Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06798g2.531ON1111115774e-78
Kwal_26.80112.531ON190642502e-27
NCAS0J00640na 1ON102521937e-20
KAFR0C031408.117ON370841981e-18
SAKL0A09438g2.531ON441561981e-18
Ecym_26733.298ON301901961e-18
KNAG0H010703.298ON322571934e-18
TDEL0F011708.116ON1621041864e-18
Kpol_1052.83.298ON386581944e-18
NCAS0C042308.117ON338611927e-18
NDAI0C06260na 1ON582571939e-18
Ecym_8387na 2ON1791011832e-17
Kpol_541.398.116ON291671872e-17
KNAG0G011408.117ON519721892e-17
ADL050Wna 2ON146761775e-17
NDAI0A075403.298ON370661866e-17
SAKL0D02618g3.298ON321631821e-16
NCAS0B05750singletonON505541841e-16
ZYRO0E02684g8.116ON133561732e-16
KLLA0F20636gsingletonON285921812e-16
AGL207W3.298ON277861802e-16
TBLA0G032403.298ON511611804e-16
Suva_16.3388.117ON247571774e-16
Kwal_27.104673.298ON302591784e-16
KAFR0A018402.531ON414541805e-16
CAGL0L05786g8.116ON348561786e-16
Suva_16.3358.116ON317571776e-16
Skud_16.2988.116ON317571777e-16
Smik_16.2538.116ON317571777e-16
KAFR0B019908.116ON410631771e-15
CAGL0J01595g8.117ON344621771e-15
TBLA0B064102.531ON449571771e-15
NDAI0B02080singletonON273571741e-15
Skud_16.3008.117ON249571731e-15
YPR015C8.117ON247571731e-15
YPR013C8.116ON317571751e-15
NCAS0B046708.116ON266621731e-15
Smik_16.2558.117ON247571722e-15
Ecym_1383na 3ON381661752e-15
NDAI0B030808.116ON460791752e-15
KLTH0C04884g3.298ON342541733e-15
TPHA0A039103.298ON351581733e-15
CAGL0M01870g3.298ON315581723e-15
TBLA0I020603.298ON833641734e-15
Kpol_1065.483.298ON364701715e-15
ADL051Wna 4ON173531656e-15
SAKL0H20416g8.116ON317571699e-15
KNAG0D022908.116ON435561701e-14
SAKL0H20394g8.117ON359651691e-14
KLLA0A04609gsingletonON423681691e-14
NDAI0B019408.116ON336541672e-14
Ecym_8388na 4ON223661633e-14
KLLA0F11682g3.298ON374541663e-14
NCAS0I014603.298ON330751654e-14
KAFR0C003403.298ON394591655e-14
KNAG0J022503.296ON296571636e-14
ADL042Wna 5ON281781627e-14
Kpol_495.20singletonON486631638e-14
KLTH0H08800g8.117ON168661578e-14
Ecym_8379na 5ON305541629e-14
AEL077Wna 3ON336651621e-13
KNAG0D022808.117ON435601621e-13
TBLA0E039308.116ON462611621e-13
KAFR0B020008.117ON303561611e-13
Kpol_1018.352.531ON517621621e-13
NCAS0B046608.117ON256531582e-13
SAKL0A10648gsingletonON261611573e-13
ADL040Wna 6ON330711575e-13
KAFR0H012903.298ON330581575e-13
NCAS0F009202.531ON354741541e-12
SAKL0D15136gsingletonON271531512e-12
TPHA0A04530singletonON501531523e-12
Kwal_14.22068.117ON254551493e-12
Ecym_4128na 7ON312531504e-12
AGR186Cna 7ON287531494e-12
SAKL0A10582gsingletonON288681486e-12
ADR308Cna 8ON278511486e-12
Ecym_8377na 6ON310911487e-12
NCAS0F00910singletonON350511462e-11
Ecym_8011na 8ON276511452e-11
KLLA0F22319gsingletonON203471389e-11
KLTH0C07172g3.281ON265951391e-10
Ecym_8389singletonON251521381e-10
SAKL0H15488g8.326ON7981031392e-10
Kwal_27.109253.281ON264631345e-10
TBLA0H012608.326ON572971321e-09
KLLA0F01463g1.326ON781591321e-09
KNAG0J008703.281ON280651302e-09
KNAG0I020702.162ON572561312e-09
KNAG0H005502.598ON620581303e-09
TPHA0O014401.326ON778551303e-09
NCAS0H030802.598ON730581293e-09
Smik_10.1841.326ON885551293e-09
KLTH0D08734g2.598ON677781285e-09
NDAI0G058001.326ON836561285e-09
Kwal_14.25431.326ON711541285e-09
ZYRO0G20526g1.326ON849551276e-09
Kwal_26.83512.598ON698781276e-09
ABR089C2.598ON571581277e-09
CAGL0E01331g8.326ON689921277e-09
Suva_6.1321.326ON878551277e-09
Kpol_1072.582.162ON794561278e-09
TBLA0B012802.162ON823561269e-09
Skud_10.1521.326ON879551269e-09
AGL197W8.326ON844571261e-08
SAKL0B11330g2.598ON499811251e-08
TPHA0N014602.598ON519631251e-08
KAFR0A008001.326ON753551251e-08
Ecym_23012.598ON767581251e-08
KNAG0M023102.598ON660691241e-08
ACR264W2.162ON769541242e-08
SAKL0D06776g1.326ON767541242e-08
Ecym_54242.162ON775541242e-08
Kpol_185.32.598ON647581232e-08
NCAS0A129102.598ON822581232e-08
NDAI0B013402.598ON769581233e-08
ZYRO0F01012g2.598ON584721223e-08
KNAG0H011803.281ON2541051223e-08
CAGL0K12078g3.281ON463541223e-08
Ecym_62951.326ON663541223e-08
KNAG0E026101.326ON746551223e-08
KAFR0A023202.598ON443581223e-08
KLTH0H10538g1.326ON682551223e-08
TDEL0B069102.598ON437581223e-08
YJL056C (ZAP1)1.326ON880551223e-08
Kpol_1013.212.598ON494781214e-08
KAFR0F020702.598ON370591214e-08
CAGL0L07480g3.281ON314541214e-08
Kpol_505.152.162ON510571214e-08
SAKL0E10714g2.162ON819561215e-08
Kwal_47.178882.162ON786561206e-08
KNAG0H034802.162ON796561206e-08
KAFR0C04550singletonON467491207e-08
AEL174W1.326ON661551197e-08
KLTH0E09724g2.162ON768561198e-08
ZYRO0F10428g8.326ON813591199e-08
NCAS0A091601.326ON773531191e-07
Skud_5.1373.518ON394601181e-07
KAFR0B045802.162ON729491181e-07
Suva_11.1642.598ON639581181e-07
YBR066C (NRG2)3.281ON220591171e-07
YKL062W (MSN4)2.598ON630581181e-07
Smik_2.1993.281ON220591161e-07
Skud_2.1893.281ON220651161e-07
CAGL0M13189g2.598ON541581181e-07
Skud_11.1672.598ON628581181e-07
Smik_11.1862.598ON641581181e-07
NDAI0C005602.598ON972581171e-07
TPHA0C025802.598ON365581171e-07
Suva_4.3053.281ON220541161e-07
KAFR0H022408.326ON623901171e-07
Suva_2.2003.281ON2321071162e-07
CAGL0J05060g1.326ON713531162e-07
KLLA0F26961g2.598ON694581162e-07
TBLA0F013001.326ON985551162e-07
TDEL0G023302.303ON506531153e-07
NCAS0B069602.162ON839561153e-07
SAKL0D03146g3.281ON157541123e-07
ZYRO0B16148g2.162ON930641153e-07
TDEL0F045108.326ON743501153e-07
Kwal_56.239258.326ON745931153e-07
TDEL0B052502.162ON714561143e-07
Kpol_489.4na 9ON339621143e-07
Kpol_1065.153.281ON220571134e-07
CAGL0F05995g2.598ON597581144e-07
Suva_5.1243.518ON406601144e-07
TBLA0G019202.598ON523581144e-07
KNAG0H019302.303ON618531144e-07
Kpol_1050.193.518ON221531124e-07
Kpol_1031.428.144ON359851135e-07
KLTH0G12254g8.326ON746801136e-07
TDEL0D019501.326ON755551136e-07
CAGL0I02816gsingletonOFF291611126e-07
KNAG0G012808.144ON472711136e-07
Smik_4.3908.326ON708511136e-07
KLLA0E08713g2.303ON596601126e-07
Kpol_344.48.326ON756601127e-07
TBLA0I032803.518ON330531118e-07
CAGL0L03916g2.162ON642561119e-07
YDR146C (SWI5)8.326ON709501119e-07
TPHA0B029102.162ON717561119e-07
TBLA0B060502.303ON762531119e-07
Suva_8.1662.162ON948561119e-07
KLLA0F23782g2.162ON782641111e-06
YOR113W (AZF1)2.162ON914561111e-06
YER130C8.144ON443741101e-06
Suva_13.2062.598ON709751101e-06
Ecym_25368.486ON2401001091e-06
KNAG0D021208.144ON402721101e-06
TDEL0H002807.543ON424541101e-06
TDEL0D058603.518ON330601101e-06
Skud_15.2762.162ON917561101e-06
YDR043C (NRG1)3.281ON231871092e-06
Smik_5.2768.144ON442741092e-06
TPHA0G008202.303ON532531092e-06
Smik_15.2912.162ON909561092e-06
