Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06842g2.533ON50650613550.0
Kwal_26.80212.533ON5071184952e-55
SAKL0A09482g2.533ON3881263348e-34
TPHA0G035102.533ON3871563013e-29
ZYRO0B02002g2.533ON2941072911e-28
TDEL0A030702.533ON2391362862e-28
TBLA0G022302.533ON2161212816e-28
CAGL0K03003g2.533ON6471192961e-27
KNAG0C058102.533ON5541262862e-26
NDAI0H014002.533ON5411502833e-26
KAFR0A018602.533ON4901292815e-26
NDAI0K018602.533ON7301342756e-25
AGL071C2.533ON3961352697e-25
NCAS0F009002.533ON5251562729e-25
Ecym_72552.533ON5441482702e-24
Kpol_1018.332.533ON5891122684e-24
NCAS0A048002.533ON5111102602e-23
KLLA0E18547g2.533ON4311212548e-23
Smik_13.2492.533ON4731332495e-22
Skud_13.2262.533ON4751452353e-20
YMR070W (MOT3)2.533ON4901422311e-19
TBLA0I014802.533ON513622258e-19
Suva_13.2462.533ON419612211e-18
KNAG0A070402.533ON3521142172e-18
KAFR0J003402.533ON218782067e-18
TPHA0C041902.533ON417751847e-14
Kpol_185.32.598ON647551393e-08
TPHA0C025802.598ON365551373e-08
KLLA0F26961g2.598ON694611384e-08
NCAS0H030802.598ON730681384e-08
NDAI0C005602.598ON972691384e-08
TPHA0N014602.598ON519551366e-08
TBLA0G019202.598ON523551357e-08
KAFR0F020702.598ON370551331e-07
NCAS0A129102.598ON822511351e-07
YKL062W (MSN4)2.598ON630551341e-07
Smik_11.1862.598ON641551331e-07
ZYRO0F01012g2.598ON584551331e-07
KNAG0H005502.598ON620551332e-07
ABR089C2.598ON571601332e-07
Ecym_23012.598ON767621332e-07
Skud_11.1672.598ON628551322e-07
SAKL0B11330g2.598ON499551312e-07
Kwal_26.83512.598ON698551313e-07
CAGL0M13189g2.598ON541551294e-07
KLTH0D08734g2.598ON677551295e-07
TDEL0B069102.598ON437551276e-07
CAGL0L06072g8.144ON300621241e-06
Suva_11.1642.598ON639551261e-06
ZYRO0B07568g4.214ON616841251e-06
KNAG0M023102.598ON660591251e-06
NDAI0B013402.598ON769551251e-06
NDAI0B019308.144ON436511242e-06
CAGL0F05995g2.598ON597511242e-06
Smik_13.2072.598ON703551242e-06
TDEL0B046708.144ON312561212e-06
KNAG0D041904.214ON1010621242e-06
YMR037C (MSN2)2.598ON704551233e-06
Suva_13.2062.598ON709551233e-06
Kwal_26.80112.531ON190521173e-06
TPHA0C021608.425ON1375951233e-06
KAFR0A023202.598ON443581213e-06
Skud_13.1932.598ON704551223e-06
TPHA0D010508.144ON439551214e-06
ADL051Wna 1ON173471154e-06
Kpol_1013.212.598ON494551214e-06
SAKL0H04070g4.214ON8991171214e-06
KLLA0C17072g8.144ON474561205e-06
NDAI0D042404.214ON1169661215e-06
TBLA0H028302.598ON746551206e-06
ZYRO0G19140g8.144ON557561197e-06
ACL057W8.144ON520511197e-06
KNAG0D021208.144ON402511188e-06
Ecym_84038.144ON573511198e-06
Kwal_47.172418.144ON403581188e-06
NDAI0C048608.425ON1350651198e-06
SAKL0H24816g8.144ON410511189e-06
KLTH0E06688g8.144ON397511171e-05
NCAS0B046008.144ON547511171e-05
CAGL0K02145g8.144ON317551161e-05
Kpol_1031.428.144ON359521161e-05
Ecym_4128na 2ON312581151e-05
AFR580C4.214ON838581172e-05
KNAG0G012808.144ON472511152e-05
KAFR0G030504.214ON749521162e-05
Kwal_47.190453.518ON266521132e-05
NCAS0A023104.214ON879581152e-05
TDEL0E015904.214ON7701001152e-05
Kpol_529.138.425ON1410481153e-05
CAGL0K04631g4.214ON1013551153e-05
KLTH0G01826g3.518ON307521123e-05
KAFR0B068104.351ON1155861153e-05
Suva_7.523.518ON400661133e-05
AGR186Cna 2ON287451123e-05
KLLA0F13046g8.425ON1379601144e-05
TPHA0A019408.234ON912741134e-05
SAKL0H12958g8.425ON1129671135e-05
Suva_5.2518.144ON449511125e-05
Suva_16.766.256ON392681115e-05
KLLA0B07909g4.214ON922791135e-05
NCAS0B028408.425ON1152531135e-05
TDEL0A013008.234ON837781126e-05
Smik_5.2768.144ON442511116e-05
ADL042Wna 3ON281491096e-05
Skud_5.2488.144ON442541116e-05
Ecym_27604.214ON938581127e-05
Smik_6.1504.214ON806521117e-05
KAFR0C003403.298ON394511107e-05
YER130C8.144ON443511107e-05
KNAG0G018708.234ON875531118e-05
SAKL0F01980g3.518ON385511098e-05
KAFR0B025508.234ON890531109e-05
KAFR0B063608.425ON627521101e-04
ZYRO0B11770g8.234ON867581101e-04
KNAG0J022503.296ON296821081e-04
TBLA0F038308.234ON967531101e-04
Skud_7.3644.214ON810521091e-04
KLLA0F20636gsingletonON285491071e-04
Suva_7.3494.214ON812521091e-04
TBLA0F003708.144ON687561091e-04
KNAG0I020702.162ON572771081e-04
YGR067C4.214ON804521082e-04
KAFR0B021608.144ON453511072e-04
AGR172W8.425ON1057651082e-04
TPHA0A039103.298ON351861062e-04
Smik_6.4356.256ON386581072e-04
YGL209W (MIG2)3.518ON382651072e-04
YPL230W (USV1)6.256ON391581062e-04
YPL038W (MET31)8.486ON177701022e-04
ZYRO0E08426g3.518ON171521022e-04
TDEL0F055008.425ON1207601072e-04
Kpol_472.104.214ON830501072e-04
Kpol_1032.528.234ON824531072e-04
CAGL0L11880g8.234ON980531072e-04
NDAI0C06260na 4ON582821062e-04
Smik_7.543.518ON382521053e-04
CAGL0E04884g8.425ON1489531073e-04
Skud_7.593.518ON383521053e-04
NDAI0G034208.144ON484511063e-04
Skud_5.3088.234ON802531063e-04
ZYRO0B14894g4.351ON1119731073e-04
TBLA0I027004.214ON737501063e-04
KNAG0B005903.518ON439521053e-04
YER169W (RPH1)8.234ON796531063e-04
Smik_5.3418.234ON798531063e-04
Suva_16.5187.543ON427501053e-04
Skud_16.486.256ON398581053e-04
NCAS0C040708.144ON289611043e-04
KLTH0E09922g8.425ON1119721063e-04
Skud_16.2438.486ON177741004e-04
ZYRO0A09416g8.425ON1346531064e-04
KNAG0A044608.425ON1290521054e-04
TDEL0F026904.80ON350581044e-04
Suva_5.3038.234ON797531054e-04
TBLA0I032803.518ON330511034e-04
SAKL0D06776g1.326ON767521054e-04
Kpol_1052.83.298ON386601034e-04
NDAI0B060203.518ON426521045e-04
Ecym_8387na 5ON17949995e-04
Smik_16.1978.486ON17168995e-04
KLTH0H08800g8.117ON16854995e-04
AGR117C8.234ON799741045e-04
KAFR0F041503.518ON416521035e-04
YDR216W (ADR1)8.425ON1323521046e-04
TBLA0H006608.425ON1311601046e-04
Ecym_8379na 3ON305491026e-04
KAFR0C029808.144ON225511006e-04
Skud_4.3548.234ON916531036e-04
SAKL0H17842g8.234ON814581036e-04
Kwal_27.104673.298ON302931016e-04
KLLA0C17710g8.234ON821631037e-04
KAFR0I023703.518ON391521027e-04
YDR096W (GIS1)8.234ON894531037e-04
Ecym_8388na 1ON223471007e-04
Smik_4.4638.425ON1324521037e-04
Smik_4.3378.234ON894531037e-04
Suva_2.3838.425ON1319521037e-04
NDAI0I029003.518ON524671027e-04
Kpol_541.398.116ON291741017e-04
Klac_YGOB_Anc_3.5183.518ON239521007e-04
KLTH0D06798g2.531ON11154948e-04
Suva_16.2788.486ON17568988e-04
KLTH0G14454g8.234ON832581028e-04
Suva_2.2558.234ON894531029e-04
NDAI0B022508.234ON1156581029e-04
Skud_4.4788.425ON1323521029e-04
Kwal_56.234538.234ON828581029e-04
NCAS0E006103.518ON401521019e-04
Ecym_35208.234ON819521020.001
SAKL0H20988g4.80ON548511010.001
ADL050Wna 5ON14659960.001
KNAG0H030108.234ON784521020.001
Ecym_54242.162ON775581010.001
NCAS0B048408.234ON864681010.001
CAGL0G08107g8.234ON625521010.001
KNAG0H010703.298ON32252990.001
CAGL0E06116g6.256ON613851000.001
KNAG0M003504.351ON1076601010.001
TPHA0B003804.351ON1310471010.001
TBLA0B012802.162ON823501000.001
TBLA0E047704.351ON1655631010.001
KNAG0E016003.518ON33851990.001
AEL278W7.543ON47650990.002
YML081W (TDA9)4.351ON12511091000.002
AFR531Wna 6ON27461980.002
Kpol_1050.1097.543ON38450990.002
Kwal_47.166214.351ON1178521000.002
KLTH0D18062g4.351ON1128521000.002
TBLA0E04210singletonON45450990.002
NCAS0F009202.531ON35455980.002
Smik_13.584.351ON12531091000.002
SAKL0F16170g7.543ON43734990.002
Kpol_1065.483.298ON36460980.002
SAKL0E10714g2.162ON81967990.002
SAKL0A03476g6.256ON32275980.002
Suva_2.4198.486ON19176950.002
KLLA0F01463g1.326ON78150990.002
KLTH0H09196g4.80ON46056980.002
KNAG0G011408.117ON51951980.002
NCAS0C024308.486ON19996950.002
TPHA0B029102.162ON71758980.002
Smik_5.1513.518ON38858970.002
Ecym_8389singletonON25185960.002
SAKL0G18062g4.351ON123852990.003
CAGL0C02519g3.518ON31852970.003
Kpol_1050.193.518ON22154950.003
TBLA0G032403.298ON51151980.003
Smik_16.4507.543ON43250970.003
AER159C4.351ON119152980.003
NDAI0A075403.298ON37051970.003
TPHA0D034003.518ON33857970.003
TBLA0E042208.234ON51950970.003
Skud_5.1373.518ON39452970.003
Smik_13.3876.256ON21265940.003
Ecym_14154.80ON50451970.003
NDAI0B042902.162ON106482980.003
Suva_13.3636.256ON21155940.003
Ecym_25368.486ON24064950.003
CAGL0J05060g1.326ON71345970.003
Kwal_23.54007.543ON42934970.003
CAGL0M01870g3.298ON315147960.003
TDEL0D058603.518ON33052960.003
ZYRO0B16148g2.162ON93077970.003
KLLA0B04477g4.351ON133252970.003
Kpol_1001.14.351ON134147970.003
TDEL0B052502.162ON71477970.004
TDEL0D006704.351ON119952970.004
Kwal_14.22784.80ON46356960.004
Smik_4.5008.486ON19380930.004
NDAI0I009906.256ON40957960.004
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06842g
         (506 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...   526   0.0  
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...   195   2e-55
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...   133   8e-34
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...   120   3e-29
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...   116   1e-28
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...   114   2e-28
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...   112   6e-28
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...   118   1e-27
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...   114   2e-26
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...   113   3e-26
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...   112   5e-26
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...   110   6e-25
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...   108   7e-25
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...   109   9e-25
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...   108   2e-24
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...   107   4e-24
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...   104   2e-23
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...   102   8e-23
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...   100   5e-22
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    95   3e-20
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    94   1e-19
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    91   8e-19
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    90   1e-18
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    88   2e-18
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       84   7e-18
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    75   7e-14
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    58   3e-08
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    57   3e-08
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    58   4e-08
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    58   4e-08
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     58   4e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    57   6e-08
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    57   7e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    56   1e-07
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    57   1e-07
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    56   1e-07
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    56   1e-07
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    56   1e-07
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    56   2e-07
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    56   2e-07
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    56   2e-07
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    55   2e-07
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    55   2e-07
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    55   3e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    54   4e-07
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    54   5e-07
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    54   6e-07
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    52   1e-06
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    53   1e-06
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    53   1e-06
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    53   1e-06
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     53   1e-06
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     52   2e-06
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    52   2e-06
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    52   2e-06
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    51   2e-06
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    52   2e-06
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    52   3e-06
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    52   3e-06
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    50   3e-06
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    52   3e-06
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    51   3e-06
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    52   3e-06
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    51   4e-06
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    49   4e-06
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    51   4e-06
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    51   4e-06
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    51   5e-06
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    51   5e-06
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    51   6e-06
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    50   7e-06
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    50   7e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    50   8e-06
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    50   8e-06
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    50   8e-06
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    50   8e-06
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    50   9e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    50   1e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    50   1e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    49   1e-05
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    49   1e-05
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    49   1e-05
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    50   2e-05
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    49   2e-05
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    49   2e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    48   2e-05
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    49   2e-05
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    49   2e-05
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    49   3e-05
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    49   3e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    48   3e-05
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    49   3e-05
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    48   3e-05
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    48   3e-05
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    49   4e-05
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    48   4e-05
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    48   5e-05
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    48   5e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    47   5e-05
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    48   5e-05
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    48   5e-05
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    48   6e-05
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   6e-05
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    47   6e-05
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    47   6e-05
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    48   7e-05
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    47   7e-05
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    47   7e-05
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   7e-05
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    47   8e-05
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    47   8e-05
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    47   9e-05
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    47   1e-04
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    47   1e-04
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               46   1e-04
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    47   1e-04
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    47   1e-04
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    46   1e-04
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    47   1e-04
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    47   1e-04
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    46   1e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    46   2e-04
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    46   2e-04
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    46   2e-04
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    45   2e-04
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    46   2e-04
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    46   2e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    45   2e-04
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    44   2e-04
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    44   2e-04
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    46   2e-04
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    46   2e-04
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    46   2e-04
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    46   2e-04
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             45   2e-04
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    45   3e-04
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    46   3e-04
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    45   3e-04
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    45   3e-04
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    45   3e-04
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    46   3e-04
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    45   3e-04
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    45   3e-04
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    45   3e-04
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    45   3e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    45   3e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    45   3e-04
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      45   3e-04
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    45   3e-04
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    43   4e-04
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    45   4e-04
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    45   4e-04
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    45   4e-04
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    45   4e-04
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    44   4e-04
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    45   4e-04
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    44   4e-04
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    45   5e-04
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    43   5e-04
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    43   5e-04
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    43   5e-04
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    45   5e-04
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    44   5e-04
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    45   6e-04
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    45   6e-04
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    44   6e-04
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    43   6e-04
Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W ...    44   6e-04
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    44   6e-04
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    44   6e-04
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    44   7e-04
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    44   7e-04
YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC d...    44   7e-04
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    43   7e-04
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    44   7e-04
Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W ...    44   7e-04
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    44   7e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    44   7e-04
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    44   7e-04
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    43   7e-04
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    41   8e-04
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    42   8e-04
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    44   8e-04
Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W ...    44   9e-04
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    44   9e-04
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    44   9e-04
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    44   9e-04
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     44   9e-04
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    44   0.001
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    44   0.001
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    42   0.001
KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.2...    44   0.001
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    44   0.001
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     44   0.001
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    44   0.001
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    43   0.001
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    43   0.001
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    44   0.001
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    44   0.001
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    43   0.001
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    44   0.001
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    43   0.001
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    43   0.002
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    43   0.002
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    42   0.002
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    43   0.002
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    43   0.002
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    43   0.002
TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON}             43   0.002
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     42   0.002
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    43   0.002
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    43   0.002
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    42   0.002
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    43   0.002
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    42   0.002
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    41   0.002
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    43   0.002
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    42   0.002
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    42   0.002
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      41   0.002
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    42   0.002
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    42   0.002
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    42   0.002
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    43   0.003
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    42   0.003
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    41   0.003
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     42   0.003
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    42   0.003
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    42   0.003
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    42   0.003
