTSDEYAGFIGLFVSSWKINENL 234

Query: 644 ----QQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHIS 699
               QQD  E+  FLL+QLH++   S+  + D                       E + +
Sbjct: 235 AGYFQQDAHEYWQFLLNQLHNDYMVSHNKSPD-----------------------ETNFA 271

Query: 700 ENGISPIDNIFQGQMENGLFCQRCG-HSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDC 758
           E       + FQG +++ + C  C   S      F  LSL I         + K  L +C
Sbjct: 272 ELCDCIAHSTFQGSLKSSIVCPECKMDSKTTKDPFMDLSLDI---------KDKSNLYEC 322

Query: 759 INLFTSDEQLTNENAWDCPKCGTS 782
           ++ F   EQL + N + C +C T+
Sbjct: 323 LDSFHKMEQLHDFN-YHCDRCNTT 345

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFR 581
           + GL N G TCY NS+LQCL+  K  R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 53/136 (38%), Gaps = 37/136 (27%)

Query: 645 QDTQEFLLFLLSQLHDELS-ESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGI 703
           QD  EFL FL++ L D L  +  R+ +  P                          EN I
Sbjct: 431 QDAHEFLNFLMNALSDSLQLQLQRLPDKSP--------------------------ENFI 464

Query: 704 SPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDCINLFT 763
                +FQG M N + C  C + + N   F+    AIP      S+ +++ ++D +  F 
Sbjct: 465 H---TLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP-----VSEDEELNVQDILRDFH 514

Query: 764 SDEQLTNENAWDCPKC 779
             E L   N + C  C
Sbjct: 515 QREMLNGANKFYCDSC 530

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           TG+ NIG TCY+NS+LQ  F+    R   L+
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILN 766

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 10/120 (8%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN-----QLSKYFNVLF 611
           GL N+G +CY+NS+LQ LF   A  D  L    +  F R    P+     QL K  N + 
Sbjct: 314 GLNNLGNSCYMNSVLQVLF-NGAVPDWSLEVLGD--FPRDVVYPSTNLKCQLIKLRNAI- 369

Query: 612 KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVAND 671
           K+   +    + P+ F +       +F     QQD  EF  + + +L  +L       ND
Sbjct: 370 KRNPSDYTTGIKPSTFKRCIGESHEEFSSGR-QQDAMEFFTYFIDELDKKLFSRGSNPND 428

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 10/75 (13%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGIT 955
           Y+L  +  H G +   GHYT+ V       L++ ++KWY  DD TV  +IN  ++  G  
Sbjct: 767 YKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYRIDDTTV-TEINKEEVVTGGE 818

Query: 956 SIS-SSDVYVLFYEK 969
             S S   Y+L Y++
Sbjct: 819 EGSHSRTAYILIYQR 833

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           GL NIG TCY+NS+LQ  FA    R+   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 765

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TGL NIG TCY+NS+LQ  F+    R   L
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYVL 761

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 109/264 (41%), Gaps = 59/264 (22%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           S  T +P +E+         ++GL N+G TC+++S+LQCL     F  +  S +  H   
Sbjct: 122 STKTMVPAMERRD------GLSGLINMGSTCFMSSILQCLIHNPYF--IRHSMRQIHSNK 173

Query: 595 RKYTNPNQ-----LSKYFNVLFKKMYMNGGCSVVPT-----GFLKACNALRPDFRI---- 640
            K  +P++     L K  + L+  +  +   S         GF+   + L   ++I    
Sbjct: 174 CKVRSPDKCFSCALDKIVHELYGVLNTDQPSSSSSATNRQGGFI---HLLTCAWKINQSL 230

Query: 641 -PHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHIS 699
             + QQD  EF  FL++++H    +S  ++   P               E D    K   
Sbjct: 231 AGYSQQDAHEFWQFLINEIH----QSYVLSLPNP--------------KEVDRANNKRCD 272

Query: 700 ENGISPIDNIFQGQMENGLFCQRC-GHSSFNYSVFYVLSLAIPSSTSTFSQRKKVRLEDC 758
                 +  +F+G +E+ + C  C  +S      F  LSL I         + K +L +C
Sbjct: 273 ----CIVHTVFEGSLESSIVCPGCQNNSKTTIDPFMDLSLDI---------KDKQKLYEC 319