TBLA0A039608.326ON850571092e-06
ADL198W2.303ON547531092e-06
YNL027W (CRZ1)2.303ON678531092e-06
KAFR0H032402.303ON519531092e-06
TPHA0M011803.281ON350541082e-06
TPHA0A039803.281ON314541082e-06
Smik_14.3032.303ON673531082e-06
AFR471C4.80ON389651082e-06
Suva_5.2518.144ON449741082e-06
YMR037C (MSN2)2.598ON704801082e-06
NCAS0G037302.303ON571531082e-06
ZYRO0C13508g3.281ON189601062e-06
Skud_4.2973.281ON231861073e-06
Smik_4.2813.281ON231831073e-06
SAKL0E07216g2.303ON548531073e-06
Skud_14.3012.303ON682531083e-06
KLTH0G10802g2.303ON526531073e-06
Smik_13.2072.598ON703801073e-06
Kpol_1050.116singletonON329561073e-06
Ecym_33412.303ON560531074e-06
Kpol_1052.183.281ON357611074e-06
Suva_14.3182.303ON681531074e-06
Kpol_1003.502.303ON614531074e-06
KLTH0A00682g7.543ON433531064e-06
ZYRO0E08426g3.518ON171601044e-06
Skud_5.2488.144ON442741064e-06
Suva_2.3078.326ON691501064e-06
CAGL0M06831g2.303ON645531064e-06
TBLA0H028302.598ON746581065e-06
Kpol_423.153.518ON392531065e-06
KAFR0C004903.281ON224541055e-06
NDAI0G034208.144ON484951065e-06
NDAI0B042902.162ON1064491065e-06
Skud_13.1932.598ON704581065e-06
KLTH0E06688g8.144ON397591055e-06
KLTH0G01826g3.518ON307531055e-06
NDAI0B019308.144ON436711056e-06
Kwal_23.54007.543ON429531056e-06
Klac_YGOB_Anc_3.5183.518ON239531047e-06
KNAG0A051708.326ON645501057e-06
SAKL0F01980g3.518ON385811048e-06
Kpol_1036.708.326ON674581048e-06
NCAS0A152707.543ON433551049e-06
NDAI0G007202.303ON708531049e-06
YPR186C (PZF1)7.543ON429581049e-06
KAFR0A010903.281ON249541031e-05
SAKL0H11440g8.486ON205811021e-05
CAGL0M04323g8.326ON703501041e-05
Kwal_27.114602.303ON531531031e-05
NCAS0B046008.144ON547711031e-05
KNAG0B005903.518ON439601031e-05
Skud_7.593.518ON383601031e-05
YPL038W (MET31)8.486ON1771051011e-05
KAFR0J003402.533ON218601021e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06798g
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...   226   4e-78
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...   100   2e-27
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       79   7e-20
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               81   1e-18
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    81   1e-18
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    80   1e-18
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    79   4e-18
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    76   4e-18
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    79   4e-18
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               79   7e-18
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             79   9e-18
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    75   2e-17
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    77   2e-17
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    77   2e-17
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    73   5e-17
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    76   6e-17
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    75   1e-16
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    75   1e-16
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    71   2e-16
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    74   2e-16
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    74   2e-16
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     74   4e-16
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    73   4e-16
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    73   4e-16
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    74   5e-16
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    73   6e-16
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    73   6e-16
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    73   7e-16
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    73   7e-16
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    73   1e-15
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    73   1e-15
TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...    73   1e-15
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                72   1e-15
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    71   1e-15
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    71   1e-15
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    72   1e-15
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                71   1e-15
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    71   2e-15
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    72   2e-15
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    72   2e-15
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    71   3e-15
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    71   3e-15
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    71   3e-15
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     71   4e-15
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    70   5e-15
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    68   6e-15
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    70   9e-15
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    70   1e-14
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    70   1e-14
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    70   1e-14
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    69   2e-14
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    67   3e-14
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    69   3e-14
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    68   4e-14
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    68   5e-14
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               67   6e-14
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    67   7e-14
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    67   8e-14
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    65   8e-14
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    67   9e-14
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    67   1e-13
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               67   1e-13
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    67   1e-13
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    67   1e-13
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    67   1e-13
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                65   2e-13