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    42   0.003
TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON} Anc_8...    42   0.003
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    42   0.003
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    41   0.003
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   0.003
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    42   0.003
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    41   0.003
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    41   0.003
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    42   0.003
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    42   0.003
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    42   0.003
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    42   0.003
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    42   0.003
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    42   0.003
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    42   0.003
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    42   0.004
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    42   0.004
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    42   0.004
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    40   0.004
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    42   0.004
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    42   0.004
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    42   0.004
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    42   0.004
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    40   0.004
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    42   0.004
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    42   0.004
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    42   0.004
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    42   0.004
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    41   0.004
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    41   0.004
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    42   0.004
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     42   0.005
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    42   0.005
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    41   0.005
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    40   0.005
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    42   0.005
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    42   0.005
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    42   0.005
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    42   0.005
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    41   0.005
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    41   0.006
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    41   0.006
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    41   0.006
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    41   0.006
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    41   0.006
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    41   0.006
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    41   0.006
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    41   0.006
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    41   0.006
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    41   0.007
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    41   0.007
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    41   0.007
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    40   0.007
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    41   0.007
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    40   0.007
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      41   0.007
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    40   0.007
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    40   0.007
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    40   0.007
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    41   0.008
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      40   0.008
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             40   0.008
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    40   0.008
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    41   0.008
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    39   0.009
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    40   0.009
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    39   0.009
Skud_10.351 Chr10 complement(617553..621332,621389..621469,62146...    41   0.009
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    40   0.010
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               40   0.010
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    40   0.010
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    40   0.010
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      40   0.010
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    40   0.010
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    40   0.010
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    40   0.010
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    40   0.010
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    40   0.011
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    40   0.011
Suva_12.218 Chr12 complement(338418..342230) [3813 bp, 1270 aa] ...    40   0.011
KLTH0H15048g Chr8 (1303474..1304364) [891 bp, 296 aa] {ON} some ...    40   0.011
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    40   0.011
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    40   0.012
YJR127C Chr10 complement(658917..663059) [4143 bp, 1380 aa] {ON}...    40   0.012
Smik_10.420 Chr10 complement(647997..651776,651798..651836,65184...    40   0.013
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    39   0.013
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    40   0.013
KAFR0A06720 Chr1 (1361355..1362062) [708 bp, 235 aa] {ON} Anc_5....    39   0.013
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    40   0.014
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    40   0.014
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    39   0.015
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    39   0.015
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    40   0.015
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    39   0.015
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    40   0.016
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    40   0.016
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    40   0.016
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               39   0.017
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    39   0.017
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    39   0.017
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    39   0.017
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    37   0.018
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    39   0.019
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    40   0.019
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    40   0.020
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    39   0.020
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    40   0.020
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     39   0.020
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    39   0.021
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    39   0.021
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    39   0.022
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    39   0.023
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                39   0.023
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    38   0.023
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    39   0.024
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    39   0.024
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    38   0.024
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    39   0.025
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                38   0.026
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    39   0.026
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    39   0.028
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    39   0.029
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    39   0.030
KNAG0B06710 Chr2 complement(1325084..1328245) [3162 bp, 1053 aa]...    39   0.031
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    39   0.032
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    39   0.032
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    39   0.033
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    38   0.033
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    39   0.033
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               39   0.034
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    39   0.034
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    38   0.035
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    37   0.036
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    38   0.037
Smik_8.63 Chr8 (97366..98994) [1629 bp, 542 aa] {ON} YHR006W (REAL)    39   0.037
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    39   0.039
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    39   0.039
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    39   0.039
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    38   0.040
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    39   0.041
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    38   0.044
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    38   0.044
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    39   0.045
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     39   0.045
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    38   0.046
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    37   0.047
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    38   0.047
NDAI0H01110 Chr8 (247915..249279) [1365 bp, 454 aa] {ON} Anc_5.586     38   0.049
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    38   0.049
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    38   0.051
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    38   0.051
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    38   0.053
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    38   0.053
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    38   0.054
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    38   0.054
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    38   0.055
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    38   0.056
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    37   0.056
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    38   0.056
Ecym_1475 Chr1 (978578..979627) [1050 bp, 349 aa] {ON} similar t...    38   0.058
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    38   0.058
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    38   0.059
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    38   0.060
Skud_8.55 Chr8 (100188..101795) [1608 bp, 535 aa] {ON} YHR006W (...    38   0.063
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                37   0.063
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    37   0.064
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    36   0.064
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    38   0.065
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    37   0.069
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    37   0.070
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    37   0.070
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      37   0.071
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    38   0.073
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    37   0.073
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    37   0.079
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    37   0.080
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    37   0.081
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               37   0.083
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    36   0.084
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    38   0.084
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    37   0.085
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    37   0.087
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    37   0.088
ZYRO0D13992g Chr4 (1178918..1180681) [1764 bp, 587 aa] {ON} simi...    37   0.089
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    37   0.090
KNAG0C06030 Chr3 (1176811..1177755) [945 bp, 314 aa] {ON} Anc_5....    37   0.090
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    37   0.091
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    37   0.095
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    37   0.097
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    37   0.100
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    35   0.10 
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    37   0.10 
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    37   0.11 
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    36   0.11 
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    37   0.11 
Suva_8.62 Chr8 (113740..115377) [1638 bp, 545 aa] {ON} YHR006W (...    37   0.11 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    37   0.11 
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    35   0.12 
CAGL0K06413g Chr11 (628640..629719) [1080 bp, 359 aa] {ON} some ...    37   0.12 
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    37   0.13 
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    37   0.13 
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    37   0.13 
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    37   0.13 
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    33   0.13 
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    37   0.13 
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    36   0.14 
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    36   0.14 
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    37   0.14 
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    36   0.14 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    36   0.14 
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    37   0.15 
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    36   0.15 
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    37   0.15 
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    37   0.16 
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    36   0.16 
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    36   0.16 
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    37   0.17 
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     36   0.17 
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    36   0.17 
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    36   0.18 
Kwal_34.15946 s34 complement(130149..130988) [840 bp, 279 aa] {O...    36   0.18 
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    36   0.18 
SAKL0G06292g Chr7 (522850..524403) [1554 bp, 517 aa] {ON} unipro...    36   0.18 
SAKL0B05434g Chr2 (467863..468897) [1035 bp, 344 aa] {ON} some s...    36   0.21 
KLLA0F10109g Chr6 complement(939195..941066) [1872 bp, 623 aa] {...    36   0.21 
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      36   0.21 
NCAS0A07900 Chr1 complement(1570244..1571347) [1104 bp, 367 aa] ...    36   0.21 
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    36   0.22 
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    36   0.22 
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    36   0.22 
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    35   0.23 
YHR006W Chr8 (117814..119439) [1626 bp, 541 aa] {ON}  STP2Transc...    36   0.23 
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    36   0.23 
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                35   0.23 
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    36   0.25 
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    35   0.25 
Smik_4.742 Chr4 (1308041..1309627) [1587 bp, 528 aa] {ON} YDR463...    36   0.25 
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    35   0.25 
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    35   0.25 
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    36   0.27 
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    36   0.27 
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    35   0.29 
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    36   0.32 
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    34   0.33 
CAGL0E04312g Chr5 (412800..414866) [2067 bp, 688 aa] {ON} some s...    35   0.34 
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    35   0.34 
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    35   0.35 
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    35   0.35 
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    35   0.37 
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    35   0.39 
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    35   0.39 
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    35   0.39 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    35   0.39 
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    35   0.39 
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    35   0.42 
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    34   0.42 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    35   0.42 
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    35   0.43 
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    35   0.44 
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    35   0.45 
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    35   0.47 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    35   0.50 
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    35   0.51 
KAFR0C05710 Chr3 (1136694..1138022) [1329 bp, 442 aa] {ON} Anc_5...    35   0.53 
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      35   0.54 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    35   0.54 
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                34   0.60 
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    35   0.61 
CAGL0K04697g Chr11 (459195..460742) [1548 bp, 515 aa] {ON} some ...    35   0.61 
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    35   0.64 
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    34   0.69 
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               34   0.69 
Ecym_1404 Chr1 complement(840220..841908) [1689 bp, 562 aa] {ON}...    34   0.70 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    35   0.71 
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    34   0.73 
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    34   0.78 
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    34   0.80 
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     34   0.90 
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       32   1.0  
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    34   1.0  
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    33   1.0  
Kpol_1023.63 s1023 complement(144388..146058) [1671 bp, 556 aa] ...    34   1.0  
TBLA0E02820 Chr5 complement(699189..700127) [939 bp, 312 aa] {ON...    33   1.1  
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    33   1.1  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 34   1.1  
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    33   1.2  
TPHA0B02390 Chr2 complement(547109..548149) [1041 bp, 346 aa] {O...    33   1.3  
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      33   1.3  
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    33   1.3  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    33   1.3  
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    32   1.4  
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    33   1.5  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      32   1.6  
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    33   1.6  
AFR461C Chr6 complement(1270007..1271641) [1635 bp, 544 aa] {ON}...    33   1.7  
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    33   1.9  
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    33   1.9  
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    33   1.9  
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    33   2.0  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    33   2.3  
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    32   2.5  
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    33   2.5  
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    33   2.6  
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    33   2.7  
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    33   2.7  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   2.7  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    32   2.8  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   3.0  
NDAI0C00690 Chr3 complement(134897..136849) [1953 bp, 650 aa] {O...    32   3.3  
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    32   3.3  
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    32   3.4  
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    32   3.4  
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    32   3.5  
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    32   3.6  
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  32   3.7  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   3.7  
KLTH0G17336g Chr7 (1500141..1501598) [1458 bp, 485 aa] {ON} some...    32   3.8  
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    32   3.9  
TDEL0A04530 Chr1 (805574..807028) [1455 bp, 484 aa] {ON} Anc_5.5...    32   4.0  
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     32   4.6  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   4.6  
NCAS0A02360 Chr1 (448263..449699) [1437 bp, 478 aa] {ON} Anc_4.222     32   4.7  
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    31   4.9  
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    32   5.0  
SAKL0B04664g Chr2 complement(410577..411857) [1281 bp, 426 aa] {...    32   5.1  
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    32   5.1  
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    32   5.2  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    32   5.2  
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    32   5.2  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    31   5.6  
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    31   5.8  
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    32   5.9  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    32   6.1  
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    32   6.8  
NDAI0J02060 Chr10 (505150..506619) [1470 bp, 489 aa] {ON} Anc_4....    31   7.6  
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    31   7.9  
TPHA0K00210 Chr11 complement(34961..36406) [1446 bp, 481 aa] {ON...    31   8.6  
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    31   8.8  
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    31   9.0  
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    31   9.1  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    31   9.1  
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    31   9.5  

>KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 506

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/506 (58%), Positives = 294/506 (58%)

Query: 1   MLSVHPYTSPADIDRDARRGSSQLDFRRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MLSVHPYTSPADIDRDARRGSSQLDFRRR                               
Sbjct: 1   MLSVHPYTSPADIDRDARRGSSQLDFRRRSSASSVASIGGAAAGGGPAQSPTSALWAAAP 60

Query: 61  XXXXXXXXXXXXXXXXXVHRQPQYSVAQMHSQAYAIRQKHARASSTDSSXXXXXXXXXXX 120
                            VHRQPQYSVAQMHSQAYAIRQKHARASSTDSS           
Sbjct: 61  APAPAPPLVPPAAVSSTVHRQPQYSVAQMHSQAYAIRQKHARASSTDSSGTPIPGPAAAV 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXLYELMEYDTRYLPYHYKSAYPMWXXXXXXXXXX 180
                                      LYELMEYDTRYLPYHYKSAYPMW          
Sbjct: 121 TTPGPASVPAPVTAAQQQPPPPPIGGPLYELMEYDTRYLPYHYKSAYPMWGPAGPTAAAA 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXWNSYQAPHHVWNGQPAASSGGYPHMXXXXXXXXXXX 240
                                   WNSYQAPHHVWNGQPAASSGGYPHM           
Sbjct: 181 GTAPGTAPGAPGAAYPAYQYPPPAWNSYQAPHHVWNGQPAASSGGYPHMQLQIPTQLPQQ 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLHRQSISHRQSQGFSAD 300
                                                     SLHRQSISHRQSQGFSAD
Sbjct: 241 PQMTTSQQQQQQQQQQQQQPHQPQQPQQQYQFQQQPQQPQQPSLHRQSISHRQSQGFSAD 300

Query: 301 QFPSALAATELPLSAYAPDPRSGAQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           QFPSALAATELPLSAYAPDPRSGAQL                                  
Sbjct: 301 QFPSALAATELPLSAYAPDPRSGAQLAGRPYVVAAAPGPAAASAPFGLGAVGIGAGAGAG 360

Query: 361 XXXXXPYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW 420
                PYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW
Sbjct: 361 ARGPAPYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW 420

Query: 421 CQSRHKRRDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQD 480
           CQSRHKRRDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQD
Sbjct: 421 CQSRHKRRDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQD 480

Query: 481 GRVKKERVKTVLNAVIARVHDGEPGQ 506
           GRVKKERVKTVLNAVIARVHDGEPGQ
Sbjct: 481 GRVKKERVKTVLNAVIARVHDGEPGQ 506

>Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W
           (MOT3) - 2 Cys2-His2 zinc fingers at c-terminus,
           glutamine and asparagine rich [contig 55] FULL
          Length = 507

 Score =  195 bits (495), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 104/118 (88%), Gaps = 1/118 (0%)

Query: 386 MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           + YRCSMC+KSFKR+SWH+RHLLSHSSFKPY+CPWCQSRHKRRDNLFQHMKTKHV  V+Q
Sbjct: 387 VAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPWCQSRHKRRDNLFQHMKTKHVRHVVQ 446

Query: 446 ELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGE 503
           EL+E GD+DGS+ + +++  D+    PSI+TL+QDG+VKKERVK VLNAVIARV +GE
Sbjct: 447 ELLEVGDVDGSVMSGMQVTSDESAPEPSIKTLIQDGQVKKERVKAVLNAVIARV-NGE 503

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 150 ELMEYDTRYLPYHYKSAYPMW 170
           E  EYD RY+PY+YK AYP W
Sbjct: 176 EYTEYDQRYVPYYYKPAYPGW 196

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score =  133 bits (334), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (65%), Gaps = 15/126 (11%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           ++C +C+KSFKRKSW +RHLLSHSS KP+NCPWCQSRHKR+DNL QHMK KH  QVLQEL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPWCQSRHKRKDNLLQHMKLKHTPQVLQEL 317

Query: 448 MEAG-----------DLDGSMGTNVRLAI----DDMVAGPSIRTLVQDGRVKKERVKTVL 492
             AG           +L  + G N   ++     DM    SI+T++ DG + K+ VK VL
Sbjct: 318 QSAGVHPIVSNITLINLASTAGQNGVPSLVPVHGDMSMMTSIKTMIDDGTLNKDDVKRVL 377

Query: 493 NAVIAR 498
           N +I R
Sbjct: 378 NMLINR 383

>TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.533
           YMR070W
          Length = 387

 Score =  120 bits (301), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 25/156 (16%)

Query: 367 YSGTGSDRGSF---DDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQS 423
           Y+     + SF   D+   +   ++RC++C K FKRKSW +RHLLSHSS + Y+CPWC S
Sbjct: 230 YAQNNQQQDSFAFSDNIYMNNKYIFRCNVCGKYFKRKSWLKRHLLSHSSNRQYSCPWCLS 289

Query: 424 RHKRRDNLFQHMKTKHVHQVLQEL-------MEAGDLDGSMGTNVRLAIDDMVA------ 470
           +HKR+DNL QHMK KH  QVLQE+       +E  D + S GT+    I +  A      
Sbjct: 290 KHKRKDNLLQHMKLKHKQQVLQEMDKLSESSLELND-ESSTGTDTASPIVNETALSMLND 348

Query: 471 --------GPSIRTLVQDGRVKKERVKTVLNAVIAR 498
                     SI  +V +G +KKE VK VLN++I R
Sbjct: 349 DSGSSSNDNVSIIAMVDNGTLKKENVKKVLNSIIER 384

>ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 294

 Score =  116 bits (291), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 11/107 (10%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQELME 449
           C MC+KSFKRKSW +RHLLSHS  + + CPWC S+HKR+DNL QHMK KH   VL++L  
Sbjct: 194 CPMCDKSFKRKSWLRRHLLSHSPERHFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKL-- 251

Query: 450 AGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVI 496
                     N  + ID  V   +IRTL+ +GR+ KE VK VLN +I
Sbjct: 252 ---------RNQNVGIDGEVRNDNIRTLLCEGRLNKEDVKKVLNGLI 289

>TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.533
           YMR070W
          Length = 239

 Score =  114 bits (286), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 84/136 (61%), Gaps = 10/136 (7%)

Query: 368 SGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKR 427
           +   S+    ++   +   +++C +C KSFKRKSW QRHLLSHS  + ++CPWC S+HKR
Sbjct: 114 ASLSSNSADDEEQREAQGYVHKCHLCNKSFKRKSWLQRHLLSHSPARHFSCPWCLSKHKR 173

Query: 428 RDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKER 487
           +DNL QHMK KH   VLQEL            NV ++ +      +IRTL+ +GR+ K+ 
Sbjct: 174 KDNLLQHMKLKHTDYVLQEL---------RLNNVYVSTEGSCKN-NIRTLLYEGRLNKDE 223

Query: 488 VKTVLNAVIARVHDGE 503
           VK VLN++I R ++ +
Sbjct: 224 VKKVLNSLIDRHNNNQ 239

>TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.533
           YMR070W
          Length = 216

 Score =  112 bits (281), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 80/121 (66%), Gaps = 8/121 (6%)

Query: 377 FDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           ++ + + MA  ++C  CEK FKRKSW +RH+LSHS  + Y+CPWC SRHKR+DNL QHMK
Sbjct: 103 YNSSMNEMA-YHKCPQCEKRFKRKSWLKRHMLSHSEERQYSCPWCISRHKRKDNLLQHMK 161

Query: 437 TKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVI 496
            KH  +VL++L     L+G  G       ++M+   +IRT++ +G + K+ VK VLN ++
Sbjct: 162 LKHTDEVLKKLKMTCYLEGDDG-------EEMMNRDNIRTMLYEGLLDKDEVKKVLNELL 214

Query: 497 A 497
            
Sbjct: 215 E 215

>CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakly
           similar to uniprot|P54785 Saccharomyces cerevisiae
           YMR070w MOT3
          Length = 647

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 79/119 (66%), Gaps = 3/119 (2%)

Query: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           SS+A  +RC +C K FKRKSW +RHLLSHS  + + CPWC SRHKRRDNL QHMK KHV 
Sbjct: 528 SSLAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDNLLQHMKLKHVP 587

Query: 442 QVLQELMEAGDLDGSMGTNVRLA--IDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIAR 498
            +LQE+  + ++  +     RL+  ID  +  P  +TL+ +G + K+ +K +LN VI +
Sbjct: 588 NLLQEI-NSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDELKNILNTVIDK 645

>KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa]
           {ON} Anc_2.533 YMR070W
          Length = 554

 Score =  114 bits (286), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 75/126 (59%), Gaps = 6/126 (4%)

Query: 379 DTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           D  S    +++C +CEKSFKR+SW +RHLLSHS+ + Y CPWC SRHKR+DNL QHMK K
Sbjct: 427 DNSSPSNFIHKCHLCEKSFKRRSWLKRHLLSHSAERHYLCPWCLSRHKRKDNLLQHMKLK 486

Query: 439 HVHQVLQELMEA------GDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVL 492
           H + +L EL  A      G  DG   T+            SI+ L+  G + K+ VK VL
Sbjct: 487 HSNYLLDELKNANVSFNWGTYDGQNSTDSMPKTLSGYPDSSIKKLLYRGILNKDDVKRVL 546

Query: 493 NAVIAR 498
           N +I R
Sbjct: 547 NKIIER 552

>NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {ON}
           Anc_2.533
          Length = 541

 Score =  113 bits (283), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 79/150 (52%), Gaps = 32/150 (21%)

Query: 375 GSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           G FD    S    YRC +CEK FKR+SW +RHLLSHSS + Y CPWC SRHKRRDNL QH
Sbjct: 391 GEFDIESQS----YRCRICEKKFKRRSWLKRHLLSHSSERHYLCPWCLSRHKRRDNLLQH 446

Query: 435 MKTKHVHQVLQELM----------------------EAGDLDGSMGTNVRLAIDDMVAGP 472
           MK KH + ++ EL                           ++  M   V   +D+ V+ P
Sbjct: 447 MKLKHPNNLINELKLRNFISSQTAAASVAFVTSAAPSIMSINDGMNNTVAGTVDNAVSTP 506

Query: 473 ------SIRTLVQDGRVKKERVKTVLNAVI 496
                 +I+ L+ +G + KE VK +LN +I
Sbjct: 507 GYETGITIKDLISEGLINKEDVKRLLNILI 536

>KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.533
           YMR070W
          Length = 490

 Score =  112 bits (281), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 81/129 (62%), Gaps = 4/129 (3%)

Query: 368 SGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKR 427
           +G  +D  S +  G ++ +++ C +CEKSF+RKSW +RHLLSHS+ + + CPWC SRHKR
Sbjct: 334 NGDNTDNSS-NVIGGNLTLIHSCHLCEKSFRRKSWLKRHLLSHSTERQFLCPWCLSRHKR 392

Query: 428 RDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKER 487
           +DNL QHMK KH + ++ EL +   +   +    R  ++D      IR L+  G + K+ 
Sbjct: 393 KDNLLQHMKLKHSNYLVIELKKNNAVFSCVNGGNREKLNDT---DDIRNLISLGVINKDD 449

Query: 488 VKTVLNAVI 496
           VK V+N +I
Sbjct: 450 VKKVINKLI 458

>NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {ON}
           Anc_2.533
          Length = 730

 Score =  110 bits (275), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 80/134 (59%), Gaps = 24/134 (17%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +++CS C KSFKR SW +RHLL+HS  + Y+CPWC S+HKR+DNL QH+K KH   VLQ+
Sbjct: 559 VFQCSYCVKSFKRFSWLKRHLLAHSPERHYSCPWCLSKHKRKDNLLQHLKLKHTEMVLQQ 618

Query: 447 L-------------MEAGDLD----------GSMGTNVRLAIDDMV-AGPSIRTLVQDGR 482
           L             ME   +D          G+ G N  + I ++   G +I+TL+ DGR
Sbjct: 619 LRLENIEISTIEETMEDRRVDVHERSKSVDTGTSGVNDDIDIKNVKQPGTNIKTLLYDGR 678

Query: 483 VKKERVKTVLNAVI 496
           + KE VK VLN ++
Sbjct: 679 LNKEDVKKVLNKLL 692

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score =  108 bits (269), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 78/135 (57%), Gaps = 20/135 (14%)

Query: 373 DRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLF 432
           D  SF++       +++C  CEK+FKRKSW +RHLLSHS+ KPY+CPWC SRHKR+DNL 
Sbjct: 177 DLNSFEN-------IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLS 229

Query: 433 QHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGP-----------SIRTLVQDG 481
           QH+K KH   +L+ L    +   S+    RL   D  AG            SI+ ++  G
Sbjct: 230 QHLKLKHAEMLLERLSSNPNTPTSLIN--RLHSSDAAAGSAAAAAGTPAAFSIKDMIDSG 287

Query: 482 RVKKERVKTVLNAVI 496
            + K  VK  LN++I
Sbjct: 288 MLSKNEVKKTLNSLI 302

>NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {ON}
           Anc_2.533
          Length = 525

 Score =  109 bits (272), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 82/156 (52%), Gaps = 33/156 (21%)

Query: 374 RGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQ 433
           RG+FD   +    +Y C +C K+FKR+SW +RHLLSHSS + Y CPWC SRHKRRDNL Q
Sbjct: 378 RGTFDSENA----VYICHICSKNFKRRSWLKRHLLSHSSERHYFCPWCLSRHKRRDNLLQ 433

Query: 434 HMKTKHVHQVLQEL--------------------MEAGDLDGSM-----GTNVRLAIDDM 468
           HMK KH   ++ EL                     +     G M     G N    I+  
Sbjct: 434 HMKLKHSKNLINELKFRNVIFDWHNYHYQQQVQRHQQYQQQGGMPPQIHGANEPFNINSE 493

Query: 469 VAGPSIRTLVQDGRVKKERVKTVLNAVIARVHDGEP 504
               +IRTLV +G V KE VK VLN ++   ++ EP
Sbjct: 494 F---TIRTLVTNGVVNKEDVKRVLNQLVDE-NENEP 525

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 80/148 (54%), Gaps = 31/148 (20%)

Query: 373 DRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLF 432
           D  SF++       +++C  CEK+FKRKSW +RHLLSHS+ KPY+CPWC SRHKR+DNL 
Sbjct: 278 DPNSFEN-------IHKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPWCHSRHKRKDNLS 330

Query: 433 QHMKTKHVHQVLQELMEAGDLDGSM------GTNVRLAIDDMVA---------------G 471
           QH+K KH   +L+ L    +    +      G N  +A+    A               G
Sbjct: 331 QHLKLKHAEMLLERLSSNPNTASHLMNRLHSGANGAVAVTAASADSSATMVSSSSSSAAG 390

Query: 472 P---SIRTLVQDGRVKKERVKTVLNAVI 496
           P   SI+ ++  G + K  VK  LN++I
Sbjct: 391 PTTFSIKDMIDSGMLSKNEVKKTLNSLI 418