Query: 759 INLFTSDEQLTNENAWDCPKCGTS 782
           ++ F   E L + N + C +C ++
Sbjct: 320 LDSFHKKELLKDFN-YHCGECNST 342

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 557 GLRNIGCTCYVNSMLQCLF--ATKAFRDLFLSTKYEHYFSRKYTN-PNQLSKYFNVLF-- 611
           GL N+G +CY+NS+LQ L       +   FL +++        +N   Q  K  N +   
Sbjct: 324 GLINLGNSCYLNSVLQSLLNGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLLNAMKCE 383

Query: 612 KKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFL 654
            ++Y NG   + PT F K       +F   + QQD  EFL FL
Sbjct: 384 PEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFL 422

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLRRYIL 764

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 40/88 (45%), Gaps = 17/88 (19%)

Query: 857 PTVLTIHLSRFFYDLTK--KNNKVITYPLILSIVLKNEQIM-----------KYRLYAIA 903
           P VL +HLSR  ++     KN   +T+P  L I   NEQ++           +Y+L A+ 
Sbjct: 388 PRVLILHLSRSVFNGVSYAKNTCNVTFPEELVI---NEQLLENNKCVGVRAVRYKLCAMI 444

Query: 904 NHFGNLISGHYTSLVNK-DLDHDLNKGK 930
            H G    GHY    +K D   D   G+
Sbjct: 445 KHIGTHSQGHYACFRHKPDFRKDPRTGE 472

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TGL NIG TCY+NS+LQ  F     R   +
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 35.8 bits (81), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 17/26 (65%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFR 581
           TGL NIG TCY+NS+LQ  F     R
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLR 728

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           TG+ NIG TCY+NS+LQ  F+    R   L
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRRYVL 765

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 28/129 (21%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKM 614
           I GL N G TC++NS+LQ L ++K   D FL T  +    ++        +      KK 
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMD-FLDTTIKQEQEQEQEQEQVGDE------KKE 179

Query: 615 YMNGGCSVVPTGFLKACNAL----RPDFR-----------------IPHDQQDTQEFLLF 653
            ++ G ++     L   NA     RP F+                 + +DQ+D QEF   
Sbjct: 180 DVDIGFTLSLNELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQN 239

Query: 654 LLSQLHDEL 662
           +LS+L   L
Sbjct: 240 ILSELEKNL 248

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           + G  N G TCY NS+LQCL+    FR   L
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 51/123 (41%), Gaps = 17/123 (13%)

Query: 855 SLPTVLTIHLSRFFYDLTKKNNKV----ITYPLILSIV--LKNEQIMKYRLYAIA-NHFG 907
           SLP  L IHL RF Y   +  N      I YPL L +     +     Y L  I  +  G
Sbjct: 516 SLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGIVIHMGG 575

Query: 908 NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITSISS-SDVYVLF 966
               GHY ++   DL          W  FDDETV + IN   +   I   +  +  YVL 
Sbjct: 576 GPHHGHYVAICKNDL--------FGWLLFDDETV-ESINEETVLKFIGDANELTTAYVLI 626

Query: 967 YEK 969
           Y++
Sbjct: 627 YKE 629

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLS 586
           GL+N+G TCY+N+ LQ L+     R+  L+
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILN 134

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 35.4 bits (80), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 12/120 (10%)

Query: 555 ITGLRNIGCTCYVNSMLQ-CLF--ATKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLF 611
           I  + + G   +VN  L+ C F    + F D      Y  YFS+KY N   L K+++ L 
Sbjct: 520 IAHMDDDGSILWVNGGLKNCKFDAVERDFED------YTEYFSKKYINKENLQKFYD-LE 572

Query: 612 KKMYMNGGCSVVPTGFLKA--CNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVA 669
             M M      V + ++KA  C A      I  D  +  E+  +++ +    L E N++A
Sbjct: 573 VDMQMAFIPDFVDSDWVKAPECRAFTWCSTIKADSMEGAEYQSYIIKKGDPRLREYNKIA 632

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 35.4 bits (80), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 43/202 (21%), Positives = 80/202 (39%), Gaps = 48/202 (23%)