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    65   3e-13
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    65   5e-13
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    65   5e-13
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     64   1e-12
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    63   2e-12
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             63   3e-12
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    62   3e-12
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    62   4e-12
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    62   4e-12
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    62   6e-12
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    62   6e-12
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    62   7e-12
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               61   2e-11
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    60   2e-11
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    58   9e-11
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    58   1e-10
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    58   1e-10
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    58   2e-10
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    56   5e-10
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    55   1e-09
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    55   1e-09
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    55   2e-09
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    55   2e-09
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    55   3e-09
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    55   3e-09
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    54   3e-09
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    54   3e-09
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    54   5e-09
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    54   5e-09
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    54   5e-09
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    54   6e-09
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    54   6e-09
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    54   7e-09
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    54   7e-09
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    54   7e-09
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    54   8e-09
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    53   9e-09
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    53   9e-09
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    53   1e-08
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    53   1e-08
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    53   1e-08
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    53   1e-08
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    53   1e-08
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    52   1e-08
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    52   2e-08
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    52   2e-08
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    52   2e-08
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    52   2e-08
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    52   2e-08
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     52   3e-08
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    52   3e-08
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    52   3e-08
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    52   3e-08
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    52   3e-08
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    52   3e-08
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    52   3e-08
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    52   3e-08
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    52   3e-08
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    52   3e-08
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    51   4e-08
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    51   4e-08
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    51   4e-08
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    51   4e-08
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    51   5e-08
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    51   6e-08
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    51   6e-08
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               51   7e-08
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    50   7e-08
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    50   8e-08
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    50   9e-08
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    50   1e-07
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    50   1e-07
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    50   1e-07
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    50   1e-07
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    50   1e-07
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    50   1e-07
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    49   1e-07
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    49   1e-07
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    50   1e-07
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    50   1e-07
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    50   1e-07
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     50   1e-07
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    50   1e-07
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    49   1e-07
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    50   1e-07
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    49   2e-07
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    49   2e-07
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    49   2e-07
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    49   2e-07
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    49   3e-07
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    49   3e-07
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    48   3e-07
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    49   3e-07