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score =  107 bits (268), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 75/112 (66%), Gaps = 8/112 (7%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL-- 447
           C +C K FKRKSW QRHLLSHSS + ++CPWC S+HKR+DNL QHMK KH   VL++L  
Sbjct: 479 CHICGKQFKRKSWLQRHLLSHSSERNFDCPWCLSKHKRKDNLLQHMKLKHAENVLEQLRI 538

Query: 448 -MEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIAR 498
            ++A + + +    +    D      +IRTL+ +G + K+ VK +LN+++A+
Sbjct: 539 NLKANNPNDNSEPTLEGNGDH-----NIRTLMGEGILNKDEVKKLLNSLVAQ 585

>NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {ON}
           Anc_2.533
          Length = 511

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +Y+C MC KSF+R SW +RHLL+HSS + Y+CP C S+HKR+DNL QH+K KH   VL++
Sbjct: 386 VYQCHMCVKSFRRHSWLKRHLLAHSSQRHYSCPKCVSKHKRKDNLLQHLKLKHTAFVLEQ 445

Query: 447 LMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVI 496
           L +  ++D     +         +  +I+TL+ +GR+ KE VK VLN +I
Sbjct: 446 LRQ-DNIDIKTAKDEGEEDQGTASNTNIKTLLVEGRLNKEDVKKVLNRLI 494

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score =  102 bits (254), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 70/121 (57%), Gaps = 12/121 (9%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE- 446
           Y+C +CEK F+RKSW +RHLLSHS+ K ++CPWC S HKR+DNL QH+K KH   +L E 
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPWCSSTHKRKDNLLQHLKLKHTQYLLHEF 365

Query: 447 -----LMEAGDLDGSMGTNVRLAIDDMVA------GPSIRTLVQDGRVKKERVKTVLNAV 495
                LM   +  G+    V  +  + +         +IR ++    + K++VK  LN +
Sbjct: 366 TLFGILMNVNNGSGNTANLVTTSTGETICLINNEPSTTIRDMLDSNALPKDQVKRCLNYI 425

Query: 496 I 496
           +
Sbjct: 426 V 426

>Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 aa]
           {ON} YMR070W (REAL)
          Length = 473

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 72/133 (54%), Gaps = 22/133 (16%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH + +L E
Sbjct: 337 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 396

Query: 447 LMEAGDLDGSMGTNVRLAI----------------------DDMVAGPSIRTLVQDGRVK 484
           L +   +     +++                          D     P+I+TL+ DG + 
Sbjct: 397 LKKNNIIFNYNNSSINSNNSNNNNSASGSGGGSAAAAPENEDGNSYDPNIKTLINDGVLN 456

Query: 485 KERVKTVLNAVIA 497
           K+ VK VLN +I 
Sbjct: 457 KDDVKRVLNNLIV 469

>Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)
           [1428 bp, 475 aa] {ON} YMR070W (REAL)
          Length = 475

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 34/145 (23%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH + +L E
Sbjct: 327 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 386

Query: 447 LMEAGDLDGSMGTNVRLAI----------------------------------DDMVAGP 472
           L +   +     T+                                       D     P
Sbjct: 387 LKKNNIIFNYNKTSTNSNDNNNSTSTRTSASASSGGGGGGGGGAAAAAAPENEDGSSYDP 446

Query: 473 SIRTLVQDGRVKKERVKTVLNAVIA 497
           +I+TL+ DG + K+ VK VLN +I 
Sbjct: 447 NIKTLINDGVLNKDDVKRVLNNLIV 471

>YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}
           MOT3Transcriptional repressor and activator with two
           C2-H2 zinc fingers; involved in repression of a subset
           of hypoxic genes by Rox1p, repression of several DAN/TIR
           genes during aerobic growth, and repression of
           ergosterol biosynthetic genes in response to
           hyperosmotic stress; contributes to recruitment of the
           Tup1p-Cyc8p general repressor to promoters; involved in
           positive transcriptional regulation of CWP2 and other
           genes; can form the [MOT3+] prion
          Length = 490

 Score = 93.6 bits (231), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 73/142 (51%), Gaps = 31/142 (21%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH + +L E
Sbjct: 345 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 404

Query: 447 LMEAGDL---------------------DGSMGTNVRLAIDDMVAGP----------SIR 475
           L +   +                     + + G+    A       P          +I+
Sbjct: 405 LKKNNIIFNYNNSSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIK 464

Query: 476 TLVQDGRVKKERVKTVLNAVIA 497
           TL+ DG + K+ VK VLN +I 
Sbjct: 465 TLINDGVLNKDDVKRVLNNLIV 486

>TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.533
           YMR070W
          Length = 513

 Score = 91.3 bits (225), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 51/62 (82%)

Query: 386 MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           ++++C +CEKSFKRKSW +RHLLSHS  + ++CP C S+HKR+DNL QH+K KH+  +L+
Sbjct: 338 IIFQCHLCEKSFKRKSWLKRHLLSHSKKRNFSCPCCLSKHKRKDNLIQHLKLKHLDYILK 397

Query: 446 EL 447
           +L
Sbjct: 398 KL 399

>Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070W
           (REAL)
          Length = 419

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           +++C  CEKSFKRKSW +RHLLSHS  + + CPWC SR KR+DNL QHMK KH + +L E
Sbjct: 326 IHQCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDE 385

Query: 447 L 447
           L
Sbjct: 386 L 386

>KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON}
           Anc_2.533 YMR070W
          Length = 352

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 65/114 (57%), Gaps = 13/114 (11%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y C  C KSF+R +W +RH ++H++  P+ C WC+S HKRRDN+F+HMK KH++ +++ +
Sbjct: 250 YPCPQCPKSFQRSAWLKRHSITHTNSHPFKCVWCKSEHKRRDNMFKHMKLKHMNLLMKVI 309

Query: 448 MEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKERVKTVLNAVIARVHD 501
                L    G +             ++ L+ DGR+ KE VK VL  ++    D
Sbjct: 310 RNYYPLAEFEGKD-------------LKGLLADGRLHKEDVKRVLVDIVNPTRD 350

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 84.0 bits (206), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 57/78 (73%), Gaps = 3/78 (3%)

Query: 372 SDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNL 431
            + G  +D  +S   +YRC++C K F+R++W +RH LSH++ + + CPWC+S+HKRRDNL
Sbjct: 106 KEEGKNEDEVTS---VYRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPWCKSKHKRRDNL 162

Query: 432 FQHMKTKHVHQVLQELME 449
           F+H+K KH+  +++ + E
Sbjct: 163 FKHIKLKHMELLMKAIRE 180

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
            Y C +C K+FKR SW +RH  SHS  K ++C WC  ++KR+DNL QH++ KH  +  +E
Sbjct: 323 FYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNWCSGKYKRKDNLVQHIRKKHRDKTNKE 382

Query: 447 LMEAGDLDGSMGTNV 461
             E  +       NV
Sbjct: 383 PNELENKSDEPVVNV 397

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C+ CEK+F+R    +RH+ S HSS +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNYCEKKFSRSDNLSQHLKTHKKH 644

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C+ CEK FKR    +RH+ S HS+ +PY+C +C+    R DNL QH+KT   H
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHCQFCEKNFSRSDNLSQHLKTHKRH 362

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           ++C  C K+F+R    +RH+ S HS+ +P++C +C  +  R DNL QH+KT   H  + E
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHLKTHKKHGDITE 680

Query: 447 L 447
           L
Sbjct: 681 L 681

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 5/68 (7%)

Query: 375 GSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQ 433
           GS DD        ++CS C K+F+R    +RH+ S HSS +P+ C +C+ +  R DNL Q
Sbjct: 664 GSLDDKNKP----FKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQ 719

Query: 434 HMKTKHVH 441
           H+KT   H
Sbjct: 720 HLKTHKKH 727

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (56%), Gaps = 8/69 (11%)

Query: 381 GSSMAMLY-------RCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLF 432
           GSS   +Y       +CS CEK+F+R    +RH  S HS+ +P+ C +C  R  R DNL 
Sbjct: 901 GSSTTTIYDDQNKPFKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMFCTKRFSRSDNLS 960

Query: 433 QHMKTKHVH 441
           QH+KT   H
Sbjct: 961 QHLKTHKKH 969

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C+ CEK+F+R    +RH+ S HSS +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 462 FKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNYCEKKFSRSDNLSQHLKTHKKH 516

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  CEK+F+R    +RH+ S HSS +P+ C +C  R  R DNL QH+KT   H
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPCTFCDKRFSRSDNLSQHLKTHKKH 520

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++CS CEK FKR    +RH  S HS+ +P+ C  C+ +  R DNL QH+KT   H
Sbjct: 313 FKCSECEKGFKRSEHLKRHFRSVHSNERPFPCMLCEKKFSRSDNLSQHLKTHKKH 367

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C  C K+F+R    +RH+ S HSS +P+ CP C  +  R DNL QH+KT
Sbjct: 765 FKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDKKFSRSDNLAQHIKT 815

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  CEK+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKH 627

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  CEK+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKH 638

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HSS +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 527 FKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKH 581

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+FKR    +RH+ S HS+ +P+ C  C+ +  R DNL QH+KT   H
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFACTLCEKKFSRSDNLSQHLKTHKKH 617

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           ++C  C K+F+R    +RH+ S HSS +P+ C +C  +  R DNL QH+KT   H  +++
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKD 563

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           ++C  C K+F+R    +RH+ S HS+ +P+ C +C  +  R DNL QH+KT   H  +++
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTYCDKKFSRSDNLSQHLKTHRKHGDIKD 757

Query: 447 LM 448
           ++
Sbjct: 758 VL 759

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  CEK+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKH 625

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HSS +P++C +C  +  R DNL QH+KT   H
Sbjct: 442 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKH 496

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HSS +P++C +C  +  R DNL QH+KT   H
Sbjct: 641 FKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYCDKKFSRSDNLSQHLKTHKKH 695

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C+ C+K+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHLKTHKRH 538

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HS+ +P++C +C  +  R DNL QH+KT   H
Sbjct: 620 FKCQECTKAFRRSEHLKRHIRSVHSTERPFHCSYCDKKFSRSDNLSQHLKTHKKH 674

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 380 FKCKECAKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHLKTHKKH 434

>CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {ON}
           some similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c or uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%), Gaps = 6/62 (9%)

Query: 377 FDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHM 435
           FDD     A +++C MCE+ FKR+   +RH+ S H   +PY+C  C     R DNL QH 
Sbjct: 212 FDD-----AKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHK 266

Query: 436 KT 437
           +T
Sbjct: 267 RT 268

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C  C+K+F+R    +RH+ S HS+ +P+ C +C+ +  R DNL QH+KT   H
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMFCEKKFSRSDNLSQHLKTHKKH 636

>ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 616

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 5/84 (5%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS C K+F R     RH  SH+  KP+ C  C+    RRD L +H++T H   +   L
Sbjct: 8   YVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHAFVRRDLLQRHIRTVHRELL---L 64

Query: 448 MEAGDLDGSMGTN--VRLAIDDMV 469
           M+ G  +G   ++  V L ++ M+
Sbjct: 65  MKKGMEEGGNKSDLIVELLVNSMI 88

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 384 MAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           M   + C  C K+FKR    +RH+ S HS  +PY C  C  +  R DNL QH+KT   H
Sbjct: 599 MEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGCNICDKKFSRSDNLSQHLKTHKRH 657

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C KSF+R    +RH+ S HS  +P+ C  C+ +  R DNL QH+KT   H
Sbjct: 712 FQCDQCTKSFRRSEHLKRHVRSVHSKERPFACNLCEKKFSRSDNLSQHLKTHKKH 766

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  CE+ FKR+   +RH+ S H   KPY C  CQ    R DNL QH+KT
Sbjct: 384 FGCEYCERRFKRQEHLKRHVRSLHIGVKPYTCHICQKNFSRSDNLSQHIKT 434

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C +C K+FKR    +RH+ S HS+ +P++C  C+ +  R DNL QH+KT
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHIKT 585

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C +C KSFKR    +RH+ S HS+ +P+ C  C+ +  R DNL QH+KT   H
Sbjct: 646 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICEKKFSRSDNLSQHIKTHKKH 700

>TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.144
           YER130C
          Length = 312

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           + C  C++ FKR+   +RH+ S H   KP+NC  C  +  R DNL QH+KT H HQ
Sbjct: 258 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFNCHICDKKFSRSDNLNQHIKT-HSHQ 312

>KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {ON}
           Anc_4.214 YGR067C
          Length = 1010

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS C K+F R     RH  SH+ +KP+ C  CQ    RRD + +H+KT H   +L   
Sbjct: 8   YICSYCAKAFSRSEHRTRHERSHTGYKPFQCKICQHCFVRRDLVQRHIKTVHRLLILSNK 67

Query: 448 ME 449
            E
Sbjct: 68  TE 69

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C +C KSFKR    +RH+ S HS+ +P+ C  C  +  R DNL QH+KT   H
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKH 701

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C +C KSFKR    +RH+ S HS+ +P+ C  C  +  R DNL QH+KT   H
Sbjct: 652 FHCHICSKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKH 706

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKT 437
           Y+C +C K F R S  Q HLL+H+  +P+ CP+  C      + N+ +H+KT
Sbjct: 128 YQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKT 179

>TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1375

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 45/95 (47%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ CS+C ++F R+    RH  SH+  KPY C  CQ +  RRD L +H +  H
Sbjct: 36  TPSGKVRLFVCSICTRAFARQEHLTRHERSHTKEKPYCCGLCQRKFSRRDLLLRHAQKIH 95

Query: 440 VHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSI 474
                  ++   +   ++  N R   D +V   SI
Sbjct: 96  NGDYGDTVIITSNGTITLNNNERKIDDSLVDNLSI 130

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVL 444
           ++C  C K+F+R    +RH+ S HS+ +P+ C  C  +  R DNL QH+KT   H  L
Sbjct: 386 FKCDTCYKAFRRSEHLKRHIRSVHSTERPFACTICDKKFSRSDNLSQHLKTHKKHGEL 443

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C +C KSFKR    +RH+ S HS+ +P+ C  C  +  R DNL QH+KT   H
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTHKKH 701

>TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {ON}
           Anc_8.144 YER130C
          Length = 439

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           + C  CE+ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT H H
Sbjct: 386 FGCDYCERRFKRQEHLKRHVRSLHMCVKPYACHICDKKFSRSDNLSQHIKT-HTH 439

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 2/47 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQH 434
           C++C KSF RK+  Q H+L H+  KPY CP+  C      + NL++H
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRH 164

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K F+R    +RH+ S HS  +P+ C +C  +  R DNL QH+KT   H
Sbjct: 437 FKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKYCDKKFSRSDNLSQHLKTHKKH 491

>SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C hypothetical ORF
          Length = 899

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 16/117 (13%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS C K+F R     RH  SH+  KP+ C  C     RRD L +H++T H   +LQ  
Sbjct: 8   YICSFCAKAFSRSEHRTRHERSHTGVKPFTCTVCAHSFVRRDLLQRHIRTVHRTFLLQCT 67

Query: 448 MEAGDLDGSMGTNVRLAIDDMVAGPSI-RTLVQDGRVKKERV-KTVLNAVIARVHDG 502
            E                  MV GPSI    +    V  +R+   V+N++I   H+G
Sbjct: 68  KEQE--------------QHMVPGPSIGGNEICGSAVHNDRLFDHVMNSMIKVNHEG 110

>KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 474

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           + C  C++ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT H H+
Sbjct: 418 FGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHLKT-HTHE 472

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 414 KPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           KP+ C +C  R KR+++L +H+++ H+
Sbjct: 416 KPFGCEYCDRRFKRQEHLKRHIRSLHI 442

>NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {ON}
           Anc_4.214
          Length = 1169

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + CS C K+F R     RH  SH+ FKPY C  C     R D   +H+KT H  Q+   L
Sbjct: 87  FICSFCAKAFSRSEHKIRHERSHTGFKPYKCLLCDHSFVRSDLTIRHLKTVHKDQI--NL 144

Query: 448 MEAGDL 453
           ++  +L
Sbjct: 145 LQKDNL 150

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++C  C K+F+R    +RH+ S HS  +P++C  C  +  R DNL QH+KT   H
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSCDICLKKFSRSDNLSQHLKTHKKH 743

>ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 557

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           + C  C++ FKR+   +RH+ S H   KP+ C  C  +  R DNL QH+KT H HQ
Sbjct: 503 FGCEYCDRRFKRQEHLKRHVRSLHMCEKPFGCHICGKKFSRSDNLNQHIKT-HTHQ 557

>ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER130C
          Length = 520

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  CE+ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 460 FGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT 510

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 21/27 (77%)

Query: 414 KPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           KP+ C +C+ R KR+++L +H+++ H+
Sbjct: 458 KPFGCEYCERRFKRQEHLKRHIRSLHM 484

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y C  CE+ FKR+   +RH+ S H   KPY C  C  +  R DNL QH KT
Sbjct: 349 YSCEYCERRFKRQEHLKRHIRSLHLGAKPYTCHICARKFSRSDNLNQHTKT 399

>Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii ACL057W
          Length = 573

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  CE+ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 514 FGCEFCERRFKRQEHLKRHVRSLHMGEKPYGCDICGKKFSRSDNLNQHIKT 564

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 21/27 (77%)

Query: 414 KPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           KP+ C +C+ R KR+++L +H+++ H+
Sbjct: 512 KPFGCEFCERRFKRQEHLKRHVRSLHM 538

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVL 444
           + C  C++ FKR+   +RH+ S H   KP++C  C  +  R DNL QH+KT    +VL
Sbjct: 346 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHICGKKFSRSDNLNQHIKTHTDGEVL 403

>NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON}
           Anc_8.425
          Length = 1350

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ C +C ++F R+    RH  SH+  KPYNC  C  +  RRD L +H +  H
Sbjct: 108 TPSGKVRLFVCEICTRAFARQEHLVRHERSHTKEKPYNCGICSKKFTRRDLLIRHAQKVH 167

Query: 440 VHQVL 444
              V+
Sbjct: 168 NGNVV 172

>SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]
           {ON} weakly similar to uniprot|P39959 Saccharomyces
           cerevisiae YER130C Hypothetical ORF
          Length = 410

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 354 FGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHIKT 404

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KP++C  C  +  R DNL QH+KT
Sbjct: 340 FACDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQICGKKFSRSDNLNQHVKT 390

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  CE+ FKR+   +RH+ S H   KPY C  C     R DNL QH+KT
Sbjct: 495 FACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHIKT 545

>CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some
           similarities with uniprot|P39959 Saccharomyces
           cerevisiae YER130c
          Length = 317

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 384 MAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++  + C  C++ FKR+   +RH+ S H   KPY C  C  +  R DNL QH+KT
Sbjct: 260 LSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIKT 314

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           L+ C  C++ FKR+   +RH+ S H   KP++C  C+ +  R DNL QH+KT
Sbjct: 302 LFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSCHICEKKFSRSDNLNQHIKT 353

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 380 TGSSMAMLYR---CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           T S+  +++    C +C KSF R+S  Q HLL H++ KP+ C +C+     + NL +H
Sbjct: 160 TSSNRGLIFVSKICPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCEKEFNVKSNLNRH 217

>AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR067C
          Length = 838

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y CS C ++F R     RH  SH+  KP++C  C     RRD L +H++T H   +L+
Sbjct: 8   YICSFCAQAFSRSEHKTRHERSHTGVKPFSCKVCNHSFVRRDLLQRHIRTVHRSMLLE 65

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C + FKR+   +RH+LS H   K + CP C     R DNL QH+KT
Sbjct: 400 FGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPICGKNFSRSDNLNQHIKT 450

>KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {ON}
           Anc_4.214 YGR067C
          Length = 749

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y CS C K+F R     RH  SH+ +KP+ C  C     RRD + +H+KT H
Sbjct: 8   YVCSFCAKAFSRSEHRIRHERSHTGYKPFQCNICNHAFVRRDLVQRHIKTVH 59

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           ++C MC K F R    +RH+ +H+  KP++C  P C  R  R D L +H++T
Sbjct: 14  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRT 65

>NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {ON}
           Anc_4.214
          Length = 879

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           + CS C K F R     RH  SH+  KPY C  C     R D   +H+KT H  ++LQ
Sbjct: 15  FICSFCAKGFSRAEHKIRHERSHTGLKPYKCKVCTHCFVRSDLALRHIKTVHKKEILQ 72

>TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.214
           YGR067C
          Length = 770

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 4/100 (4%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H   +L E 
Sbjct: 12  YICSYCGKPFSRSEHKARHERSHTGVKPFECKVCRHSFVRRDLLQRHIRTVHRELLLVE- 70

Query: 448 MEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRVKKER 487
                L+ + G++    + ++     I+    D RV K R
Sbjct: 71  ---SSLEPAAGSSKGDLMLELRVNSMIKVSGDDKRVDKCR 107

>Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON}
           complement(28325..32557) [4233 nt, 1411 aa]
          Length = 1410

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           L+ CS+C ++F R+    RH  SH+  KPY C  CQ +  RRD L +H
Sbjct: 117 LFVCSICTRAFARQEHLTRHERSHTKEKPYCCGICQRKFSRRDLLLRH 164

>CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]
           {ON} some similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067c
          Length = 1013

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVL 444
           CS C K+F R     RH  SH+  KP+ C  C     RRD L +H++T  VH++L
Sbjct: 14  CSFCNKAFSRSEHKTRHERSHAGVKPFECQVCSHSFVRRDLLQRHIRT--VHRIL 66

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           ++C MC K F R    +RH+ +H+  KP+ C  P C  R  R D L +H++T
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRT 64

>KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1155

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 11/86 (12%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQV---- 443
           + CS+C + F R+   +RH  +H+S KP+ C +C     RRD + +H    H   +    
Sbjct: 54  FLCSICTRGFVRQEHLKRHQRAHTSEKPFLCTFCGRCFARRDLVLRHQHKLHSSLISKSN 113

Query: 444 ----LQELMEAG---DLDGSMGTNVR 462
                ++LME     DL+G+M + +R
Sbjct: 114 NDNTFEKLMENNKNLDLNGAMPSTIR 139

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           +RC  C + F R    +RHL +H+  KP++C  P C     R D L +HM+T H  Q  +
Sbjct: 17  FRCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRT-HTGQSQR 75

Query: 446 ELMEAG 451
            L ++G
Sbjct: 76  RLKKSG 81

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           C +C KSF R+S  Q HLL H++ KP+ C +C      + NL +H
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSFCDKEFNVKSNLNRH 213

>KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1379

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ C +C ++F R+    RH  SH+  KPY C  C+ R  RRD L +H +  H
Sbjct: 117 TPSGKPRLFVCKVCTRAFARQEHLTRHERSHTKEKPYVCGICERRFTRRDLLIRHCQKLH 176

>TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {ON}
           Anc_8.234 YER169W
          Length = 912

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 366 PYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSR 424
           P +  GSD     + G     +Y C  C++ F       RH  S HS  KP++CP C  R
Sbjct: 759 PQNKFGSDEIVISENGK----VYICQDCKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKR 814

Query: 425 HKRRDNLFQHMKTK 438
            KRRD++ QH+  K
Sbjct: 815 FKRRDHVLQHLNKK 828

>SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa]
           {ON} similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1129

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%)

Query: 373 DRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLF 432
           + G +  T S    L+ C +C ++F R+    RH  SH+  KPY C  C  R  RRD L 
Sbjct: 44  NLGLYGKTPSGKPRLFVCKICTRAFARQEHLTRHERSHTKEKPYFCGICDRRFSRRDLLL 103

Query: 433 QHMKTKH 439
           +H    H
Sbjct: 104 RHAHKLH 110

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KP+ C  C     R DNL QH+KT
Sbjct: 395 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 445

>Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W
           (REAL)
          Length = 392

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 380 TGSSMAMLYRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           T S+    ++C+    C  SF R     RH+  H+  KP+ CP C     R DNL QH +
Sbjct: 36  TKSARRKTFKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRE 95

Query: 437 TKHVHQVL 444
           + H H+ L
Sbjct: 96  SVHAHKQL 103

>KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some
           similarities with uniprot|P53243 Saccharomyces
           cerevisiae YGR067C
          Length = 922

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS C K F R     RH  SH+  KP++C  C     RRD L +H++T H    L  +
Sbjct: 8   YICSFCAKPFSRSEHKARHERSHTGSKPFSCSICSHSFVRRDLLQRHIRTVH-KSSLNSM 66

Query: 448 MEAG--DLDGSMGTNVRLA 464
           ++ G  +++  M + ++++
Sbjct: 67  LKTGNKNMEEVMNSLIKIS 85

>NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {ON}
           Anc_8.425
          Length = 1152

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           L+ C +C ++F R+    RH  SH++ KPY C  C  +  RRD L +H +  H
Sbjct: 77  LFVCDVCSRAFARQEHLDRHARSHTNEKPYQCGICTKKFTRRDLLLRHAQKVH 129

>TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {ON}
           Anc_8.234 YER169W
          Length = 837

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 367 YSGTGSDRGSFDDTGSSMAM-----LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPW 420
           Y+ T S       T S + M     +Y C  C++ F       RH  S HS  KPY+CP 
Sbjct: 730 YTSTASQSQQPKFTSSEIVMSENGKVYICQECKRQFSSGHHLTRHKKSVHSGEKPYSCPK 789

Query: 421 CQSRHKRRDNLFQHMKTK 438
           C  + KRRD++ QH+  K
Sbjct: 790 CGKKFKRRDHVLQHLNKK 807

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KP+ C  C     R DNL QH+KT
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 438

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCP--WCQSRHKRRDNLFQHMK 436
           C +C K FKR S  + H++ H++ KPYNC    CQ R   + N+ +HM+
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMR 275

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           + C  C++ FKR+   +RH+ S H   KP+ C  C     R DNL QH+KT HV
Sbjct: 388 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT-HV 440

>Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {ON}
           similar to Ashbya gossypii AFR580C
          Length = 938

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y C  C ++F R     RH  SH+  KP++C  C     RRD L +H++T H   +L+
Sbjct: 8   YICCFCARAFSRSEHRTRHERSHTGVKPFSCKVCSHSFVRRDLLQRHIRTVHRSMLLE 65

>Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON}
           YGR067C (REAL)
          Length = 806

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H
Sbjct: 8   YICSFCLKPFSRSEHKMRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVH 59

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           Y C +C K FKR S    H+  H+ +KPY CP+  CQ     + N+ +H K
Sbjct: 278 YCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYK 328

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KP+ C  C     R DNL QH+KT
Sbjct: 389 FGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKT 439

>KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.234
           YER169W
          Length = 875

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KPY+CP C  R KRRD++ QH+  K
Sbjct: 759 VYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKRFKRRDHVLQHLNKK 811

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMK 436
           Y+C +C K F R    +RH+ +H+  KP+ C  P C  R  R D L +H++
Sbjct: 25  YKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKRFSRSDELKRHLR 75

>KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.234
           YER169W
          Length = 890

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C +C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 780 VYICQICKRQFSSGHHLTRHKKSVHSGEKPFSCPKCGKRFKRRDHVLQHLNKK 832

>KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON}
           Anc_8.425 YDR216W
          Length = 627

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C+K+F R+    RHL SH++ KP+ C  C     RRD L +H    H
Sbjct: 49  FLCFVCQKAFARQEHLDRHLRSHTNEKPFKCAVCDKDFTRRDLLIRHSNKLH 100

>ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} similar
           to uniprot|P39956 Saccharomyces cerevisiae YER169W RPH1
           Transcriptional repressor of PHR1 which is a photolyase
           induced by DNA damage binds to AG(4) (C(4)T) sequence
           upstream of PHR1 Rph1p phosphorylation during DNA damage
           is under control of the MEC1-RAD53 pathway
          Length = 867

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           S    +Y C  C++ F       RH  S HS  KPY+CP C  + KRRD++ QH+  K
Sbjct: 782 SENGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPYSCPKCGKKFKRRDHVLQHLNKK 839

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           ++C +C K F+R S    H   H+ FKPY CP+  C      + N+F+H K         
Sbjct: 208 FKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFKLPSGA 267