Query: 548 NEYVALSITGLRNIGCTCYVNSMLQCLFATKAFR----DLFLSTKYEHYFSR---KYTNP 600
           +++  L   GL N G TCY N+ +Q +    + +    D+ L  KY+   S+    YT  
Sbjct: 351 DQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILLG-KYDGTISKNSVSYTLA 409

Query: 601 NQLSKYFNVLFKKMYMNGGCSVVPTGFLKA----CNALRPDFRIPHDQQDTQEFLLFLLS 656
               K ++ + K    +   S +   +L +     N +  +++    Q+D+ E+ + L+S
Sbjct: 410 ETSKKMWSPISKNPKKSPSASYINPKYLISRLDDINCMMSEWQ----QEDSHEYFMSLMS 465

Query: 657 QLHDELSESNRVANDYPGXXXXXXXXXXXXXXEYDTWFEKHISENGISPIDNIFQGQMEN 716
           +L +                              D+  + H     I  I ++F G ++ 
Sbjct: 466 RLQE------------------------------DSVPKGHKLIESI--IYDVFGGLLKQ 493

Query: 717 GLFCQRCGHSSFNYSVFYVLSL 738
            + C+ CG  S     FY LSL
Sbjct: 494 IVTCKSCGSISKTEQPFYDLSL 515

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 35.0 bits (79), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 18/96 (18%)

Query: 856 LPTVLTIHLSRFFYDLTKKN---NKVITYPLILSI-------VLKNEQIMKYRLYAIANH 905
           LP +L + L RF + +   N   N+ + YPL L++         +    + Y L  I +H
Sbjct: 355 LPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIYELTGILSH 414

Query: 906 FGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETV 941
            G++  GHY  ++       +N G  +W+ F+D  +
Sbjct: 415 IGSINEGHYVVVLK------INDG--RWFKFNDSMI 442

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 99/270 (36%), Gaps = 71/270 (26%)

Query: 535 SKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFS 594
           S  T IP+ E+    +      GL N+G TC+++S+LQ L       +  +S    H+ +
Sbjct: 123 STKTTIPSQERRDGLF------GLVNMGSTCFMSSILQALIHNPYIVNYSMSQT--HFVN 174

Query: 595 RKYTNPN-QLSKYFNVLFKKMYMNGGCSVVPTGF------------------LKACNALR 635
               N +  +S   + +  + Y  G   + P                     L  C+   
Sbjct: 175 CSIKNSSLCMSCALDAMIIEFY--GQSKLQPISSSSSSSSSSSSSSPSAFISLLTCSLKI 232

Query: 636 PDFRIPHDQQDTQEFLLFLLSQLHDEL---SESNRVANDYPGXXXXXXXXXXXXXXEYDT 692
            +    + QQD  EFL + L+QLH +    S  N   N+ P                   
Sbjct: 233 NENFAGYSQQDAHEFLQYFLNQLHQDYKRDSSHNEQENNCPCVAH--------------- 277

Query: 693 WFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKK 752
                          +IFQG++++ + C  C + S         ++  P    +   + K
Sbjct: 278 ---------------SIFQGELKSSIVCPECQNDS--------KTIIDPFMDLSLDIKDK 314

Query: 753 VRLEDCINLFTSDEQLTNENAWDCPKCGTS 782
             L  C++ F   E+L + N + C +C TS
Sbjct: 315 TDLYQCLDSFHKKEKLHDFN-YHCSRCNTS 343

>Kpol_1055.31 s1055 complement(78247..80715) [2469 bp, 822 aa] {ON}
           complement(78247..80715) [2469 nt, 823 aa]
          Length = 822

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 59/144 (40%), Gaps = 42/144 (29%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNN----------------KVITYPLILSIVLK-------N 891
           LP VL + L RF F + T K+N                K I Y   L+I L+       +
Sbjct: 688 LPQVLLVQLKRFSFINNTDKDNNMTNYNAYNGRIEKIRKKIKYDHELTIPLESLSPASID 747

