Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06864g2.534ON1671678641e-120
SAKL0A09504g2.534ON1671677421e-101
TDEL0A030802.534ON1671677301e-99
NCAS0F008902.534ON1671677022e-95
YMR071C (TVP18)2.534ON1671677013e-95
Suva_13.2482.534ON1671676971e-94
Skud_13.2272.534ON1671676971e-94
CAGL0K03025g2.534ON1671676952e-94
KNAG0C058002.534ON1671676762e-91
TPHA0G035202.534ON2041686792e-91
NDAI0H013902.534ON1671676683e-90
TBLA0G022402.534ON1671676632e-89
KAFR0A018702.534ON1671676371e-85
Smik_13.2502.534ON1671676344e-85
AGL072W2.534ON1671675615e-74
ZYRO0B02024g2.534ON1661665321e-69
Ecym_72542.534ON1671675233e-68
Kpol_348.92.534ON1301305056e-66
KLLA0E18525g2.534ON1711655052e-65
Kwal_26.80252.534ON64643025e-36
TBLA0D023708.17ON61434645.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06864g
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   337   e-120
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   290   e-101
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   285   1e-99
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   275   2e-95
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   274   3e-95
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   273   1e-94
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   273   1e-94
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   272   2e-94
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   265   2e-91
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   266   2e-91
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   261   3e-90
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   259   2e-89
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   249   1e-85
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   248   4e-85
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   220   5e-74
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   209   1e-69
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   206   3e-68
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   199   6e-66
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   199   2e-65
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   120   5e-36
TBLA0D02370 Chr4 (596500..598344) [1845 bp, 614 aa] {ON} Anc_8.1...    29   5.8  

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  337 bits (864), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 167/167 (100%), Positives = 167/167 (100%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
           AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  290 bits (742), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 153/167 (91%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL IKQFIN+AG+V+DLKSFNFSVYGQWFGYINI LC+ALGIANLFHV+AV+ FG+++I
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +Q LVILF+EVPFLL+ICPLSDNFI FIKRFETNGKRTLFY  MA +QWCSLA+M TSLI
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VAIGLTISAASY VA+ KHQQFQ T++IK+P D+DFPHEAVVREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  285 bits (730), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 133/167 (79%), Positives = 150/167 (89%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL ++QFINVAG+V+DLKSFNFS+YG+WFGYINIFLC+ALGIANLFHVSAVI FGI+AI
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQGL+ILFVE+PFLL+ICPLSDNFI FIKRFETNG RTLFYV MA +QWCS+AV ATSLI
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTISA SY VA  KHQ+FQ T ++K P  DDFPHEAVVREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  275 bits (702), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 151/167 (90%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL+IKQFIN AG+ +DLKSFNFSVYG+WFGYINI LC+ALG+ANLFHV+AVI FGII+I
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGLVILF+E+PFLL+ICPLS+NFI FIKRFETNG R LFY+GMA +Q+CS+ +MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VAIGLTIS+ SY VAF  HQ+FQ T++IK+PAD DFPHEAVVREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  274 bits (701), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 128/167 (76%), Positives = 150/167 (89%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL++ QFINV G+V+DLKSFNFSVYG+WFGYINI LC+ALGIANLFHVS VI FGII+I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGLVILF+E+PFLL+ICPLSDNFI FIKRFETNG R LFY+ MA +Q+ S+AVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTIS+ SY VA+ KHQ+FQ T++IK+P DDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  273 bits (697), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 125/167 (74%), Positives = 150/167 (89%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL++ QFINV G+V+DLKSFNFSVYG+WFGYINI LC+ALGIANLFHVS VI FGII+I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGLVILF+E+PFLL+ICPLSDNF+ FIKRFETNG R +FY+ MA +Q+ S+AVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTIS+ SY VA+ KHQ+FQ T+++K+P DDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  273 bits (697), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 125/167 (74%), Positives = 150/167 (89%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL++ QFINV G+V+DLKSFNFSVYG+WFGYINI LC+ALGIANLFHVS VI FGII+I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGLVILF+E+PFLL+ICPLSDNF+ FIK+FETNG R +FY+ MA +Q+ S+AVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTIS+ SY VA+ KHQ+FQ T++IK+P DDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  272 bits (695), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 147/167 (88%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL I QFIN+AGL++DLKSFNFSVYG+WFGYINIFLC+ALGIANLFHVSAVI FGI+ I
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQGL+ILF+E+PFLL+ICPLSD FI FIKRFETNG R +FY  MA VQ+CSLAVM TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            + I LTISA SYG+AF KHQ+F  T++IK+P D+DFPH+AVVREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  265 bits (676), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 146/167 (87%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL+IKQF N AG+++DL+SFNFSVYG+WFG+INI LCVALGIANLFHVS VI FGI++I
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQGL+ILF+E+PFLL+ICPLSDNFI FI RFETNG R +FY+ MA +Q+CS+ +M TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VAI LT+SA  Y VAF KHQ+FQ T++IK+PAD DFPHEAVVREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  266 bits (679), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 129/168 (76%), Positives = 148/168 (88%), Gaps = 1/168 (0%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL+IKQFIN AG+++DLKSFNFSVYGQ+FGYINI LC+ALGIANLFHV+AVI FGI+AI
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQ LVILF+E+PFLL+ICPLSDNF+ F+K FETNG R LF+ GMA VQWCSL +  TSLI
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTS-VIKSPADDDFPHEAVVREML 167
            VAIGL+ISAA Y +AFFK Q+FQ TS VIK+P DDDFPHEAVVREML
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  261 bits (668), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 146/167 (87%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL I QFIN+AG+V+DLKSFNFSVYG+WFGYINI LC+ LGI+NLFHV+AVI FGI++I
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGLVILF+E+PFLL+ICPLS+ FI FIKRFETNG R +FY+ MA +Q+CS+A+MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTIS+ SY +AF  HQ+FQ T ++K+P D DFP EAVVREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  259 bits (663), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 120/167 (71%), Positives = 144/167 (86%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           M + +++F+N+ G+VR LKSFNFS+YGQWFGYINI LCVALGIANLFHV+ VI FGI++I
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +Q  +ILFVEVPFLL+ICPLSDNFIAFIK F+TNG R +FY+ MA VQWCS+ + ATSLI
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VAIGLTISA SY VA+FK+Q+FQ  S+IK+P DDDFP EAVVREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  249 bits (637), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 125/167 (74%), Positives = 151/167 (90%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL+IKQFINVAG+V+DLKSFNFSVYG+WFGYINI LC+ALGI+NLFHV+AVI FGII+I
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGL+ILF+E+PFLL+ICPLSDNF+ FIKRFETNG R +FY+ MA +Q+CS+ +MATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VAI LT+S ASYG+A FK Q+FQ T++IK+P D DFPHEAVVREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  248 bits (634), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 125/167 (74%), Positives = 150/167 (89%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL++ QFINV G+V+DLKSFNFSVYG+WFGYINI LC+ALGIANLFHVS VI FGII+I
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           +QGL+ILF+E+PFLL+ICPLSDNFI FIK+FETNG R +FY+ MA +Q+ S+AVMATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            VA+GLTIS+ SY VA+ KHQ+FQ T++IK+P DDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  220 bits (561), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 105/167 (62%), Positives = 132/167 (79%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MAL+ K F+NV G++ DL+SFNFSVYG+WFGYINI LC+ALGIAN+FH S VI F I+AI
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
           VQGL+++FVEVP LL+ICPLSDNFI  +K+ +TNG+RTL Y  +A VQ+ SL+V  TSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
           AVAIGLTISA  YG  + K Q+F   +VI++P D  F  EA VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  209 bits (532), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 129/166 (77%), Gaps = 1/166 (0%)