Query: 446 ELMEAGDLDGSMGTNVRLAIDD 467
            ++  G++  +  ++ +L  DD
Sbjct: 268 YMLPNGEITTTKPSSKQLLPDD 289

>TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.234
           YER169W
          Length = 967

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 858 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 910

>Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON}
           YGR067C (REAL)
          Length = 810

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQICKHSFVRRDLLQRHIRTVH 59

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           C+ C K F R S  + H+L HS  KP+ C W  C  +   + NL +H+K
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLK 282

>Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON}
           YGR067C (REAL)
          Length = 812

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59

>TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144
           YER130C
          Length = 687

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVH 441
           ++ C  C + FKR+   +RH  S H   KP++C  C  +  R DNL QH+KT H H
Sbjct: 633 IFICPYCNRRFKRQEHLKRHNRSLHMGEKPFDCHICNKKFSRSDNLAQHIKT-HSH 687

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y+C+ C K F +    + H+  H+  KP++C +C  R  R+ NL  H+ T   H+ ++  
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEFCSKRFSRKGNLTAHLVT---HEKVRPF 472

Query: 448 MEAGDLDGSMGTNVRLA 464
           +    L+G M T  +L 
Sbjct: 473 V--CKLNGCMKTFTQLG 487

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%)

Query: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           G++    + C++C K F + +  + HL SH   KPY C WC     +  NL  H++
Sbjct: 381 GANGIKQHECNICHKLFIQLTHLEVHLRSHLGDKPYKCTWCGKGFTQGGNLKTHVR 436

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 28/69 (40%), Gaps = 2/69 (2%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           + C  C K F RK     HL++H   +P+ C    C     +  N+  H    H + + +
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNRFHQNTLTE 503

Query: 446 ELMEAGDLD 454
                 +LD
Sbjct: 504 LTRRLANLD 512

>YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON}
           Putative protein of unknown function; contains a zinc
           finger motif similar to that of Adr1p
          Length = 804

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y CS C K F R     RH  SH+  KP+ C  C+    RRD L +H++T H
Sbjct: 8   YICSFCLKPFSRSEHKIRHERSHAGVKPFQCQVCKHSFVRRDLLQRHIRTVH 59

>KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {ON}
           Anc_8.144 YER130C
          Length = 453

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C++ FKR+   +RH+ S H   KP++C  C     R DNL QH+KT
Sbjct: 398 FSCEYCDRRFKRQEHLKRHIRSLHICEKPFHCHICDKHFSRSDNLNQHIKT 448

>AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR216W (ADR1)
          Length = 1057

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           L+ C  C ++F R+    RH  SH++ KPY C  C  R  RRD L +H    H       
Sbjct: 48  LFVCHTCTRAFARQEHLIRHKRSHTNEKPYICGICDRRFSRRDLLLRHAHKLHGGSCGDA 107

Query: 447 LMEAG 451
           L++ G
Sbjct: 108 LLKKG 112

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 2/86 (2%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCP--WCQSRHKRRDNLFQHMKT 437
           TG    + Y C++C K FKR S    H+  H+  KPY CP   C      + N+ +H K 
Sbjct: 262 TGCIDKIKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKL 321

Query: 438 KHVHQVLQELMEAGDLDGSMGTNVRL 463
                  Q ++  G++  +  T  +L
Sbjct: 322 HFKLNTGQYILPNGEISATKPTTKQL 347

>Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON}
           YPL230W (REAL)
          Length = 386

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 388 YRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           ++C+    C  SF R     RH+  H+  KP+ CP C     R DNL QH ++ H H+
Sbjct: 41  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHK 98

>YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc finger
           transcriptional repressor; cooperates with Mig1p in
           glucose-induced repression of many genes including SUC2
           (invertase); binds to Mig1p-binding sites in SUC2
           promoter; under low glucose conditions Mig2p relocalizes
           to mitochondrion, where it regulates morphology,
           interacts with Ups1p and antagonizes mitochondrial
           fission factor, Dnm1p, indicative of a role in promoting
           mitochondrial fusion or regulating morphology
          Length = 382

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           +RC  C + F R    +RHL +H+  KP++C  P C     R D L +HM+T H  Q  +
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT-HTGQSQR 75

Query: 446 ELMEA 450
            L +A
Sbjct: 76  RLKKA 80

>YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putative
           transcription factor containing a C2H2 zinc finger;
           mutation affects transcriptional regulation of genes
           involved in growth on non-fermentable carbon sources,
           response to salt stress and cell wall biosynthesis
          Length = 391

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 388 YRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           ++C+    C  SF R     RH+  H+  KP+ CP C     R DNL QH ++ H H+
Sbjct: 41  FKCTGYDGCTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHK 98

>YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}
           MET31Zinc-finger DNA-binding protein, involved in
           transcriptional regulation of the methionine
           biosynthetic genes, similar to Met32p
          Length = 177

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%)

Query: 385 AMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVL 444
           A LY C+ C+  F R S  +RH   HS   P+ C  C     R+D L +H  T    +  
Sbjct: 92  AQLYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTCQRNR 151

Query: 445 QELMEAGDLD 454
           ++L E  D+D
Sbjct: 152 KKLSEGSDVD 161

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC +C + F R    +RH+ +H+  KP+ C  P C     R D L +H++T
Sbjct: 14  FRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRT 65

>TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1207

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ C +C ++F R+    RH  SH+  KPY+C  C     RRD L +H    H
Sbjct: 51  TPSGKPRLFVCQICTRAFARQEHLTRHERSHTKEKPYSCGICNRNFSRRDLLLRHAHKVH 110

>Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON}
           (31069..33561) [2493 nt, 831 aa]
          Length = 830

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           CS C ++F R     RH  SH+  KPY C  C     RRD L +H++T H
Sbjct: 11  CSYCNRAFSRSEHKARHERSHTGTKPYECKVCLREFVRRDLLQRHIRTVH 60

>Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON}
           (118186..120660) [2475 nt, 825 aa]
          Length = 824

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 686 VYICQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 738

>CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169w
          Length = 980

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 901 IYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 953

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 7/82 (8%)

Query: 389 RCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQ----HMKTKHVHQ 442
           +C +C KS  R S  Q H+L H+  +P+ C W  C  R   + N+ +    H+K +  ++
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQLANE 551

Query: 443 VLQELMEAGDLDGSMGTNVRLA 464
           VL +  +  +L GS+  ++ +A
Sbjct: 552 VLADTTQKKEL-GSLHDDIDVA 572

>Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)
          Length = 382

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC  C + F R    +RHL +H+  KP++C  P C     R D L +HM+T
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

>CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa]
           {ON} weakly similar to uniprot|P07248 Saccharomyces
           cerevisiae YDR216w ADR1 zinc-finger transcription factor
          Length = 1489

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           L+ C  C ++F R+    RH  SH+  KPY C  C  R  RRD L +H    H
Sbjct: 29  LFVCQTCTRAFARQEHLTRHERSHTKEKPYCCGICDRRFTRRDLLLRHAHKVH 81

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC  C + F R    +RHL +H+  KP++C  P C     R D L +HM+T
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRT 68

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C++C + F+R+   +RH+ + H   +PY C  C+    R DNL QH++T
Sbjct: 413 FLCTICSRRFRRQEHMKRHIRTIHFQERPYTCYVCEKTFSRSDNLNQHLRT 463

>Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W
           (REAL)
          Length = 802

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 715 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 767

>ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1119

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV------- 440
           + CS+C + F R+   +RH  SH++ KP+ C +C     RRD + +H    H        
Sbjct: 75  FLCSICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLHAALVSKTL 134

Query: 441 -HQVLQELMEAGD 452
              V+ +  EAGD
Sbjct: 135 EEDVMMDFSEAGD 147

>TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {ON}
           Anc_4.214 YGR067C
          Length = 737

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           C+ C ++F R    +RH  SH   KP+ C  C     RRD L +H+KT H
Sbjct: 7   CAFCRRAFSRSEHRKRHERSHQGVKPFQCAVCNHVFVRRDLLKRHIKTVH 56

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           Y+C +C + F R    +RHL +H+  KP+ C  P C     R D L +H++T
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRT 71

>YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC
           domain-containing histone demethylase; specifically
           demethylates H3K36 tri- and dimethyl modification
           states; associates with actively transcribed (RNA
           polymerase II) regions in vivo and specifically targets
           H3K36 in its trimethylation state as its substrate;
           transcriptional repressor of PHR1; Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 796

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 708 IYICKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 760

>Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W
           (REAL)
          Length = 798

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 710 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 762

>Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {ON}
           YPR186C (REAL)
          Length = 427

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           +RC  C KSF +KS  +RHL SHS  KP+ C +C      R  L +H  T
Sbjct: 80  FRCDNCAKSFVKKSHLERHLFSHSDTKPFQCSYCGKGVTTRQQLKRHEVT 129

>Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W
           (REAL)
          Length = 398

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 388 YRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQ 442
           ++C+    C  SF R     RH+  H+  KP+ CP C     R DNL QH ++ H H+
Sbjct: 41  FKCTGYDGCAMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHR 98

>NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144
          Length = 289

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           Y C +C+K FKR    +RH  + H   +P+ C  C  R  R DNL QH++      +++ 
Sbjct: 223 YFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHVRIHEQQPIMEP 282

Query: 447 L 447
           +
Sbjct: 283 I 283

>KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakly
           similar to uniprot|P07248 Saccharomyces cerevisiae
           YDR216W ADR1 Positive transcriptional regulator controls
           the expression of ADH2 peroxisomal protein genes and
           genes required for ethanol glycerol and fatty acid
           utilization
          Length = 1119

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ C +C ++F R     RH   H+  KPY+C  C+ ++ RRD L +H+   H
Sbjct: 45  TPSGKPRLFVCEVCTRAFARHEHLIRHERQHTKEKPYHCGVCERKYGRRDLLLRHVIKMH 104

Query: 440 VHQVLQELMEAG 451
                  +M  G
Sbjct: 105 GGNCGDTVMPLG 116

>Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W
           (REAL)
          Length = 177

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%)

Query: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           G   + LY C+ C   F R S  +RH   HS   P+ C  C     R+D L +H  T   
Sbjct: 88  GKEYSQLYSCAKCRLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTC 147

Query: 441 HQVLQELMEAGDLD 454
            +  ++L E  D+D
Sbjct: 148 RRNRKKLCEGSDVD 161

>ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} similar
           to uniprot|P07248 Saccharomyces cerevisiae YDR216W ADR1
           Positive transcriptional regulator controls the
           expression of ADH2 peroxisomal protein genes and genes
           required for ethanol glycerol and fatty acid utilization
          Length = 1346

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           L+ C +C ++F R+    RH  SH+  KPY C  C  +  RRD L +H    H
Sbjct: 85  LFVCQVCTRAFARQEHLTRHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIH 137

>KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1290

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C ++F R    +RH  SH++ KPY C  C     RRD L +H    H
Sbjct: 75  FVCKVCTRAFARSEHLERHERSHTNEKPYECGICDRMFTRRDLLLRHALKTH 126

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 379 DTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQH 434
           ++G      + C +C+++F+R     RHL +H+  KP+ C  P C  R  R D L +H
Sbjct: 20  NSGKDAPRPHVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRH 77

>Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa]
           {ON} YER169W (REAL)
          Length = 797

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C++ F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 709 IYVCKECQRKFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKK 761

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           ++C MC + F R    +RH+ +H+  KP+ CP   C     R D L +HMK
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMK 66

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 388 YRCS--MCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y+CS   C KSF ++    RHL  HS +KP+ CP C  +    D L QH++T
Sbjct: 628 YQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKCPHCTKKFSTEDILQQHIRT 679

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C+ C K F   S  + H+ +H+  KP  C  C  R     NL +HMKT
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKICGKRFNESSNLSKHMKT 735

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C  C K F  +   Q+H+ +HS  +P+ C +C  +     +L  H++T
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT 707

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 380 TGSSMAML-YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           TG ++  + Y CS+C K FKR S    H+  H+  KP+ CP+  C      + N+ +H K
Sbjct: 296 TGGNIEKIKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYK 355

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC  C + F R    +RH+ +H+  KP+ C  P C+    RRD L +H++T
Sbjct: 21  FRCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRT 72

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMK 436
           C +C K F RK+    HLL H+  +PY C  P C+     + NL +H+K
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLK 159

>Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W
           (REAL)
          Length = 171

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           LY C+ C+  F R S  +RH   HS   P+ C  C     R+D L +H  T    +  ++
Sbjct: 88  LYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTCQRNRKK 147

Query: 447 LMEAGDLD 454
           L E  D+D
Sbjct: 148 LSEGSDVD 155

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 385 AMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMK 436
           A L+ C +C K+F R S    H L H+  +P+ C  P C  R   + NL +H K
Sbjct: 108 ATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKK 161

>AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER169W
           (RPH1) and YDR096W (GIS1)
          Length = 799

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 366 PYSGTGSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSR 424
           P S   ++     D G +    Y C  C++ F       RH  S HS  KP++CP C  +
Sbjct: 714 PTSKISAEEIIISDKGKA----YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 769

Query: 425 HKRRDNLFQHMKTK 438
            KRRD++ QH+  K
Sbjct: 770 FKRRDHVLQHLNKK 783

>KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {ON}
           Anc_3.518 YGL209W
          Length = 416

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           ++C +C + F R     RH+++H+  KP+ C  P C  +  R D L +H KT
Sbjct: 18  FKCDICSRGFHRLEHKNRHIMTHTGEKPHQCSFPGCVKKFSRGDELKRHAKT 69

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C ++F R+   +RH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {ON}
           Anc_8.425 YDR216W
          Length = 1311

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 380 TGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           T S    L+ C  C+++F R+    RH  SH++ KP+ C  C     RRD L +H +  H
Sbjct: 144 TPSGKLRLFLCDFCKRAFARQEHLTRHKRSHTNEKPFLCNLCFKNFTRRDLLIRHAQKIH 203

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           C +C K FKR S  + H++ H++ KPY C    CQ R   + N+ +HM+
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMR 299

>KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.144
           YER130C
          Length = 225

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           + C  C + F+R+   +RH+ S H + KPY+C  C     R DNL QH KT
Sbjct: 171 FACQYCHRRFRRQEHMKRHIRSLHIAEKPYSCQICSKAFSRNDNLKQHRKT 221