Query: 892 EQIMKYRLYAIANHFG-NLISGHYTSLV-NKDLDHDLNKGKQKWYYFDD----ETVKKDI 945
            +   Y L  +  H G +   GHYT+ V +K+LD        KWY  DD    E  K D+
Sbjct: 748 TKNRAYELTGVIYHHGLSSDGGHYTADVYHKELD--------KWYRIDDVNIIELEKDDV 799

Query: 946 NHGDIDAGITSISSSDVYVLFYEK 969
             G  D   T  +    Y+L Y K
Sbjct: 800 LKGGEDGNDTRTA----YILIYRK 819

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 35.4 bits (80), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 88/235 (37%), Gaps = 53/235 (22%)

Query: 555 ITGLRNIGCTCYVNSMLQCLFATK---AFRDLFLSTKYEHYFSR----------KYTNPN 601
           + GL N G TC++NS+LQ L ++K   AF D  +  K++    +          +     
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 602 QLSKYFNVLFKKM-------YMNGGCSVVPTGFLKA-CNALRPDFRIPHDQQDTQEFLLF 653
            +   F+V FK++       Y            LK   NA   +  + +DQ+D QEF   
Sbjct: 150 DVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQN 209

Query: 654 LLSQL------------------HDELSESNRVANDYPGX-------XXXXXXXXXXXXX 688
           +LS+L                   +EL +   +     G                     
Sbjct: 210 ILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNND 269

Query: 689 EYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCG-HSSFNYSVFYVLSLAIPS 742
           E DT F  +     I+P+D I   +    + C +CG +    YSVF  LSL +P 
Sbjct: 270 ENDTKF--YTPFKLITPLDGISAER----IGCLQCGENGGIRYSVFSGLSLNLPG 318

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 35.4 bits (80), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 897 YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDI-DAGI 954
           YRL  +  H G +   GHYT+ V       L++ + KWY  DD  V  +I   D+   G 
Sbjct: 723 YRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNV-TEIRQEDVFKRGD 774

Query: 955 TSISSSDVYVLFYEK 969
            +  S   Y+L Y++
Sbjct: 775 EASDSKTAYILIYQR 789

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 26/134 (19%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLF------------------LSTKYEHY--FSRK 596
           G+ N G  C+++S+LQ L   + F ++                   L +  E Y  F + 
Sbjct: 350 GIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLLGSCLEFYKEFEKL 409

Query: 597 YTNPNQLSKYFNVLFKKMYMNGGC---SVVPTGFLKACNALR--PDFRIPHDQQDTQEFL 651
           + + ++  K  N   K    N      ++ P  F K  + L    D +  H Q+D +EFL
Sbjct: 410 HADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKLPMFKDLQWGH-QEDAEEFL 468

Query: 652 LFLLSQLHDELSES 665
              L QLH+E   S
Sbjct: 469 THFLDQLHEEFVSS 482

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 853 FISLPTVLTIHLSRFFYDLTK--KNNKVITYPLILSI---VLKNEQIM-----KYRLYAI 902
            +  P VL IHLSR  ++ T   +N   + +  IL +   V++N++ +      Y L AI
Sbjct: 466 VVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGINSVNYELKAI 525

Query: 903 ANHFGNLISGHY 914
             H G+   GHY
Sbjct: 526 VKHAGSHSQGHY 537

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 36/143 (25%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLK------------------------- 890
           LP VL I L RF +      +K++ Y      V K                         
Sbjct: 638 LPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKETISSVHSNF 697

Query: 891 -NEQIMKYRLYAIANHFGNLISG-HYTSLV-NKDLDHDLNKGKQKWYYFDDETVKKDINH 947
            ++   KY+L  +  H G   SG HYT+ V ++++D        KW+  DD  + +    
Sbjct: 698 YDDAGTKYKLVGVVYHHGVSPSGGHYTADVYHQEMD--------KWFRIDDVNIAELNKE 749

Query: 948 GDIDAGITSISSSDVYVLFYEKI 970
             +  G     S   Y+L Y+KI
Sbjct: 750 EVLKGGEDGFDSRTAYILMYQKI 772

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 48/112 (42%), Gaps = 10/112 (8%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN---QLSKYFNVLFK 612
            GL N+G +CY+N++LQ LF         L    +      Y + N   QL K  N L  
Sbjct: 309 CGLLNLGNSCYMNAVLQVLF-NGGVSSWSLDELGDFPTDVVYVSSNLKCQLIKLRNALRT 367

