Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06820g2.532ON26026012791e-180
Kwal_26.80162.532ON2402635282e-66
SAKL0A09460g2.532ON2402613656e-42
Kpol_1018.342.532ON2922342946e-31
NCAS0D026402.532ON2602722742e-28
NDAI0I022702.532ON2772752753e-28
CAGL0K02981g2.532ON2782312657e-27
KAFR0A018502.532ON2562442612e-26
Smik_13.2482.532ON2551552593e-26
YMR069W (NAT4)2.532ON2851552581e-25
TPHA0C041802.532ON2641582472e-24
TDEL0A030602.532ON2442432444e-24
KNAG0C058202.532ON2711702369e-23
Skud_13.2252.532ON2541752271e-21
TBLA0G022202.532ON2781542072e-18
ZYRO0B01980g2.532ON1881592003e-18
Suva_13.2442.532ON2571601798e-15
Ecym_72562.532ON2431781647e-13
KLLA0E18569g2.532ON2151651541e-11
Agos_YGOB_Anc_2.5322.532ON1871411433e-10
Kpol_543.45.467ON84299721.3
Kpol_440.85.467ON84299721.3
KNAG0F015102.108ON282136711.3
KAFR0G022806.112ON64577702.3
SAKL0G03388g5.467ON84299683.8
Ecym_23195.467ON84299675.1
KLTH0F15180g5.467ON84299676.0
AFR142C5.467ON84272659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06820g
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...   497   e-180
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...   207   2e-66
SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly ...   145   6e-42
Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {...   117   6e-31
NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON...   110   2e-28
NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.53...   110   3e-28
CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly...   106   7e-27
KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.53...   105   2e-26
Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W...   104   3e-26
YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N alph...   103   1e-25
TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.53...   100   2e-24
TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.53...    99   4e-24
KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {...    96   9e-23
Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W...    92   1e-21
TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.53...    84   2e-18
ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some si...    82   3e-18
Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)...    74   8e-15
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    68   7e-13
KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa] ...    64   1e-11
Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...    60   3e-10
Kpol_543.4 s543 (8173..10701) [2529 bp, 842 aa] {ON} (8173..1070...    32   1.3  
Kpol_440.8 s440 (20244..22772) [2529 bp, 842 aa] {ON} (20244..22...    32   1.3  
KNAG0F01510 Chr6 (273832..274680) [849 bp, 282 aa] {ON} Anc_2.10...    32   1.3  
KAFR0G02280 Chr7 (475071..477008) [1938 bp, 645 aa] {ON} Anc_6.1...    32   2.3  
SAKL0G03388g Chr7 (277210..279738) [2529 bp, 842 aa] {ON} unipro...    31   3.8  
Ecym_2319 Chr2 complement(625283..627811) [2529 bp, 842 aa] {ON}...    30   5.1  
KLTH0F15180g Chr6 complement(1244579..1247107) [2529 bp, 842 aa]...    30   6.0  
AFR142C Chr6 complement(695454..697982) [2529 bp, 842 aa] {ON} S...    30   9.0  

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score =  497 bits (1279), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/260 (95%), Positives = 247/260 (95%)

Query: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60
           MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG
Sbjct: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60

Query: 61  PTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
           PTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG
Sbjct: 61  PTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120

Query: 121 LVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDC 180
           LVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDC
Sbjct: 121 LVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDC 180

Query: 181 LGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDXXXXXXXXXXXXX 240
           LGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD             
Sbjct: 181 LGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDRRAQVRRRTRAIA 240

Query: 241 YDSSLVTRPAYYILFWPAAS 260
           YDSSLVTRPAYYILFWPAAS
Sbjct: 241 YDSSLVTRPAYYILFWPAAS 260

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score =  207 bits (528), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 136/263 (51%), Positives = 162/263 (61%), Gaps = 32/263 (12%)

Query: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60
           M DYPA  L PHVT  FP  LTL +GQ+ + RAVYG+P D  +       RA  P P   
Sbjct: 1   MADYPADYLVPHVTDSFPTTLTLASGQR-IQRAVYGVPMDTVRS------RAEIPDP--- 50

Query: 61  PTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
                 C         LL+QLL+LV +NLGP+Y +HA+A+YG    SW  RKR EM TPG
Sbjct: 51  ------C---------LLEQLLALVDSNLGPVYAQHAKALYGDQCGSWKERKRQEMVTPG 95

Query: 121 LVYVVY------SDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGT 174
           LVYVVY      +     PL F+SLLLTDEPELG   AA V+YL EIHV+DIIRG GLG 
Sbjct: 96  LVYVVYRAVDEETGKEGLPLAFLSLLLTDEPELGPAPAA-VVYLMEIHVADIIRGLGLGG 154