>Skud_4.354 Chr4 (614004..616754) [2751 bp, 916 aa] {ON} YDR096W
           (REAL)
          Length = 916

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C + F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 849 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 901

>SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]
           {ON} similar to uniprot|P39956 Saccharomyces cerevisiae
           YER169W RPH1 Transcriptional repressor of PHR1 which is
           a photolyase induced by DNA damage binds to AG(4)
           (C(4)T) sequence upstream of PHR1 Rph1p phosphorylation
           during DNA damage is under control of the MEC1-RAD53
           pathway
          Length = 814

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           S    +Y C  C++ F       RH  S HS  KP++CP C  + KRRD++ QH+  K
Sbjct: 712 SEKGKVYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 769

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 4/93 (4%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y C+ C K F R S    H  +H+  KPY CP+  C  +   R N+ +H K      +  
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFKTDIGT 257

Query: 446 ELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLV 478
            ++  G++  +  +  +LA  DM +G S+  L+
Sbjct: 258 YVLPNGEVTKARPSMRQLA--DMNSGISVPDLI 288

>KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} similar
           to uniprot|Q74ZT1 Ashbya gossypii AGR117C AGR117Cp and
           some similarites with YER169W uniprot|P39956
           Saccharomyces cerevisiae YER169W RPH1 Transcriptional
           repressor of PHR1 which is a photolyase induced by DNA
           damage binds to AG(4) (C(4)T) sequence upstream of PHR1
           Rph1p phosphorylation during DNA damage is under control
           of the MEC1-RAD53 pathway
          Length = 821

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 377 FDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHM 435
           F D GS    +Y C  C + F       RH  S HS  KP++CP C  + KRRD++ QH+
Sbjct: 747 FLDDGSK---VYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 803

Query: 436 KTK 438
             K
Sbjct: 804 NKK 806

>KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.518
           YGL209W
          Length = 391

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC +C++ F R    +RH+ +H+  KP+ C  P C+    R D L +H +T
Sbjct: 17  FRCELCQRGFHRLEHKKRHVRTHTGEKPHACTFPGCEKHFSRSDELKRHSRT 68

>YDR096W Chr4 (637139..639823) [2685 bp, 894 aa] {ON}  GIS1JmjC
           domain-containing histone demethylase and transcription
           factor; involved in expression of genes during nutrient
           limitation; negatively regulates DPP1 and PHR1; activity
           is modulated by limited proteasome-mediated proteolysis;
           has a JmjC and a JmjN domain in the N-terminal region
           that interact, promoting Gis1p stability and proper
           transcriptional activity; contains transactivating
           domains TAD1 and TAD2 downstream of the Jmj domains and
           a C-terminal DNA binding domain
          Length = 894

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C + F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQH 434
           C +C KSF RK+  Q H+L H+  KPY C +  C      + NL++H
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRH 207

>Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W
           (REAL)
          Length = 1324

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C ++F R+   +RH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 110 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 161

>Smik_4.337 Chr4 (603613..606297) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C + F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W
           (REAL)
          Length = 1319

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C ++F R+   +RH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 373 DRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDN 430
           D+G  D    +    ++C +C + F R    +RH+ +H+  KP++C  P C     R D 
Sbjct: 3   DKGQPDFPADNDERPFKCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDE 62

Query: 431 LFQHMKT 437
           L +H++T
Sbjct: 63  LKRHLRT 69

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 374 RGSFDDTGSSMAMLYR--CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRD 429
           + +F+   S    L R  C +C+K   R +  + HLL H+   P+ CPW  C      + 
Sbjct: 133 KKAFNSEESKKMTLLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKS 192

Query: 430 NLFQHMKTKHVHQV 443
           N+ +H+K+    QV
Sbjct: 193 NMLRHLKSHQRKQV 206

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           Y C +C   F R     RH+ +H+  KP+ C  P C  R  R D L +H+KT
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKT 63

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 386 MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCP--WCQSRHKRRDNLFQHMKT 437
           + Y+CS C K F R S  Q H+L H+  +P+ CP   C      + N+ +H KT
Sbjct: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKT 100

>Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W
           (REAL)
          Length = 175

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQE 446
           LY C+ C+  F R S  +RH   HS   P+ C  C     R+D L +H  T    +  ++
Sbjct: 92  LYSCAKCQLKFSRSSDLRRHEKVHSLVLPHICSNCGKGFARKDALKRHSNTLTCQRNRKK 151

Query: 447 LMEAGDLD 454
           L E  D+D
Sbjct: 152 LCEGSDVD 159

>KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some
           similarities with uniprot|P39956 Saccharomyces
           cerevisiae YER169W RPH1 Transcriptional repressor of
           PHR1 which is a photolyase induced by DNA damage binds
           to AG(4) (C(4)T) sequence upstream of PHR1 Rph1p
           phosphorylation during DNA damage is under control of
           the MEC1-RAD53 pathway
          Length = 832

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           S    +Y C  C + F       RH  S HS  KP++CP C  + KRRD++ QH+  K
Sbjct: 733 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 790

>Suva_2.255 Chr2 (436524..439208) [2685 bp, 894 aa] {ON} YDR096W
           (REAL)
          Length = 894

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           +Y C  C + F       RH  S HS  KP++CP C  R KRRD++ QH+  K
Sbjct: 827 IYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRDHVLQHLNKK 879

>NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8.234
          Length = 1156

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 382  SSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
            S    +Y C  C++ F       RH  S HS  KP++CP C  + KRRD++ QH+  K
Sbjct: 992  SENGKIYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 1049

>Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W
           (REAL)
          Length = 1323

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C ++F R+   +RH  SH++ KPY C  C     RRD L +H +  H
Sbjct: 104 FVCEVCTRAFARQEHLKRHHRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIH 155

>Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {ON}
           YER169W (RPH1) - Repressor of PHR1 transcription; binds
           to PHR1 URS [contig 177] FULL
          Length = 828

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 382 SSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           S    +Y C  C + F       RH  S HS  KP++CP C  + KRRD++ QH+  K
Sbjct: 729 SDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 786

>NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518
          Length = 401

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC  C + F R    +RH+ +H+  KP++C  P C     R D L +H++T
Sbjct: 18  FRCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRT 69

>Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}
           similar to Ashbya gossypii AGR117C
          Length = 819

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           Y C  C++ F       RH  S HS  KP++CP C  + KRRD++ QH+  K
Sbjct: 752 YICQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 803

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMK 436
           Y C +C ++F R     RH+ +H+  KP+ C  P C  R  R D L +H +
Sbjct: 34  YVCPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTR 84

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 390 CSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQE 446
           C +C K F RK+    HLL H+  +PY C +  C      + NL +H++    H++  E
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHRGHELHHE 136

>KNAG0H03010 Chr8 (560630..562984) [2355 bp, 784 aa] {ON} Anc_8.234
           YER169W
          Length = 784

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSF-KPYNCPWCQSRHKRRDNLFQHMKTK 438
           Y C  C+++F       RH  S  SF KP++CP C  + KRRD++ QH+  K
Sbjct: 725 YICVDCKRTFSSGHHLTRHKKSVHSFEKPHSCPKCGKKFKRRDHVLQHLNKK 776

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           ++C  C K F +    + H+  H+  +PY C  C  R  R+ NL  HM T   H+  Q
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYECDKCGKRFSRKGNLAAHMLTHENHKPFQ 576

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           + C  C K F + +  + H+ SH  +KP+ C +C  R  +  NL  H++
Sbjct: 491 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHVR 539

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 3/64 (4%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y C  C K F RK     H+L+H + KP+ C    C     +  N+  H    H+ Q L 
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHL-QTLN 605

Query: 446 ELME 449
            L +
Sbjct: 606 RLTQ 609

>NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234
          Length = 864

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 372 SDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDN 430
           SD     +TG     +Y C  C++ F       RH  S HS  KP++CP C  + KRRD+
Sbjct: 753 SDEIIMSETGK----VYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 808

Query: 431 LFQHMKTK 438
           + QH+  K
Sbjct: 809 VLQHLNKK 816

>CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly
           similar to uniprot|Q03833 Saccharomyces cerevisiae
           YDR096w GIS1 DNA damage-responsive repressor of PHR1
          Length = 625

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           + C +C+ +F       RH  S HS+ KPYNCP C    KR+D++ QH+K K
Sbjct: 562 FYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKK 613

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCP--WCQSRHKRRDNLFQHMKT 437
           Y CS+C K F R S    HL +H+  KPY CP   C      R N+ +H KT
Sbjct: 237 YGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKT 288

>CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {ON}
           some similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230w USV1 or uniprot|Q00453 Saccharomyces
           cerevisiae YMR182c RGM1
          Length = 613

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 5/85 (5%)

Query: 388 YRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVL 444
           ++C+    CE SF R     RH+  H+  KP+ C  C     R DNL QH  T H    +
Sbjct: 25  FKCTGYPGCEMSFSRAEHLARHIRRHTGEKPFKCDICLKYFSRIDNLKQHKDTVHAKDNV 84

Query: 445 QELMEAGDL--DGSMGTNVRLAIDD 467
           +   +   +  +G+  +N+ L   D
Sbjct: 85  KNNSQHHQIHVNGAKSSNITLKYSD 109

>KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.351
           YJR127C
          Length = 1076

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + CS+C ++F R+   +RH  SH++ KP+ C +C     RRD + +H    H   +  EL
Sbjct: 52  FVCSVCTRAFIRQEHLKRHQRSHTNEKPFICVFCGRCFARRDLVLRHQHKLHSALIGTEL 111

>TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.351
           YJR127C
          Length = 1310

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           + CS+C + F R+   +RH +SH++ KP+ C +C     R+D + +H
Sbjct: 34  FLCSICTRGFVRQEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 80

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y+C+ C K F +    + H   H+  KPY+C  C  R  R+ NL  H+ T
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKICNKRFSRKGNLTAHVLT 594

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 2/69 (2%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y C +C K F RK     H+L+H   KPY C    C     +  N+  H    H + +++
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAHQNKFHYNTLIE 632

Query: 446 ELMEAGDLD 454
              +  +++
Sbjct: 633 LTNKLANMN 641

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           ++C  C + F + +  + H+ SH  +KPY C +C  +  +  NL  H +
Sbjct: 517 HQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNFCGKKFTQGGNLKTHQR 565

>TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]
           {ON} Anc_4.351 YJR127C
          Length = 1655

 Score = 43.5 bits (101), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 32/63 (50%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y C +C + F R+   +RH  +H++ KP+ C +C     RRD + +H    H   +  E 
Sbjct: 87  YLCQICTRGFVRQEHLRRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHPTLISMES 146

Query: 448 MEA 450
            EA
Sbjct: 147 TEA 149

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMK 436
           ++C +C++ F R    +RH+ +H+  KPY C  P C     R D L +H K
Sbjct: 17  FKCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSK 67

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y+C  C + F +KS  +RHL SHS  KP++C  C      R  L +H  T
Sbjct: 150 YQCEQCGRGFTKKSHLERHLFSHSETKPFSCTVCGKGVTTRQQLRRHEIT 199

>YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}
           TDA9DNA-binding protein, putative transcription factor;
           green fluorescent protein (GFP)-fusion protein localizes
           to the nucleus; null mutant is sensitive to expression
           of the top1-T722A allele; not an essential gene
          Length = 1251

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + C +C + F R+   +RH  +H++ KP+ C +C     RRD + +H    H   V +E 
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES 120

Query: 448 MEAGD---LDGSMGTNV------RLAIDDMVAGPSIRTLVQDGRVKKER 487
           + + D   +D     N+      +  I    + P  +T VQ  +  KE+
Sbjct: 121 INSKDKTEIDAINDKNIIQIQGNKQTILPTPSNPLAKTAVQLKKAAKEK 169

>AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if
           syntenic homolog of Saccharomyces cerevisiae YHR006W
           (STP2)
          Length = 274

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 387 LYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW------CQS--RHKRRDNLFQHMKTK 438
           +YRCS C  +FK + +  RHL  H  +K + CP+      C S     R+D    H+K+ 
Sbjct: 155 VYRCSYCPSNFKVRGYLTRHLKKHMPYKDFRCPYWSEDCRCHSSGEFSRKDTFRTHLKSI 214

Query: 439 H 439
           H
Sbjct: 215 H 215

>Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]
           {ON} complement(246366..247520) [1155 nt, 385 aa]
          Length = 384

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C  C+ +F +KS  +RHL SHSS KP+ C  C      R  L +H  T
Sbjct: 73  FKCDQCDSAFSKKSHLERHLFSHSSEKPFTCAVCNKGLTTRQQLKRHEIT 122

>Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {ON}
           YML081W - Hypothetical ORF [contig 376] FULL
          Length = 1178

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + CS+C + F R+   +RH  +H++ KP+ C +C     RRD + +H +  H
Sbjct: 78  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 129

>KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON}
           similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1128

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + CS+C + F R+   +RH  +H++ KP+ C +C     RRD + +H +  H
Sbjct: 32  FLCSICTRGFARQEHLKRHQRAHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 83

>TBLA0E04210 Chr5 (1066141..1067505) [1365 bp, 454 aa] {ON} 
          Length = 454

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 390 CSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           C  C +SF       RH  + H + KP++CP C+ R KRRD++ QH+  K
Sbjct: 392 CYECCRSFSSSHHLTRHKKTVHLNEKPFSCPRCRKRFKRRDHVLQHLNKK 441

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 385 AMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKT 437
           A +++C +C+K   R +  + HLL H+  KPY C W  C +    + N+ +H K+
Sbjct: 293 ARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKS 347

>Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081W
           (REAL)
          Length = 1253

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + C +C + F R+   +RH  +H++ KP+ C +C     RRD + +H    H   V +E 
Sbjct: 61  FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKES 120

Query: 448 MEAGD---LDGSMGTNV------RLAIDDMVAGPSIRTLVQDGRVKKER 487
           + + D   +DG    N+      +  I    + P  +T  Q  +  KE+
Sbjct: 121 VNSKDKTQIDGINDKNIIQIQGNKQTILPTPSNPLAKTAAQLKKAAKEK 169