Query: 613 --KMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
             +MY NG   V P+ F         +F     QQD  EF  +L+  L  +L
Sbjct: 368 NPEMYPNG---VKPSTFKDCVGGTHEEFSSGR-QQDALEFFSYLIDLLDKKL 415

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 10/79 (12%)

Query: 889 LKNEQIMKYRLYAIANHFGNLI-SGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINH 947
           + +E    +RL A+  H G+ + SGHY + + KD++++      KW  ++DE +      
Sbjct: 690 ISDETKANFRLSAVICHKGSSVHSGHYVAFIKKDVENE-----TKWVLYNDEKMVV---- 740

Query: 948 GDIDAGITSISSSDVYVLF 966
            D  + IT I  +    LF
Sbjct: 741 ADDPSNITEIKKNGYIYLF 759

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFL 585
           G+ NIG TCY+NS+LQ  F+    R+  L
Sbjct: 714 GINNIGNTCYLNSLLQYYFSIAPLRNYVL 742

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 18/102 (17%)

Query: 853 FISLPTVLTIHLSRFFYDLTK--KNNKVITYPLILSIVLKNEQI----------MKYRLY 900
            +S P VL +HLSR  +D     KN+  + +P    ++L  ++I          ++Y+L 
Sbjct: 400 VVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPE--DLILNEQEIKEDRCIAVHCVRYKLQ 457

Query: 901 AIANHFGNLISGHYTSLVNK-DLDHDLNKGKQKWYYFDDETV 941
           A+  H G    GHY    +K D   DL   K +  +    TV
Sbjct: 458 AMIKHTGTHFQGHYEVFRHKPDFVKDL---KSRAVFISSPTV 496

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRD 582
            GL NIG TCY+NS+LQ  F     R+
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}
           UBP3Ubiquitin-specific protease involved in transport
           and osmotic response; interacts with Bre5p to
           co-regulate anterograde and retrograde transport between
           the ER and Golgi; involved in transcription elongation
           in response to osmostress through phosphorylation at
           Ser695 by Hog1p; inhibitor of gene silencing; cleaves
           ubiquitin fusions but not polyubiquitin; also has mRNA
           binding activity
          Length = 912

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 57/144 (39%), Gaps = 37/144 (25%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLIL------SIVLK 890
           LP VL I   RF F +   K+N +  Y                   LI+      SI LK
Sbjct: 774 LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 833

Query: 891 NEQI----MKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDI 945
           N        +Y+L  +  H G +   GHYT+    D+ H  +    KWY  DD  + +  
Sbjct: 834 NNTSGIDDRRYKLTGVIYHHGVSSDGGHYTA----DVYHSEH---NKWYRIDDVNITELE 886

Query: 946 NHGDIDAGITSISSSDVYVLFYEK 969
           +   +  G  +  S   Y+L Y+K
Sbjct: 887 DDDVLKGGEEASDSRTAYILMYQK 910

>CAGL0K10384g Chr11 complement(1011380..1017694) [6315 bp, 2104 aa]
            {ON} similar to uniprot|P34756 Saccharomyces cerevisiae
            YFR019w FAB1 phosphatidylinositol 3-phosphate 5-kinase
          Length = 2104

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 11/96 (11%)

Query: 580  FRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTG------FLKACNA 633
            F D FL    EHY   K  + NQ  + +   F + + N   SV PT        LK    
Sbjct: 971  FNDNFLQLSVEHYLLAKTESKNQQPEGYYSDFVEKFNNRLLSVSPTVSFPLPFLLKQARN 1030

Query: 634  LRPDFRIPHDQQDT-----QEFLLFLLSQLHDELSE 664
            L  + R+  DQ+ T     +E+ + LLS + ++L++
Sbjct: 1031 LERELRLLEDQESTVHAAKEEYQIGLLSDISNKLTK 1066

>SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 472

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 13/113 (11%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNP-NQLSKYFNVLFKKMY 615
           GL NI    Y N ++Q L      RD FL    E        NP +QL +  +++ +KM+
Sbjct: 156 GLNNISNNDYANVVIQLLGHVPPIRDYFLLKGLER-------NPESQLIRRLSIIVRKMW 208