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    49   3e-07
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    49   3e-07
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    49   3e-07
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    49   3e-07
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    48   4e-07
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    49   4e-07
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    49   4e-07
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    49   4e-07
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    49   4e-07
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    48   4e-07
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    48   5e-07
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    48   6e-07
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    48   6e-07
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    48   6e-07
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    48   6e-07
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    48   6e-07
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    48   6e-07
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    48   7e-07
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    47   8e-07
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    47   9e-07
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    47   9e-07
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    47   9e-07
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    47   9e-07
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    47   9e-07
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    47   1e-06
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    47   1e-06
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    47   1e-06
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    47   1e-06
Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON...    47   1e-06
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    47   1e-06
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    47   1e-06
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    47   1e-06
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    47   1e-06
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    47   2e-06
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    47   2e-06
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    47   2e-06
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    47   2e-06
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    47   2e-06
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    47   2e-06
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    47   2e-06
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    47   2e-06
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    46   2e-06
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    46   2e-06
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    46   2e-06
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    46   2e-06
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    46   2e-06
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    46   2e-06
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     46   2e-06
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    45   2e-06
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    46   3e-06
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    46   3e-06
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    46   3e-06
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    46   3e-06
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    46   3e-06
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    46   3e-06
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    46   3e-06
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    46   4e-06
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    46   4e-06
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    46   4e-06
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    46   4e-06
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    45   4e-06
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    45   4e-06
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    45   4e-06
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    45   4e-06
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    45   4e-06
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    45   5e-06
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    45   5e-06
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    45   5e-06
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    45   5e-06
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    45   5e-06
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    45   5e-06
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    45   5e-06
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    45   5e-06
NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144     45   6e-06
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    45   6e-06
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    45   7e-06
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    45   7e-06
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    45   8e-06
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    45   8e-06
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    45   9e-06
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    45   9e-06
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    45   9e-06
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    44   1e-05
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    44   1e-05
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    45   1e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    44   1e-05
NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {O...    44   1e-05
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    44   1e-05
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    44   1e-05
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    44   1e-05
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       44   1e-05
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    44   1e-05
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    44   1e-05