Query: 175 HLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDXXXXXXX 234
            LLR+ + GT+    RA P + G ELTVF++N+ ALRLYL LGM +AAWSPQD       
Sbjct: 155 TLLREGVAGTVRGARRAHPFIQGTELTVFTDNEGALRLYLRLGMQIAAWSPQDTCIEVHR 214

Query: 235 XXXXXXYDSSLVTRPAYYILFWP 257
                 Y+S  VTRP YY+LFWP
Sbjct: 215 RTRATRYESRKVTRPTYYLLFWP 237

>SAKL0A09460g Chr1 (826395..827117) [723 bp, 240 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069W NAT4 N alpha-acetyl-transferase involved in
           acetylation of the N-terminal residues of histones H4
           and H2A
          Length = 240

 Score =  145 bits (365), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 137/261 (52%), Gaps = 24/261 (9%)

Query: 1   MVDYPASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPG 60
           MVDYPA+ L P+V   FP  +TL +G    TR V  I                  +P  G
Sbjct: 1   MVDYPANVLLPYVLDSFPTSITLKDGSLA-TRKVLVID-----------------EPSSG 42

Query: 61  PTPASE-CD-SVPRPPAD-LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEME 117
             P+ + C  S  R  ++ LL Q L ++  NLG  Y   +  +YG  R SW   K  EM+
Sbjct: 43  IAPSGQVCTWSGDRQSSNSLLIQFLKVLDLNLGSKYRSVSATLYGNTR-SWTENKLEEMQ 101

Query: 118 TPGLVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLL 177
           T GLVYV Y    S PL+F+S LLTDEP+   +   +V+YL+EI +   ++GQ LGT +L
Sbjct: 102 TIGLVYVGYFQGVS-PLMFLSFLLTDEPDFLPD-PVKVVYLYEIQLLPEVQGQRLGTQML 159

Query: 178 RDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQDXXXXXXXXXX 237
           +  L  T+ SLSR  P + G ELTVFS+N  AL LY ++GM +A  SP D          
Sbjct: 160 QVYLKNTVHSLSRLDPLLKGIELTVFSDNDAALHLYYSIGMALAPGSPTDEIATSQRRTR 219

Query: 238 XXXYDSSLVTRPAYYILFWPA 258
               D   V+RP YY++F P 
Sbjct: 220 HSTTDLQTVSRPDYYLMFLPV 240

>Kpol_1018.34 s1018 complement(109063..109941) [879 bp, 292 aa] {ON}
           complement(109063..109941) [879 nt, 293 aa]
          Length = 292

 Score =  117 bits (294), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 118/234 (50%), Gaps = 27/234 (11%)

Query: 6   ASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPAS 65
           A  +FP   +      +  N ++ L R +  I S   Q + R    +             
Sbjct: 11  AENIFPETLELLNDNSSTSNQKKVLHRQLIAIDSKNNQIDVRNNVLSYYK-------DNV 63

Query: 66  ECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVV 125
           +CD V       L++LL ++  NLGP+Y   +  IY    + W   K  EM++ GL+YV+
Sbjct: 64  KCDVV-------LNKLLDILDNNLGPIYLEKSSKIY-CNEKPWKENKIVEMKSEGLLYVI 115

Query: 126 YSDSHS-QPLVFMSLLLTDEPEL-------GQELA---ARVLYLFEIHVSDIIRGQGLGT 174
           Y+D  + +PL+FMS ++TD+P L         EL+   A V+YL+EI + ++IR Q LGT
Sbjct: 116 YNDDITKEPLLFMSFMITDDPSLVVPTDNDSNELSNSTAAVIYLYEIQLLELIRNQKLGT 175

Query: 175 HLLRDCLGGTLASLSRA-SPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227
            L+ + L  T+  L++    +++  ELTVFS N  A+  Y  +GM     SP+D
Sbjct: 176 ILITNYLKKTIEILNKDYQKNIIALELTVFSNNINAINFYKKIGMLYTPDSPRD 229

>NCAS0D02640 Chr4 complement(507611..508393) [783 bp, 260 aa] {ON}
           Anc_2.532 YMR069W
          Length = 260

 Score =  110 bits (274), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 128/272 (47%), Gaps = 33/272 (12%)

Query: 6   ASELFPH-VTQCFPLVL--TLPNGQQQLTRAVYGI-PSDATQHEERREPRAAGPKPEPGP 61
           A E F H + + FPL L  TL    + L R +  I P + T  +  ++        + G 
Sbjct: 3   AFEAFSHMILEEFPLTLEVTLQEQLKCLKRKILIIEPDNCTSGKNSQDVVYMKCSTDQGD 62