Query: 3   LNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAIVQ 62
           +++ Q   +  LV+ LKS+NFS+YG++  Y+NI  C+A GIANLFHV+AVI FG+I+IVQ
Sbjct: 1   MDLAQIKILGSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQ 60

Query: 63  GLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLIAV 122
           G +ILF+EVPFLLRICPLSDNFI F+ RFETNG RT+FY+  A +QW SLA+  TSLI V
Sbjct: 61  GAIILFLEVPFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVV 120

Query: 123 AIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFP-HEAVVREML 167
           A+GLTISAA YGVA+FKHQ FQ +S IK P  +    +E  VREML
Sbjct: 121 AVGLTISAAFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  206 bits (523), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%)

Query: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60
           MA+++K FINV G+V DLKSFNFSVYG+WFGYINI LC+ALGIAN+FH   VI+F I+A+
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120
            QG  +LFVEVPFL++ICPLS+ F++ +K F +N KRT+ Y  MA +QW SL    TSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167
            +AI LT+SA  Y   +   Q+F+ ++V++ P  D FPHEA VREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  199 bits (505), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 112/130 (86%), Gaps = 1/130 (0%)

Query: 39  VALGIANLFHVSAVIVFGIIAIVQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRT 98
           +ALGIANLFHV+AVI FGI+AIVQ L+ILFVEVPFLL+ICPLS+NFI FIK FETNG R 
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  LFYVGMAAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTS-VIKSPADDDF 157
           +FY  MA VQWCSLA+M TSLI VAI LTISA  Y +A+FK+Q+FQ T+ VIK+P DDDF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEAVVREML 167
           PH+AVVREML
Sbjct: 121 PHDAVVREML 130

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  199 bits (505), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 94/165 (56%), Positives = 125/165 (75%), Gaps = 2/165 (1%)

Query: 5   IKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAIVQGL 64
           +K   NV+G+V DLKS NFS+YGQW  Y+NI  C+A GIAN+FH SAVIVF IIAIVQGL
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  VILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLIAVAI 124
           +ILF+EVPFLL+ICPLSDNFI F+ +F+TN +R LFY+ M A+QWCS+ V +TSLI VA+
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 GLTISAASYGVAFFKHQQFQGTSVI--KSPADDDFPHEAVVREML 167
           GL+I+A  Y +     Q+F+ ++++  +        +EAVVR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  120 bits (302), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 56/64 (87%), Positives = 61/64 (95%)

Query: 104 MAAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVV 163
           MAAVQWCS+A+M TSLI VA+GLTISAASY VAFFKHQQFQGTSVIK+PAD+DFPHEAVV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REML 167
           REML
Sbjct: 61  REML 64

>TBLA0D02370 Chr4 (596500..598344) [1845 bp, 614 aa] {ON} Anc_8.17
           YFL041W
          Length = 614

 Score = 29.3 bits (64), Expect = 5.8,   Method: Composition-based stats.
 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 29  WFGYINIFLCVALGIANLFHVSAVIVFGIIAIVQ 62
           W GY+ +FLC A+ I   +   ++I +G++ +V+
Sbjct: 563 WKGYLAMFLCTAIAIYGFW---SIIQYGLLNVVE 593

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.144    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,299,994
Number of extensions: 531022
Number of successful extensions: 1767
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1793
Number of HSP's successfully gapped: 27
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 61 (28.1 bits)