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    44   1e-05
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    44   1e-05
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    44   1e-05
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    44   1e-05
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    44   1e-05
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    44   1e-05
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    44   1e-05
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     44   1e-05
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    44   1e-05
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    44   2e-05
TBLA0F00370 Chr6 (84825..86888) [2064 bp, 687 aa] {ON} Anc_8.144...    44   2e-05
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    44   2e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    44   2e-05
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    44   2e-05
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     44   2e-05
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    44   2e-05
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    44   2e-05
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    44   2e-05
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    44   2e-05
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    43   3e-05
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    43   3e-05
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    43   3e-05
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    43   3e-05
NDAI0D04240 Chr4 complement(993054..996563) [3510 bp, 1169 aa] {...    43   3e-05
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    43   3e-05
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    43   3e-05
NCAS0C02430 Chr3 (453975..454574) [600 bp, 199 aa] {ON} Anc_8.486      43   3e-05
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    43   3e-05
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    43   4e-05
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    43   4e-05
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    43   4e-05
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    43   4e-05
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    43   4e-05
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    43   4e-05
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    42   4e-05
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    42   5e-05
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    42   5e-05
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    42   5e-05
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    42   5e-05
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    42   6e-05
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    42   6e-05
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    42   6e-05
Kpol_472.10 s472 (31069..33561) [2493 bp, 830 aa] {ON} (31069..3...    42   6e-05
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     42   6e-05
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    42   6e-05
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    42   6e-05
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    42   7e-05
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    42   7e-05
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    42   7e-05
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    42   7e-05
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    42   7e-05
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    42   7e-05
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    42   7e-05
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    42   7e-05
AGL246W Chr7 (240857..241540) [684 bp, 227 aa] {ON} Syntenic hom...    42   8e-05
YDR253C Chr4 complement(963990..964565) [576 bp, 191 aa] {ON}  M...    42   8e-05
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    42   8e-05
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    42   9e-05
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    42   9e-05
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    42   9e-05
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    42   9e-05
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  42   1e-04
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    42   1e-04
Smik_6.150 Chr6 complement(248356..250776) [2421 bp, 806 aa] {ON...    42   1e-04
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    42   1e-04
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    42   1e-04
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    41   1e-04
KAFR0H01500 Chr8 (277542..278336) [795 bp, 264 aa] {ON} Anc_8.48...    41   1e-04
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    41   1e-04
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    41   1e-04
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    42   1e-04
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    41   1e-04
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    41   1e-04
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    41   1e-04
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    41   1e-04
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    41   1e-04
Smik_4.500 Chr4 complement(908879..909460) [582 bp, 193 aa] {ON}...    41   1e-04
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    41   1e-04
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    41   2e-04
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    41   2e-04
Suva_7.349 Chr7 complement(598667..601105) [2439 bp, 812 aa] {ON...    41   2e-04
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      41   2e-04
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    41   2e-04
YGR067C Chr7 complement(622372..624786) [2415 bp, 804 aa] {ON} P...    41   2e-04
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    41   2e-04
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    41   2e-04
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    40   2e-04
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    41   2e-04
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    41   2e-04
Skud_7.364 Chr7 complement(609656..612088) [2433 bp, 810 aa] {ON...    41   2e-04
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    40   2e-04