Query: 62  TPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGL 121
                          +LDQ L ++  NLG  YT+ ++ IY   R  W   K  EM +PGL
Sbjct: 63  K--------------MLDQFLDILDVNLGEKYTKVSKKIYENAR-PWKVNKLEEMRSPGL 107

Query: 122 VYVVYSDSHS-QPLVFMSLLLTDEPELGQE-LAARVLYLFEIHVSDIIRGQGLGTHLLRD 179
           VYV Y D  S +P++F+S +LT+E    ++     V+YL+EI +   +R + LGT LL +
Sbjct: 108 VYVSYWDEESDEPMLFLSFMLTEEDGFTEDDKLLSVVYLYEIQILPSLRNRKLGTRLLAE 167

Query: 180 CLGGTLASLSRASPSVL-----GAELTVFSENQRALRLYLALGMHVAAWSPQDXXXXX-- 232
            L    + L   +  +L     G ELTVFS+N+ A++ Y ++GM +   SP+D       
Sbjct: 168 HLQDACSRLRSENGELLEYPLIGIELTVFSDNENAIKFYKSIGMELTPDSPRDRVAHLER 227

Query: 233 -----XXXXXXXXYDSSLVTRPAYYILFWPAA 259
                           ++V +P YY+ + P +
Sbjct: 228 RRTRGMAQNISTSVGRTIVQKPIYYLFYLPLS 259

>NDAI0I02270 Chr9 (518231..519064) [834 bp, 277 aa] {ON} Anc_2.532
           YMR069W
          Length = 277

 Score =  110 bits (275), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 128/275 (46%), Gaps = 43/275 (15%)

Query: 13  VTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPR 72
           V + FP +L   +G     R ++  PS    H+E   P           +      S P+
Sbjct: 13  VCEEFPTILQSADGVTTWRRRIHHKPS----HDEVSIPIEHS-------SEVYNLSSDPQ 61

Query: 73  PPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSD-SHS 131
             +D+L++ L+++  NLG  YT+ ++ IY    +SW + K  EM +PGL+YV Y D  + 
Sbjct: 62  QRSDVLNKFLNILDVNLGAKYTKVSKTIY-ENDKSWKSNKLEEMLSPGLIYVSYWDEKYQ 120

Query: 132 QPLVFMSLLLT-------------DEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLR 178
           +PL+F+S +LT             DE E   +L + V+YL+EI +   +RGQG+GT LL 
Sbjct: 121 EPLLFLSFMLTEGDGFIGTHSNDDDENEHNDQLMS-VIYLYEIQILPQLRGQGIGTKLLS 179

Query: 179 DCLGGTLASLSRASPS------VLGAELTVFSENQRALRLYLALGMHVAAWSPQDXXXXX 232
             L    +SL            ++G ELTVFS+N +A+  Y ++GM +   SP D     
Sbjct: 180 VHLHQCCSSLVTKYGKDFLPYPLVGIELTVFSDNIKAINFYKSIGMKLTPDSPTDEVYQI 239

Query: 233 XXXXX----------XXXYDSSLVTRPAYYILFWP 257
                                 ++ +P YY+ + P
Sbjct: 240 EKRQTRNLRRINNAGTREVTKQIIKKPVYYLYYLP 274

>CAGL0K02981g Chr11 (265614..266450) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q04751 Saccharomyces cerevisiae
           YMR069w
          Length = 278

 Score =  106 bits (265), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 110/231 (47%), Gaps = 26/231 (11%)

Query: 12  HVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVP 71
           HV  CFP V+T        T++   +P D    + +R+              A   + V 
Sbjct: 18  HVLDCFPKVIT--------TKS--NLPKDIEDVQLQRKVLVIDGDDYCLANKALTNEVVL 67

Query: 72  RPP-----ADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVY 126
           R        ++L  LL L+  NLG  Y   ++ +YG  ++ W   K  EM T G++YV Y
Sbjct: 68  RSKHIKESKNILSSLLELLDQNLGQKYEISSKEMYG-NKKPWKENKIEEMNTEGMIYVSY 126

Query: 127 ----SDSHSQPLVFMSLLLTDEPELG-QELAARVLYLFEIHVSDIIRGQGLGTHLLRDCL 181
                D H+ PL+F+S +LT+E  L   +  + V++L+EI +S  +R QGLG + L +CL
Sbjct: 127 WTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFLYEIQISKELRKQGLGQYFLSNCL 186

Query: 182 GGTLASLSRASPSVL-----GAELTVFSENQRALRLYLALGMHVAAWSPQD 227
                 L       L     G ELTVF++N  A+ LY  LGM     SP+D
Sbjct: 187 FQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINLYQKLGMTHTPESPKD 237

>KAFR0A01850 Chr1 (384054..384824) [771 bp, 256 aa] {ON} Anc_2.532
           YMR069W
          Length = 256

 Score =  105 bits (261), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 118/244 (48%), Gaps = 27/244 (11%)

Query: 28  QQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPP----ADLLDQLLS 83
           Q L R +  I   A++ EE +E  +            +E D + +      + LLD  L 
Sbjct: 27  QNLKRKILYI---ASEDEENKESDSV----------INEQDDLTKFTEGIGSKLLDSFLE 73

Query: 84  LVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPL---VFMSLL 140
           ++  NLG  Y + +R IY     SW   K  EM++PGL+YV Y    ++     +F+S +
Sbjct: 74  ILDNNLGNKYEKISREIYD-NNDSWKKNKLVEMKSPGLIYVSYWKEEAEKKTCALFLSFM 132

Query: 141 LTDEPELGQELAA-RVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPS--VLG 197
           LT+E  +  ++    V+YL+EI + +  RG  LGT L++        +  +  P+  ++G
Sbjct: 133 LTEEDFVVDDIRKFSVIYLYEIQLIEKYRGCQLGTRLIKGLSNVCQIAQVKIRPAFPLIG 192

Query: 198 AELTVFSENQRALRLYLALGMHVAAWSPQDXXXXXXXXXXXXXYDS---SLVTRPAYYIL 254
            +LTVFS+N+RA++ Y  +GM     SP+D              +     +V +P YY+L
Sbjct: 193 IQLTVFSDNKRAIKFYERIGMKFTYGSPKDEVDKIESRKTRTSVNRKTLKVVRKPIYYLL 252

Query: 255 FWPA 258
           + P 
Sbjct: 253 YLPV 256

>Smik_13.248 Chr13 (391924..392691) [768 bp, 255 aa] {ON} YMR069W
           (REAL)
          Length = 255

 Score =  104 bits (259), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 88/155 (56%), Gaps = 8/155 (5%)

Query: 77  LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPLVF 136
           +LD  + L+  +LG  Y R +R +YG  R+ W A K AEM++P LVYV Y D+ +    F
Sbjct: 70  ILDSCVQLIDEHLGAKYRRASRTMYG-NRKPWKANKLAEMKSPNLVYVSYWDNGALA-AF 127

Query: 137 MSLLLTDEPEL-----GQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRA 191
            S +LT+E  L       E++  V+YL+E+HV+ + RG G+G  LL   L   +A   R 
Sbjct: 128 ASFMLTEETGLVEGDAAHEVSVPVIYLYEVHVACVHRGHGIGRRLLERALCEGVARHVRC 187

Query: 192 -SPSVLGAELTVFSENQRALRLYLALGMHVAAWSP 225
                 G  LTVFS+N RA RLY ALG + A  SP
Sbjct: 188 LYEEFFGVALTVFSDNTRARRLYEALGFYRAPGSP 222

>YMR069W Chr13 (407709..408566) [858 bp, 285 aa] {ON}  NAT4N
           alpha-acetyl-transferase, involved in acetylation of the
           N-terminal residues of histones H4 and H2A
          Length = 285

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 87/155 (56%), Gaps = 8/155 (5%)

Query: 77  LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPLVF 136
           +LD  + L+  +LG  Y R +R +YG  R+ W A K AEM++ GLVYV Y D+      F
Sbjct: 100 VLDACVQLIDKHLGAKYRRASRIMYG-NRKPWKANKLAEMKSAGLVYVCYWDN-GVLGAF 157

Query: 137 MSLLLTDEPELGQ-----ELAARVLYLFEIHVSDIIRGQGLGTHLLRDCL-GGTLASLSR 190
            S +LT+E  L +     E++  V+YL+E+HV+   RG G+G  LL   L  G      R
Sbjct: 158 TSFMLTEETGLVEGDALHEVSVPVIYLYEVHVASAHRGHGIGRRLLEHALCDGVARHTRR 217

Query: 191 ASPSVLGAELTVFSENQRALRLYLALGMHVAAWSP 225
              +  G  LTVFS+N RA RLY ALG + A  SP
Sbjct: 218 MCDNFFGVALTVFSDNTRARRLYEALGFYRAPGSP 252

>TPHA0C04180 Chr3 (899260..900054) [795 bp, 264 aa] {ON} Anc_2.532
           YMR069W
          Length = 264

 Score = 99.8 bits (247), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 90/158 (56%), Gaps = 16/158 (10%)

Query: 80  QLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVY--SDSHSQPLVFM 137
           ++L+++  NLG +YT   + +YG  +  W   K  EM+T GL+YVVY   D      +++
Sbjct: 69  KILTILDNNLGDIYTIKNKKLYGNSK-PWKENKIQEMKTEGLIYVVYHLEDEKKTVSLYL 127