Query: 616 MNG--GCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESN 666
                   + P   L+  + +        + +D + F+L+LL++L   LS SN
Sbjct: 209 SPKLFKPHISPHELLQYISLISKQKFSTKESKDPRNFILWLLTEL---LSSSN 258

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 14/110 (12%)

Query: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPN-----QLSKYFNVL 610
            GL N+G +CY+NS++Q LF     +D  L    +  F R    P+     QL K  N L
Sbjct: 318 CGLINLGNSCYLNSVVQVLF-NGGVKDWNLDMLGD--FPRDVVFPSTNLKCQLIKLRNAL 374

Query: 611 --FKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQL 658
               + Y +G   V P    K       +F     QQD  EFL + + +L
Sbjct: 375 KIHPEKYQHG---VKPASVKKCIGEDNEEFSSGR-QQDAMEFLTYFIDKL 420

>Suva_5.280 Chr5 complement(441123..443840) [2718 bp, 905 aa] {ON}
           YER151C (REAL)
          Length = 905

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 56/144 (38%), Gaps = 37/144 (25%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLIL------SIVLK 890
           LP VL I   RF F +   K+N +  Y                   LI+      SI LK
Sbjct: 767 LPQVLLIQFKRFSFINNVDKDNAMTNYNAYNGRIEKIRKKIKYGHELIIPEESMSSITLK 826

Query: 891 NEQI----MKYRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDI 945
           N         Y+L  +  H G +   GHYT+    D+ H  +    KWY  DD  + +  
Sbjct: 827 NHATGIADRNYKLTGVIYHHGISSDGGHYTA----DVYHSEH---NKWYRIDDVNIIELE 879

Query: 946 NHGDIDAGITSISSSDVYVLFYEK 969
           +   +  G  +  S   Y+L Y+K
Sbjct: 880 DDDVLKGGEEASDSRTAYILMYQK 903

>KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {ON}
           Anc_8.202 YER151C
          Length = 829

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 54/138 (39%), Gaps = 31/138 (22%)

Query: 856 LPTVLTIHLSRFFY--------DLTKKN---------NKVITYP---LILSIVLKNEQIM 895
           LP VL I L RF +        D+T  N          K I Y    +I S  + +   M
Sbjct: 698 LPEVLLIQLKRFSFVSNVGKSNDMTNYNAYNGRIEKIRKKINYGHELIIPSESVSSNATM 757

Query: 896 KYRLYAIAN---HFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDID 951
             R Y++     H G +   GHYT+ V       L+   +KWY  DD  + +      + 
Sbjct: 758 SNREYSLTGVIYHHGLSPDGGHYTADV-------LHSESKKWYRIDDVNINELEEDDVLK 810

Query: 952 AGITSISSSDVYVLFYEK 969
            G     S   Y+L Y+K
Sbjct: 811 GGEEDNDSRTAYILMYQK 828

>ZYRO0A01232g Chr1 complement(87135..87833) [699 bp, 232 aa] {ON}
           similar to uniprot|P40465 Saccharomyces cerevisiae
           YIL132C CSM2 Protein required for accurate chromosome
           segregation during meiosis
          Length = 232

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 50/105 (47%), Gaps = 18/105 (17%)

Query: 20  VYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAGCFYIYLIIP 79
           V+  D ++ FP  + EKL+   E    ++ES R  +A N +E            + LI+ 
Sbjct: 57  VFYIDASNTFPLYQFEKLVPKDERGAKIYESIRIQIALNLSE------------LNLIVR 104

Query: 80  HSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124
             +QF SR+K   +   L K    E N   VLL+++  IE M K+
Sbjct: 105 KILQFVSREK---VARSLNK--DTEQNGLKVLLILSG-IEIMFKN 143

>KAFR0A02070 Chr1 (430633..431910) [1278 bp, 425 aa] {ON} Anc_2.557
           YHL020C
          Length = 425

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%)