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    40   2e-04
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      40   2e-04
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    41   2e-04
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     40   2e-04
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    40   2e-04
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    40   3e-04
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    40   3e-04
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    40   3e-04
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    39   3e-04
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    40   3e-04
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    40   3e-04
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    40   3e-04
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    40   3e-04
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    40   3e-04
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    40   4e-04
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    40   4e-04
Suva_2.419 Chr2 complement(743569..744144) [576 bp, 191 aa] {ON}...    40   4e-04
ZYRO0F08162g Chr6 complement(660746..661294) [549 bp, 182 aa] {O...    39   4e-04
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      40   4e-04
Skud_4.515 Chr4 complement(918500..919063) [564 bp, 187 aa] {ON}...    39   4e-04
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  40   4e-04
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    39   4e-04
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    40   5e-04
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    39   5e-04
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    39   5e-04
SAKL0H04070g Chr8 (379179..381878) [2700 bp, 899 aa] {ON} some s...    40   5e-04
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    40   5e-04
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    39   6e-04
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    39   6e-04
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    39   6e-04
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    39   6e-04
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    39   6e-04
KAFR0E02900 Chr5 complement(584018..584575) [558 bp, 185 aa] {ON...    39   7e-04
KLLA0B07909g Chr2 (697885..700653) [2769 bp, 922 aa] {ON} some s...    39   7e-04
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    39   7e-04
NDAI0C05210 Chr3 complement(1209022..1209789) [768 bp, 255 aa] {...    39   7e-04
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    39   7e-04
YPL230W Chr16 (115312..116487) [1176 bp, 391 aa] {ON}  USV1Putat...    39   9e-04
ZYRO0A09416g Chr1 (756859..760899) [4041 bp, 1346 aa] {ON} simil...    39   9e-04
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    39   0.001
Smik_6.435 Chr6 complement(707873..709033) [1161 bp, 386 aa] {ON...    39   0.001
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    39   0.001
TPHA0D01050 Chr4 complement(216444..217763) [1320 bp, 439 aa] {O...    39   0.001
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    39   0.001
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    38   0.001
KAFR0C02980 Chr3 (595202..595879) [678 bp, 225 aa] {ON} Anc_8.14...    39   0.001
Kwal_27.11824 s27 complement(959535..960134) [600 bp, 199 aa] {O...    38   0.001
NDAI0E03120 Chr5 (662597..663316) [720 bp, 239 aa] {ON} Anc_8.48...    39   0.001
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    39   0.001
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    39   0.001
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    39   0.001
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    39   0.001
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    38   0.002
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    38   0.002
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    38   0.002
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    38   0.002
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    38   0.002
NCAS0A02310 Chr1 complement(433632..436271) [2640 bp, 879 aa] {O...    38   0.002
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    38   0.002
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    37   0.003
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    37   0.003
KLLA0D11902g Chr4 (1015273..1016142) [870 bp, 289 aa] {ON} some ...    37   0.003
CAGL0E04884g Chr5 complement(469532..474001) [4470 bp, 1489 aa] ...    37   0.003
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    37   0.003
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    37   0.003
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      37   0.003
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    37   0.003
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    37   0.003
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    37   0.004
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      37   0.004
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    37   0.004
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    37   0.004
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    37   0.004
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    37   0.004
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    37   0.005
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    37   0.005
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    37   0.006
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      37   0.006
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    37   0.006
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    37   0.006
TBLA0A00350 Chr1 complement(66653..67588) [936 bp, 311 aa] {ON} ...    37   0.006
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    36   0.006
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    36   0.006
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    37   0.006
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    36   0.007
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    37   0.007
NDAI0F01400 Chr6 (347938..349122) [1185 bp, 394 aa] {ON} Anc_6.256     36   0.007
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    36   0.007
TDEL0B01500 Chr2 (265906..266292) [387 bp, 128 aa] {ON} Anc_8.48...    35   0.008