Query: 138 SLLLTDE----PELGQELAARVLYLFEIHVSDIIRGQGLGTHL----LRDCLGGTLASLS 189
           S  LT E    P++  ++ + V+YL+EI ++  +R  GLGT L    L+DCL     ++ 
Sbjct: 128 SFTLTKESGFLPDI--DVFSPVIYLYEIQLTPEVRNNGLGTKLIAGYLKDCLVDVHENIH 185

Query: 190 RASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227
           +    ++G ELTVFS+N  A+R Y  +GM +   SP D
Sbjct: 186 K---DIIGIELTVFSDNTNAIRFYETIGMKLTPDSPND 220

>TDEL0A03060 Chr1 (548200..548934) [735 bp, 244 aa] {ON} Anc_2.532
           YMR069W
          Length = 244

 Score = 98.6 bits (244), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 114/243 (46%), Gaps = 45/243 (18%)

Query: 7   SELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASE 66
           +++  +  Q FP   T+     QLTR +  I +                  E  P    +
Sbjct: 7   NDVVKYANQNFPT--TINAAGIQLTRKLLAIDT------------------EEYPVETDQ 46

Query: 67  CDSV---PRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVY 123
           C S    PR    LL QLL ++  NLG  Y   +RA+Y   R  W   K  EM TPGLVY
Sbjct: 47  CISYVHSPREAEKLLWQLLEILDENLGQKYAGSSRALYHNTR-PWRVNKWREMLTPGLVY 105

Query: 124 VVYS-----------DSHSQPLVFMSLLLTDEPELGQE---LAARVLYLFEIHVSDIIRG 169
           V+YS           ++   PL+F+S +LT+E  L  +       VLYL+E+ +   +R 
Sbjct: 106 VIYSTAATTTATQRRNAPFSPLLFLSFMLTEEDGLVADDPTEVWTVLYLYELQLLPRVRR 165

Query: 170 QGLGTHLLRDCL---GGTLASLSRA----SPSVLGAELTVFSENQRALRLYLALGMHVAA 222
            GL   LL D L   G  L + SRA         G ELTVF++N  A+RLY +LGM +AA
Sbjct: 166 LGLAARLLGDHLAQCGRQLCTRSRAGRFSKTRFFGLELTVFADNAPAIRLYESLGMQLAA 225

Query: 223 WSP 225
            SP
Sbjct: 226 DSP 228

>KNAG0C05820 Chr3 complement(1131541..1132356) [816 bp, 271 aa] {ON}
           Anc_2.532 YMR069W
          Length = 271

 Score = 95.5 bits (236), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 87/170 (51%), Gaps = 14/170 (8%)

Query: 59  PGPTPASECDSVPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMET 118
           P     + C+   R   ++LD        NLGP+Y R +R IYG  +  W   K  EM +
Sbjct: 71  PTAKEDNTCERCLRIFLEILDN-------NLGPVYARLSRKIYGNSKH-WRENKWLEMLS 122

Query: 119 PGLVYVVYSDSHSQPLVFMSLLLTDEPELGQ-ELAARVLYLFEIHVSDIIRGQGLGTHLL 177
             LVYV Y  S S+P+++ S +LT+E  +   E   RV+YL+EI + + IR Q LG  ++
Sbjct: 123 AQLVYVSYWVSDSEPVLYTSFMLTEENGISSIESTDRVVYLYEIQLIEAIRRQKLGQAIV 182

Query: 178 RDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227
                  L   +  SP V    LTVFS+N++AL+ Y  L       SP+D
Sbjct: 183 -----SYLTECALESPEVAAVALTVFSDNEKALKFYERLNFTYTIDSPRD 227

>Skud_13.225 Chr13 (382174..382938) [765 bp, 254 aa] {ON} YMR069W
           (REAL)
          Length = 254

 Score = 92.0 bits (227), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 86/175 (49%), Gaps = 19/175 (10%)

Query: 61  PTPASECDSVPRPPA-----------DLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWP 109
           P    E DS+  P              +LD  + LV  +LG  Y R +R +YG  R  W 
Sbjct: 42  PEENGEVDSIDGPQCTNYNLHKSHGDHVLDSCVQLVDEHLGDKYRRASRTMYG-NRIPWK 100

Query: 110 ARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPEL-----GQELAARVLYLFEIHVS 164
           A K AEM++ GL+YV Y  + +    F S +LT+E  L       E++  V+YL+EIHV+
Sbjct: 101 ANKLAEMKSAGLLYVSYWGNGALG-AFASFMLTEETGLVEGDAAHEVSVPVIYLYEIHVA 159