Query: 250 TQASNSSDFNDQKINRYATHRKDSYHSVHMSNDDYDAFTFNLARLQKQSVVTCDQLMRIL 309
           + + N +D  D+    Y + R+    ++  S D++  + FNL+   K+S++TC  L+++ 
Sbjct: 123 SSSENETDERDKDEIEYVSKRRKISEALAKSKDNFKEYKFNLSIESKKSLITCLHLLKLA 182

Query: 310 CSQ 312
             Q
Sbjct: 183 NKQ 185

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 14/107 (13%)

Query: 854 ISLPTVLTIHLSR-FFYDLTKKNN----------KVITYPLILSIVLKNEQIMKYRLYAI 902
           + LP VL IHLSR  F  +T   N          K+  Y  I ++ L   + + Y L ++
Sbjct: 345 VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 903 ANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGD 949
             H G+   GHY     K    D+   K+   + D  ++  + NH +
Sbjct: 405 VKHTGSHSRGHYMCYRRKG---DILFDKEDESFVDSRSIITNRNHNE 448

>Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON}
           YER151C (REAL)
          Length = 910

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 55/144 (38%), Gaps = 37/144 (25%)

Query: 856 LPTVLTIHLSRF-FYDLTKKNNKVITY------------------PLIL------SIVLK 890
           LP VL I   RF F +   K+N +  Y                   LI+      SI LK
Sbjct: 772 LPQVLLIQFKRFSFINNVNKDNAMTNYNAYNGRIEKIRKKIKYDHELIIPEESMSSITLK 831

Query: 891 NEQIMK----YRLYAIANHFG-NLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDI 945
           N         Y+L  +  H G     GHYT+    D+ H  +    KWY  DD  + +  
Sbjct: 832 NHTSGADDRIYKLTGVIYHHGVGSDGGHYTA----DVYHSEH---NKWYRIDDVNITELE 884

Query: 946 NHGDIDAGITSISSSDVYVLFYEK 969
           +   +  G  +  S   Y+L Y+K
Sbjct: 885 DDDVLKGGEEASDSRTAYILMYQK 908

>TPHA0M01090 Chr13 complement(217833..220175) [2343 bp, 780 aa] {ON}
           Anc_3.270 YBR058C
          Length = 780

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 9/111 (8%)

Query: 557 GLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQLSKY--FNVLFK-- 612
           GL N+G +CY+NS+++ L           S          Y + N L +    N+  K  
Sbjct: 331 GLINLGNSCYMNSVIKVLLNGGIPGWSLDSIGSSFPMDVVYPSNNLLCQLIKLNIAMKIE 390

Query: 613 -KMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDEL 662
            + Y +G   + PT F K       +F     QQD+ EF  FL +QL  ++
Sbjct: 391 PERYPDG---IKPTSFKKCITRGNAEFS-SGKQQDSMEFFTFLTNQLDKKI 437

>Smik_12.165 Chr12 complement(328889..343618) [14730 bp, 4909 aa] {ON}
            YLR106C (REAL)
          Length = 4909

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 79   PHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKDEVETAR 130
            P + Q Q  ++ Y   A+ +KY   E ++ N + M+T++I S  K E+ T +
Sbjct: 3337 PLARQLQKIEQIYTFLAEWEKYASSEVSLNNTIKMITDLIVSWRKLELRTWK 3388

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 50/142 (35%), Gaps = 34/142 (23%)

Query: 856 LPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLK------------------------- 890
           LP V  I L RF +      +K++ Y      V K                         
Sbjct: 647 LPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIPDATISSVHSSF 706

Query: 891 -NEQIMKYRLYAIANHFGNLISG-HYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHG 948
             E    Y+L  +  H G   SG HYT  V ++    LNK    WY  DD  V++     
Sbjct: 707 YKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQET---LNK----WYRIDDTNVQEIEKDE 759

Query: 949 DIDAGITSISSSDVYVLFYEKI 970
            +  G     S   Y+L Y+K+
Sbjct: 760 VLKGGEEGNDSRTAYILIYQKL 781

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,475,012
Number of extensions: 4523708
Number of successful extensions: 14396
Number of sequences better than 10.0: 266
Number of HSP's gapped: 14201
Number of HSP's successfully gapped: 504
Length of query: 974
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 855
Effective length of database: 39,836,145
Effective search space: 34059903975
Effective search space used: 34059903975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)