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    36   0.008
Ecym_2760 Chr2 complement(1473533..1476349) [2817 bp, 938 aa] {O...    36   0.008
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    36   0.009
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      36   0.010
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    36   0.010
TBLA0I01480 Chr9 (321045..322586) [1542 bp, 513 aa] {ON} Anc_2.5...    36   0.010
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    36   0.010
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    36   0.010
KNAG0F01710 Chr6 (320407..321648) [1242 bp, 413 aa] {ON} Anc_6.2...    36   0.011
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      35   0.011
SAKL0G16434g Chr7 (1423039..1423932) [894 bp, 297 aa] {ON} some ...    35   0.011
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    35   0.012
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    35   0.012
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    36   0.012
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    35   0.012
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    36   0.012
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    35   0.013
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    35   0.013
KAFR0A07120 Chr1 complement(1435398..1436345) [948 bp, 315 aa] {...    35   0.014
KNAG0A02260 Chr1 (205510..206118) [609 bp, 202 aa] {ON} Anc_8.48...    35   0.014
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    35   0.014
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    35   0.014
KNAG0D02220 Chr4 (378969..382589) [3621 bp, 1206 aa] {ON} Anc_8....    35   0.015
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    35   0.016
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    35   0.016
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    35   0.016
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    35   0.016
NCAS0D03910 Chr4 (729305..730255) [951 bp, 316 aa] {ON} Anc_6.256      35   0.017
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    35   0.018
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                35   0.019
CAGL0E06116g Chr5 complement(604945..606786) [1842 bp, 613 aa] {...    35   0.023
KAFR0B02050 Chr2 complement(402767..405958) [3192 bp, 1063 aa] {...    35   0.024
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    35   0.026
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    35   0.026
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    35   0.028
AFR531W Chr6 (1389929..1390753) [825 bp, 274 aa] {ON} Unclear if...    34   0.032
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    34   0.035
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    34   0.036
KNAG0D00900 Chr4 (144302..145270) [969 bp, 322 aa] {ON} Anc_6.25...    34   0.037
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    34   0.038
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    34   0.038
Kpol_1031.73 s1031 complement(186968..187513) [546 bp, 181 aa] {...    34   0.039
KAFR0E04270 Chr5 complement(859635..863402) [3768 bp, 1255 aa] {...    34   0.042
NCAS0B04500 Chr2 (815788..819411) [3624 bp, 1207 aa] {ON} Anc_8....    34   0.044
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    34   0.045
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    34   0.046
NDAI0J02850 Chr10 complement(707859..712472) [4614 bp, 1537 aa] ...    34   0.046
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    34   0.049
AGR172W Chr7 (1071485..1074658) [3174 bp, 1057 aa] {ON} Syntenic...    34   0.050
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    34   0.052
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                33   0.057
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    34   0.058
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    33   0.060
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    33   0.066
CAGL0L11880g Chr12 (1274920..1277862) [2943 bp, 980 aa] {ON} som...    33   0.067
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    33   0.068
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    33   0.073
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    33   0.075
TDEL0F01030 Chr6 (182054..185287) [3234 bp, 1077 aa] {ON} Anc_8....    33   0.077
TPHA0L01320 Chr12 complement(275431..275937) [507 bp, 168 aa] {O...    33   0.081
Smik_16.263 Chr16 complement(479612..482980) [3369 bp, 1122 aa] ...    33   0.085
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 33   0.093
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    33   0.095
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    33   0.10 
TDEL0F05500 Chr6 (1024045..1027668) [3624 bp, 1207 aa] {ON} Anc_...    33   0.11 
KNAG0A04030 Chr1 (542889..543515) [627 bp, 208 aa] {ON} Anc_8.48...    33   0.12 
AFL136W Chr6 (178780..180009) [1230 bp, 409 aa] {ON} Syntenic ho...    33   0.13 
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    32   0.15 
YDR463W Chr4 (1386816..1388375) [1560 bp, 519 aa] {ON}  STP1Tran...    32   0.15 
TBLA0D02300 Chr4 (581398..584553) [3156 bp, 1051 aa] {ON} Anc_8....    32   0.16 
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    32   0.19 
CAGL0G08107g Chr7 (768772..770649) [1878 bp, 625 aa] {ON} weakly...    32   0.19 
KLLA0C16005g Chr3 (1397274..1398269) [996 bp, 331 aa] {ON} some ...    32   0.19 
KLLA0E13487g Chr5 complement(1190615..1191307) [693 bp, 230 aa] ...    32   0.22 
KNAG0B03350 Chr2 complement(647618..649420) [1803 bp, 600 aa] {O...    32   0.23 
Kpol_472.3 s472 complement(4365..5300) [936 bp, 311 aa] {ON} com...    32   0.23 
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    32   0.24 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    32   0.26 
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    32   0.28 
YPR022C Chr16 complement(603911..607312) [3402 bp, 1133 aa] {ON}...    32   0.29 
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    32   0.30 
Kwal_56.23453 s56 complement(545262..547748) [2487 bp, 828 aa] {...    32   0.32 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    32   0.33 
NCAS0C05820 Chr3 complement(1197669..1199426) [1758 bp, 585 aa] ...    32   0.35 
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    32   0.36 
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...    32   0.37 