Query: 165 DIIRGQGLGTHLLRDCLG-GTLASLSRASPSVLGAELTVFSENQRALRLYLALGM 218
              RG GLG  LL   L  G    + R      G  LTVF +N RA RLY A+G 
Sbjct: 160 HAHRGHGLGRRLLERALCEGVARRVRRVRCDFFGVALTVFGDNTRARRLYEAIGF 214

>TBLA0G02220 Chr7 (578220..579056) [837 bp, 278 aa] {ON} Anc_2.532
           YMR069W
          Length = 278

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 78/154 (50%), Gaps = 7/154 (4%)

Query: 80  QLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPL-VFMS 138
           Q+  L+  NLG +Y + ++ IY      W   KR EM T  ++Y+ Y D     + +F+S
Sbjct: 73  QIFQLIDENLGKLYKKKSKKIY-ENDLDWSINKREEMFTSNMIYITYWDCKQNSVALFLS 131

Query: 139 LLLTDEPE-LGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLA---SLSRASPS 194
           +L  +E   L       VLYL+EIH++   + QG+G  L++D L   L     + R   +
Sbjct: 132 ILSCEETYILENNDQGEVLYLYEIHITKEYQRQGIGERLIKDYLIEKLIKPLKIERQDNN 191

Query: 195 VLGAELTVFSENQRALRLYL-ALGMHVAAWSPQD 227
            +G ELTVFSEN  A   Y   + M     SP+D
Sbjct: 192 FIGLELTVFSENNDAQNFYFNKIQMQYTFGSPRD 225

>ZYRO0B01980g Chr2 (160995..161561) [567 bp, 188 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 188

 Score = 81.6 bits (200), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 82/159 (51%), Gaps = 8/159 (5%)

Query: 70  VPRPPADLLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLVYVVYSDS 129
           +      +L++ L L+  NLG  Y ++ + IY   ++ W + K  EM +  L +V Y + 
Sbjct: 13  ISNSNDKILEKQLQLIEINLGSYYNKYNKTIYKNNKR-WQSNKWQEMCSENLFHVSYWNV 71

Query: 130 HSQPLV-FMSLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASL 188
            S  LV F S++  +E  +  E++  ++YL+EIHV+   R Q  G  +L + L   L   
Sbjct: 72  ESNELVCFCSIMPCEESIVEGEMS-NIIYLYEIHVAPEWRNQKFGKSIL-NALKEKLCPK 129

Query: 189 SRASPSVLGAELTVFSENQRALRLYLALGMHVAAWSPQD 227
           +  S    G ELTVFS N+RA+  Y   G  ++  SP D
Sbjct: 130 AHLS----GIELTVFSSNERAINFYRNNGFTLSYDSPSD 164

>Suva_13.244 Chr13 (389038..389523,389555..389779,389842..389901)
           [771 bp, 257 aa] {ON} YMR069W (REAL)
          Length = 257

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 76/160 (47%), Gaps = 14/160 (8%)

Query: 66  ECDSVPRPPAD---LLDQLLSLVTANLGPMYTRHARAIYGAGRQSWPARKRAEMETPGLV 122
           EC +     AD    L   + LV  +LG  Y R +R +YG  R  W A K AEM++ GLV
Sbjct: 55  ECMNYKLHKADGDQTLHSCVQLVDEHLGAKYRRASRTMYG-NRLPWKANKLAEMKSAGLV 113

Query: 123 YVVYSDSHSQPL----VFMSLLLTDEPEL-----GQELAARVLYLFEIHVSDIIRGQGLG 173
           YV Y  + +Q       F S +LT+E  L       E +  V+YL+E+H     RG G  
Sbjct: 114 YVCYWGNDAQGERALGAFASFMLTEETGLVEGDTAHEQSVPVIYLYEVHXXHRGRGLGRR 173

Query: 174 THLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLY 213
                 C  G  A + R    + G  LTVF +N RA RLY
Sbjct: 174 LLAKALC-EGVAARVRRTCDDLFGVALTVFGDNTRARRLY 212

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 67.8 bits (164), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 80/178 (44%), Gaps = 36/178 (20%)

Query: 79  DQLLSLVTANLGPMYTRHARAIYGAGRQS--WPARKRAEMETPGLVYVVYSDSHSQPLV- 135
            QL +++   LG  Y  HA  +Y    +S  W A KRAE++  G  +V+Y   +    + 
Sbjct: 48  KQLTAIIERTLGCFYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIA 107

Query: 136 -FMSLLLTDEPEL----GQELAA---------------------------RVLYLFEIHV 163
            F+SLL  DEP      G   AA                           +V+Y+ EIHV
Sbjct: 108 GFVSLLFCDEPHWPAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHV 167