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 25/34 (73%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWC 421
           ++C  CE++F +KS  +RH+ +HS  KP++C +C
Sbjct: 86  FKCDHCERTFAKKSHLERHMFTHSDNKPFHCSYC 119

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 393 CEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           C KSF R S    H L+ H   KP+ C  C+    ++ +L +HM T
Sbjct: 62  CNKSFTRPSLLTEHQLTVHQGIKPFKCDHCERTFAKKSHLERHMFT 107

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 382 SSMA---MLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           SS+A   M Y C +C K FKR S    H   H+  KPY+CP   C+     + N+ +H K
Sbjct: 267 SSLAYQQMKYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYK 326

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 5/67 (7%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKH---VHQ 442
           Y C  C K F RK     H+L+H + KPY+C    C     +  NL  H    H   ++Q
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQ 655

Query: 443 VLQELME 449
           + Q L E
Sbjct: 656 LTQRLAE 662

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C  C K F +    + H   H+  KPY+C  C  R  R+ NL  HM T
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSCEKCGKRFSRKGNLAAHMLT 617

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           + C  C K F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 540 HECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEYCGKRFTQGGNLRTHTR 588

>SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some
           similarities with uniprot|Q12132 Saccharomyces
           cerevisiae YPL230W USV1 Up in StarVation
          Length = 322

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 11/75 (14%)

Query: 387 LYRCSM---CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQV 443
           ++RC+    C  +F R     RH+  H+  KP+ C  C     R DNL QH ++  VH +
Sbjct: 21  VFRCTGYGDCHMTFTRAEHLARHIRKHTGEKPFQCDICHRFFSRVDNLKQHKES--VHSI 78

Query: 444 LQELMEAGDLDGSMG 458
           +       D +GS G
Sbjct: 79  I------PDTNGSRG 87

>Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}
           YDR253C (REAL)
          Length = 191

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%)

Query: 376 SFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHM 435
           S D   S+    +RC+ C   F R S  +RH  +H +  P  CP C     R+D L +H 
Sbjct: 86  SQDRRNSNGGKQFRCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDALKRHY 145

Query: 436 KTKHVHQVLQELMEAG 451
            T    +   +L+ AG
Sbjct: 146 DTLTCRRNRSKLLSAG 161

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C +C KS+   S  + H+ +H+  KP +CP C  R     NL +H++T
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPICNKRFNESSNLAKHIRT 769

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 388 YRCSM--CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y+C    C K F +K    RHL  HS +KP+ C  C      +D L QH++ 
Sbjct: 662 YKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRCAECGKCFNTQDILTQHLRV 713

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           +RC+ C K F  +    +HL  HS  +P+ C  C   +    +L  H++T
Sbjct: 692 FRCAECGKCFNTQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT 741

>KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 460

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKTKHVH 441
           Y C +C ++F R     RH+ +H+  KP+ C  P C  +  R D L +H   K +H
Sbjct: 26  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFPGCTKKFSRSDELTRH---KRIH 78

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 389 RCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKT 437
           +C +C K   R S  + H + H+   P+ CPW  C      + N+F+H+K+
Sbjct: 456 QCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKS 506

>NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486
          Length = 199

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 19/96 (19%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           Y CS CE  F R S  +RH  +H    P+ C  C     R+D L +H  T+   +  ++L
Sbjct: 118 YPCSKCELIFLRSSDLRRHEKAHLLVLPHICSQCGKGFARKDALKRHFNTQTCQRNRKKL 177

Query: 448 MEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQDGRV 483
           ME                   +AG +I  L++  RV
Sbjct: 178 ME-------------------IAGGNINELLERARV 194

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQ 445
           ++C  C K F +    + H   H+  KPYNC  C  R  R+ NL  H  T   HQ L+
Sbjct: 437 FQCEFCGKRFTQGGNLRTHQRLHTGEKPYNCEMCGKRFSRKGNLAAHALT---HQKLK 491

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           Y C MC K F RK     H L+H   KPY C    C     +  N+  H    H    L+
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFH----LK 520

Query: 446 ELMEAGDLDGSMGTNVRL 463
            LM       SM  N  +
Sbjct: 521 TLMRLTSKLASMNENTDI 538

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           + C  C + F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 409 HECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEFCGKRFTQGGNLRTHQR 457

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQV 443
           +RC +C + F R    +RH+ +H+  KP+ C +  C     R D L +H++T H + V
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRHLRT-HTNTV 73

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 5/85 (5%)

Query: 371 GSDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRR 428
            S  GS +   SS      C +C K+F RK     H++ H++ KPY C  P C+ +   +
Sbjct: 141 NSQSGSLNGNISSEKT---CPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVK 197

Query: 429 DNLFQHMKTKHVHQVLQELMEAGDL 453
            NL +H K   + +  ++L +A ++
Sbjct: 198 GNLQRHSKCHKLQKPNRKLKKALNV 222

>SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa]
           {ON} similar to uniprot|Q04545 Saccharomyces cerevisiae
           YML081W Hypothetical ORF
          Length = 1238

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C + F R+   +RH  SH++ KP+ C +C     RRD + +H +  H
Sbjct: 73  FLCPICTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 124

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNC--PWCQSRHKRRDNLFQHMKT 437
           +RC +C + F R    +RH  +H+  KP+ C  P C     R D L +H +T
Sbjct: 20  FRCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRT 71

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKH 439
           Y C +C + F R    +RHL  H+  KPY C +  C  +  R D L +H K  H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHH 72

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           Y C +C K F+R S  + H+  H+  KPY CP+  C      + N+ +H K
Sbjct: 415 YHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFK 465

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C  C KSF +KS  +RHL SHS  KP+ C +C      R  L +H  T
Sbjct: 83  FQCDKCPKSFVKKSHLERHLYSHSDTKPFQCSYCGKGVTTRQQLKRHEVT 132

>AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML081W and
           YJR127C (ZMS1)
          Length = 1191

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C + F R+   +RH  SH++ KP+ C +C     RRD + +H +  H
Sbjct: 80  FLCPVCTRGFARQEHLKRHQRSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 131

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           Y C  C K FKR S    H+  H+  KPY CP+  C+     + N+ +H K
Sbjct: 258 YGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYK 308

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQ 442
           + C +C K F+R    +RH+ +H+  KP++C +  C  +  R D L +H+K  HV++
Sbjct: 13  FICDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKI-HVNK 68

>TBLA0E04220 Chr5 (1069230..1070789) [1560 bp, 519 aa] {ON}
           Anc_8.234 YER169W
          Length = 519

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 390 CSMCEKSFKRKSWHQRHLLS-HSSFKPYNCPWCQSRHKRRDNLFQHMKTK 438
           C  C +SF       RH  + H + KP++CP C  R KRRD++ QH+  K
Sbjct: 449 CFECRRSFSSSHHLTRHRKTVHLNEKPFSCPKCGKRFKRRDHVLQHLNKK 498

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKT 437
           +RC +C + F R    +RH+ +H+  KPY C    C     R D L +H +T
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRT 68

>Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {ON}
           YMR182C (REAL)
          Length = 212

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 378 DDTGSSMAMLYRC---SMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           +   +S+   YRC     C  SF R     RH+  H+  KP+ C  C     R DNL QH
Sbjct: 9   NKENASLKRNYRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQH 68

Query: 435 MKTKH 439
             + H
Sbjct: 69  QSSVH 73

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMK 436
           Y C +C ++F R     RH+ +H+  KP+ C +  C  +  RRD L +H +
Sbjct: 22  YVCPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRR 72

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVHQVLQ 445
           YRC +C+K F RK     H L+H   KP+ C    C     +  N+  H    H    LQ
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFH----LQ 711

Query: 446 ELMEAGDLDGSMGTNVRLAIDD 467
            L+E       M  N  +  +D
Sbjct: 712 TLLELTSKIAEMNPNETIPEED 733

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           ++C+ C K F +    + H   H+  KPY C  C  R  R+ NL  H  T
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRCEICDKRFSRKGNLAAHKLT 677

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           + C  C + F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 600 HECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNFCGKRFTQGGNLRTHQR 648

>Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {ON}
           YMR182C (REAL)
          Length = 211

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 3/55 (5%)

Query: 388 YRC---SMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           YRC     C  SF R     RH+  H+  KP+ C  C     R DNL QH  + H
Sbjct: 19  YRCVGYPDCNMSFNRAEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVH 73

>Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON}
           similar to Ashbya gossypii AGL246W
          Length = 240

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 29/64 (45%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + CS CE  F+R    +RH   H S  P  C  C     R+D L +H  T    +  Q+L
Sbjct: 160 FHCSKCELVFRRSGDLRRHEKVHLSILPNICSLCGKGFARKDALKRHFNTLTCKRNRQKL 219

Query: 448 MEAG 451
           +  G
Sbjct: 220 LSIG 223

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 393 CEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           C K+F ++    RHL  HS +KPY CP CQ      D L QH + 
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRV 618

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y C +C K F   +  + H+ +H+  KP  C  C        NL +HMKT
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKVCGRCFNESSNLSKHMKT 674

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKT 437
           Y+C  C+K F  +    +H   HS  KPY C  C  R    ++L  H++T
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHICHKRFAISNSLKIHIRT 646

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWC 421
           ++C++C + F RK+  +RH+ SHS  KP+ C +C
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKCSYC 114

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 60/147 (40%), Gaps = 30/147 (20%)

Query: 375 GSFDDTGSSMAML--------YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSR 424
            +FD+  S+ A +        + C +C K FKR S    H+  H+  KPY CP+  C   
Sbjct: 152 NAFDEKFSAQAEINKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKS 211

Query: 425 HKRRDNLFQHMKTKHVHQVLQELMEAGDLDGSMGTNVRLAIDDMVAGPSIRTLVQ----- 479
              + N+ +H K   +H  L           S G  +    +     P+ + L+Q     
Sbjct: 212 FNAKSNMLRHYK---LHFKL-----------SNGAYILPTGEICAEKPTAKQLLQSSKRT 257

Query: 480 DGRVKKERVKTVLNAVIARVHDGEPGQ 506
             RV+K+R KT        V DG P +
Sbjct: 258 SSRVQKKR-KTSNTTTSTYVSDGYPSE 283

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKT 437
           ++C +C + F R    +RH+ +H+  KP+ C +  C     R D L +H++T
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRT 68

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 5/77 (6%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           + C  C K F +    + H   H+  KPY C  C  R  R+ NL  H+ T   HQ L+  
Sbjct: 590 FLCECCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHIVT---HQKLKPF 646

Query: 448 MEAGDLDGSMGTNVRLA 464
           +    LDG   T  +L 
Sbjct: 647 V--CKLDGCNKTFTQLG 661

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 26/56 (46%)

Query: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           GS     + C  C + F + +  + H+ SH  +KP+ C  C  R  +  NL  H +
Sbjct: 555 GSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFLCECCGKRFTQGGNLRTHQR 610

>KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} similar
           to uniprot|Q04545 Saccharomyces cerevisiae YML081W
          Length = 1332

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 29/52 (55%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           + C +C + F R+   +RH  SH++ KP+ C +C     RRD + +H +  H
Sbjct: 83  FLCPICTRGFARQEHLRRHERSHTNEKPFLCAFCGRCFARRDLVLRHQQKLH 134

>Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..7102)
           [4026 nt, 1342 aa]
          Length = 1341

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQH 434
           + CS+C + F R    +RH +SH++ KP+ C +C     R+D + +H
Sbjct: 36  FLCSICTRGFVRHEHLKRHKISHTNEKPFLCIFCGRCFARKDLVLRH 82

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHVHQVLQEL 447
           ++C  C K F +    + H   H+  KPY C  C  R  R+ NL  H+ T   HQ L+  
Sbjct: 452 FQCQYCGKRFTQGGNLRTHQRLHTGEKPYECELCGKRFSRKGNLAAHVVT---HQKLKPF 508

Query: 448 MEAGDLDGSMGTNVRLA 464
           +    LDG   T  +L 
Sbjct: 509 I--CKLDGCNKTFTQLG 523

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 381 GSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMK 436
           GS     + C  C + F + +  + H+ SH  +KP+ C +C  R  +  NL  H +
Sbjct: 417 GSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQYCGKRFTQGGNLRTHQR 472

>TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4.351
           YJR127C
          Length = 1199

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKH 439
           Y C +C + F R+   +RH  SH++ KP+ C +C     RRD + +H    H
Sbjct: 57  YLCPICTRGFVRQEHLKRHQRSHTNEKPFLCVFCGRCFARRDLVLRHQHKLH 108

>Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {ON}
           YGL035C (MIG1) - 1:1 [contig 227] FULL
          Length = 463

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 388 YRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPW--CQSRHKRRDNLFQHMKTKHVH 441
           Y C +C ++F R     RH+ +H+  KP+ C +  C  R  R D L +H   K +H
Sbjct: 23  YICPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRH---KRIH 75

>Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}
           YDR253C (REAL)
          Length = 193

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%)

Query: 372 SDRGSFDDTGSSMAMLYRCSMCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNL 431
           S+  S D   S+    ++C+ C   F R S  +RH  +H +  P  CP C     R+D L
Sbjct: 82  SESKSQDRRNSTGEKKFKCAKCSLEFSRSSDLRRHEKTHFAILPNICPQCGKGFARKDAL 141

Query: 432 FQHMKTKHVHQVLQELMEAG 451
            +H  T    +   +L+ AG
Sbjct: 142 KRHYDTLTCRRNRTKLLTAG 161

>NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {ON}
           Anc_6.256
          Length = 409

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 387 LYRCS---MCEKSFKRKSWHQRHLLSHSSFKPYNCPWCQSRHKRRDNLFQHMKTKHV 440
           L++C+    C   F R+    RH+  H+  KP+ C  C     R DNL QH +T H+
Sbjct: 14  LFQCTGYKECSMVFTREEHLARHIRKHTGEKPFQCDICLRFFSRVDNLKQHRETVHL 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.129    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,708,169
Number of extensions: 796497
Number of successful extensions: 3441
Number of sequences better than 10.0: 623
Number of HSP's gapped: 3138
Number of HSP's successfully gapped: 764
Length of query: 506
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 392
Effective length of database: 40,409,475
Effective search space: 15840514200
Effective search space used: 15840514200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)