Query: 164 SDIIRGQGLGTHLLRDCLGGTLASLSRASPSVLGAELTVFSENQRALRLYLALGMHVA 221
           S   + QGLG+ +L  C    +  +  + P + G ELTVF+ N++AL LY   G   A
Sbjct: 168 SPSFQNQGLGSCMLL-CARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTA 224

>KLLA0E18569g Chr5 complement(1651949..1652596) [648 bp, 215 aa]
           {ON} no similarity
          Length = 215

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 74/165 (44%), Gaps = 20/165 (12%)

Query: 71  PRPPADLLDQLLSLVTANLGPMYTRHARAIY-------GAGRQSWPARKRAEMETPGLVY 123
           P      L + L+++  NL   Y  H  +IY       G G + W   K  EM    LVY
Sbjct: 42  PNYLGSTLPKCLAIIKQNLSTFYELHGSSIYNYTDDDKGKGNEKWIRFKWDEMLDKDLVY 101

Query: 124 VVYSDSHSQPLV-FMSLLLTD--EPELGQELAAR-VLYLFEIHVSDIIRGQGLGTHLLRD 179
           +V     +  +V F S+ L+D   PEL      R  L+L+EIH+    + +GLG+ +   
Sbjct: 102 IVLFKRDTTKIVGFTSVALSDPLNPELDHSKLNRPCLFLYEIHLMGEYQSRGLGSLI--- 158

Query: 180 CLGGTLASLSR--ASPSVLGAELTVFSENQRALRLYLALGMHVAA 222
              G L  L+R    PS+   EL VF+ N  A R Y  LG  +  
Sbjct: 159 -FNGLLIPLARDLTCPSI---ELCVFTANDVACRWYKRLGFQLTV 199

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 69/141 (48%), Gaps = 15/141 (10%)

Query: 80  QLLSLVTANLGPMYTRHARAIYGAGRQ--SWPARKRAEMETPGLVYVVYSDSHSQPLVFM 137
            L +LV A L P+Y  HAR +Y   R   +WP  KRAE+  P  ++++Y D   +   F+
Sbjct: 43  DLTALVAAGLAPLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYRDPAGRLACFI 102

Query: 138 SLLLTDEPELGQELAARVLYLFEIHVSDIIRGQGLGTHLLRDCLGGTLASLSRASPSVLG 197
           SLLL          A  VLY+ E+HV+   R +GL             A+ +  +  +  
Sbjct: 103 SLLLPGP-------ADPVLYILELHVAAPFRRRGLAA------ALLDAATRTARAAGLTR 149

Query: 198 AELTVFSENQRALRLYLALGM 218
            ELTVF+ N+ AL LY   G 
Sbjct: 150 LELTVFTANRPALALYARAGF 170

>Kpol_543.4 s543 (8173..10701) [2529 bp, 842 aa] {ON} (8173..10701)
           [2529 nt, 843 aa]
          Length = 842

 Score = 32.3 bits (72), Expect = 1.3,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 37/99 (37%), Gaps = 6/99 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   +  +PS  T  E R E    GP  +P       CD    P ADL+  + 
Sbjct: 328 LPAADALLEMIIMHLPSPVTAQEYRAEQLYEGPHDDPSCIAIKNCD----PKADLMLYVS 383

Query: 83  SLV-TANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
            +V T++ G  Y    R   G  +     R +     PG
Sbjct: 384 KMVPTSDKGRFYA-FGRVFAGTVKSGQKVRIQGPNFVPG 421

>Kpol_440.8 s440 (20244..22772) [2529 bp, 842 aa] {ON}
           (20244..22772) [2529 nt, 843 aa]
          Length = 842

 Score = 32.3 bits (72), Expect = 1.3,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 37/99 (37%), Gaps = 6/99 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   +  +PS  T  E R E    GP  +P       CD    P ADL+  + 
Sbjct: 328 LPAADALLEMIIMHLPSPVTAQEYRAEQLYEGPHDDPSCIAIKNCD----PKADLMLYVS 383

Query: 83  SLV-TANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
            +V T++ G  Y    R   G  +     R +     PG
Sbjct: 384 KMVPTSDKGRFYA-FGRVFAGTVKSGQKVRIQGPNFVPG 421

>KNAG0F01510 Chr6 (273832..274680) [849 bp, 282 aa] {ON} Anc_2.108
           YNL156C
          Length = 282

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 8/136 (5%)

Query: 43  QHEERREPRAAGPKPEPGPTPASECDSVPRPPA-DLLDQLLSLVTANLGPMY-TRHARAI 100
            H ER++P+  GP  +P  + +S   ++ RP    + D  + L +  +  +   ++  A 
Sbjct: 3   SHRERKQPQQGGPSRDPLGSVSSSLANLTRPELYSIYDSGVVLESEGIQDVNEAKYRSAT 62

Query: 101 YGAGRQSWPARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPELGQELAARVLYLFE 160
            G G Q+   R R +++   LV +  S      L  M   + D  +L +++ +R L L  
Sbjct: 63  AGVGPQT--LRPRGKIDATTLVVLALSGIVYHELARM---MHDNHKLHEDIISRPL-LVG 116

Query: 161 IHVSDIIRGQGLGTHL 176
           +H  D   G  LG  +
Sbjct: 117 VHFLDWAVGGSLGISI 132

>KAFR0G02280 Chr7 (475071..477008) [1938 bp, 645 aa] {ON} Anc_6.112
           YGL060W
          Length = 645

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 4/77 (5%)

Query: 6   ASELFPHVTQCFPLVLTLPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPAS 65
           +S + PHV +CF +V    N +Q L  A   + +   + E++    A   K E       
Sbjct: 87  SSPIIPHVMRCFNVVALHGNPKQVLLTACELLSNLTFEEEDKAARDAEKTKTEKD----R 142

Query: 66  ECDSVPRPPADLLDQLL 82
           E D++  P ADL + +L
Sbjct: 143 EDDAIADPNADLSEHVL 159

>SAKL0G03388g Chr7 (277210..279738) [2529 bp, 842 aa] {ON}
           uniprot|Q875S0 Saccharomyces kluyveri EFT2 Elongation
           factor 2
          Length = 842

 Score = 30.8 bits (68), Expect = 3.8,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 36/99 (36%), Gaps = 6/99 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   +  +PS  T    R E    GP  +P       CD    P ADL+  + 
Sbjct: 328 LPAADALLEMIIMHLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCD----PKADLMLYVS 383

Query: 83  SLV-TANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
            +V T++ G  Y    R   G  +     R +     PG
Sbjct: 384 KMVPTSDKGRFYA-FGRVFAGTVKSGQKVRIQGPNYIPG 421

>Ecym_2319 Chr2 complement(625283..627811) [2529 bp, 842 aa] {ON}
           similar to Ashbya gossypii AFR142C
          Length = 842

 Score = 30.4 bits (67), Expect = 5.1,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 36/99 (36%), Gaps = 6/99 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   +  +PS  T    R E    GP  +P       CD    P ADL+  + 
Sbjct: 328 LPAADALLEMIIMHLPSPVTAQSYRAEQLYEGPTDDPACIAIKNCD----PKADLMLYVS 383

Query: 83  SLV-TANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
            +V T++ G  Y    R   G  +     R +     PG
Sbjct: 384 KMVPTSDKGRFYA-FGRVFSGTVKSGQKVRIQGPNFVPG 421

>KLTH0F15180g Chr6 complement(1244579..1247107) [2529 bp, 842 aa]
           {ON} highly similar to uniprot|P32324 Saccharomyces
           cerevisiae YOR133W EFT1 Elongation factor 2 (EF-2) and
           highly similar to uniprot|P32324 Saccharomyces
           cerevisiae YDR385W EFT2
          Length = 842

 Score = 30.4 bits (67), Expect = 6.0,   Method: Composition-based stats.
 Identities = 26/99 (26%), Positives = 36/99 (36%), Gaps = 6/99 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   V  +PS  T    R E    GP  +P       CD    P +DL+  + 
Sbjct: 328 LPAADALLEMIVMHLPSPVTAQNYRAEQLYEGPSDDPACVAIKNCD----PTSDLMLYVS 383

Query: 83  SLV-TANLGPMYTRHARAIYGAGRQSWPARKRAEMETPG 120
            +V T++ G  Y    R   G  +     R +     PG
Sbjct: 384 KMVPTSDKGRFYA-FGRVFAGTVKSGQKIRIQGPNYVPG 421

>AFR142C Chr6 complement(695454..697982) [2529 bp, 842 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR385W
           (EFT2) and YOR133W (EFT1)
          Length = 842

 Score = 29.6 bits (65), Expect = 9.0,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 5/72 (6%)

Query: 23  LPNGQQQLTRAVYGIPSDATQHEERREPRAAGPKPEPGPTPASECDSVPRPPADLLDQLL 82
           LP     L   +  +PS  T    R E    GP  +P       CD    P ADL+  + 
Sbjct: 328 LPAADALLEMIIMHLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCD----PKADLMLYVS 383

Query: 83  SLV-TANLGPMY 93
            +V T++ G  Y
Sbjct: 384 KMVPTSDKGRFY 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,385,917
Number of extensions: 950100
Number of successful extensions: 2800
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2776
Number of HSP's successfully gapped: 35
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)