KAFR0A02380 Chr1 complement(493691..496393) [2703 bp, 900 aa] {O...    31   0.41 
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    31   0.41 
ZYRO0B11770g Chr2 (932841..935444) [2604 bp, 867 aa] {ON} simila...    31   0.43 
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    31   0.43 
CAGL0L00583g Chr12 (71544..72710) [1167 bp, 388 aa] {ON} similar...    31   0.45 
TDEL0A01300 Chr1 complement(225813..228326) [2514 bp, 837 aa] {O...    31   0.46 
KNAG0G01870 Chr7 (417774..420401) [2628 bp, 875 aa] {ON} Anc_8.2...    31   0.51 
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    31   0.53 
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    31   0.55 
NDAI0B02250 Chr2 (559530..563000) [3471 bp, 1156 aa] {ON} Anc_8....    31   0.55 
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    31   0.57 
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    29   0.61 
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    31   0.61 
Suva_16.349 Chr16 complement(610937..612562) [1626 bp, 541 aa] {...    31   0.63 
SAKL0H24464g Chr8 complement(2118553..2121405) [2853 bp, 950 aa]...    31   0.67 
Ecym_3520 Chr3 complement(980315..982774) [2460 bp, 819 aa] {ON}...    30   0.75 
TPHA0A01940 Chr1 complement(391362..394100) [2739 bp, 912 aa] {O...    30   0.82 
Kpol_1032.52 s1032 (118186..120660) [2475 bp, 824 aa] {ON} (1181...    30   0.86 
SAKL0H17842g Chr8 complement(1584215..1586659) [2445 bp, 814 aa]...    30   0.94 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    30   0.95 
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    30   1.0  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    30   1.0  
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    30   1.4  
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    30   1.4  
TDEL0E01860 Chr5 (353978..354790) [813 bp, 270 aa] {ON} Anc_4.18...    30   1.4  
ZYRO0A12936g Chr1 complement(1023335..1024135) [801 bp, 266 aa] ...    30   1.4  
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    30   1.5  
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    30   1.6  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      29   1.6  
AGR117C Chr7 complement(964411..966810) [2400 bp, 799 aa] {ON} S...    30   1.7  
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    29   1.9  
KLTH0G14454g Chr7 (1263253..1265751) [2499 bp, 832 aa] {ON} some...    29   1.9  
KAFR0B02550 Chr2 (507752..510424) [2673 bp, 890 aa] {ON} Anc_8.2...    29   1.9  
KLLA0C17710g Chr3 (1569331..1571796) [2466 bp, 821 aa] {ON} simi...    29   2.2  
Skud_16.307 Chr16 complement(568219..570672,570703..571623) [337...    29   2.3  
TBLA0A08390 Chr1 (2064300..2066756) [2457 bp, 818 aa] {ON} Anc_4...    29   2.3  
KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {O...    28   2.6  
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    29   2.6  
KLTH0E09922g Chr5 (894838..898197) [3360 bp, 1119 aa] {ON} weakl...    29   2.6  
NCAS0B04840 Chr2 (882270..884864) [2595 bp, 864 aa] {ON} Anc_8.234     29   3.1  
TPHA0B00710 Chr2 complement(160987..162735) [1749 bp, 582 aa] {O...    28   3.5  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    28   4.0  
Smik_5.341 Chr5 (522964..525360) [2397 bp, 798 aa] {ON} YER169W ...    28   4.0  
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...    28   4.2  
TPHA0C01760 Chr3 (402424..402939) [516 bp, 171 aa] {ON} Anc_8.48...    28   4.3  
Skud_5.308 Chr5 (508459..510867) [2409 bp, 802 aa] {ON} YER169W ...    28   4.3  
AER071W Chr5 (767038..768891) [1854 bp, 617 aa] {ON} Syntenic ho...    28   4.3  
YER169W Chr5 (523369..525759) [2391 bp, 796 aa] {ON}  RPH1JmjC d...    28   4.4  
KAFR0F03940 Chr6 complement(769153..770511) [1359 bp, 452 aa] {O...    28   4.4  
Suva_5.303 Chr5 (491206..492999,493030..493629) [2394 bp, 797 aa...    28   4.6  
NCAS0H02890 Chr8 complement(564830..566428) [1599 bp, 532 aa] {O...    28   5.3  
Kpol_388.8 s388 (25278..26939) [1662 bp, 553 aa] {ON} (25278..26...    28   5.3  
TDEL0E01050 Chr5 complement(214937..216859) [1923 bp, 640 aa] {O...    28   5.6  
YGR044C Chr7 complement(582990..583892) [903 bp, 300 aa] {ON}  R...    28   6.2  
YLR436C Chr12 complement(1007421..1011245) [3825 bp, 1274 aa] {O...    28   6.3  
TBLA0F03830 Chr6 (947034..949937) [2904 bp, 967 aa] {ON} Anc_8.2...    28   6.5  
Skud_7.342 Chr7 complement(570256..571143) [888 bp, 295 aa] {ON}...    28   6.9  
Skud_7.354 Chr7 (588967..591741) [2775 bp, 924 aa] {ON} YGR056W ...    27   8.3  
Suva_2.639 Chr2 (1139039..1140589) [1551 bp, 516 aa] {ON} YDR463...    27   8.5  
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    27   9.1  
Kwal_47.18337 s47 complement(787992..789602) [1611 bp, 536 aa] {...    27   9.1  

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score =  226 bits (577), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 111/111 (100%), Positives = 111/111 (100%)

Query: 1   MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTR 60
           MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTR
Sbjct: 1   MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTR 60

Query: 61  SSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRRGST 111
           SSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRRGST
Sbjct: 61  SSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRRGST 111

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score =  100 bits (250), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 53/64 (82%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLR 107
           +YQC  CLK+F+RSSALQ+H+L HTG RPF CP +SCSK+FNVKSNM RH KTHKQ  +R
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQPEVR 186

Query: 108 RGST 111
           R ST
Sbjct: 187 RSST 190

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 79.0 bits (193), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (80%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           QC  C K+ TRSS+LQ+H+LVHTGDRPF C   +C K+FNVKSNMNRH+K H
Sbjct: 41  QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLH 92

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 52/84 (61%), Gaps = 6/84 (7%)

Query: 34  PSAVPTPAEAPK------LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKS 87
           PS +PTPA           LR QC  C K+ +R S L++H L+HTGD PF CP   C+KS
Sbjct: 277 PSGLPTPATIQSNLSLAIRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKS 336

Query: 88  FNVKSNMNRHFKTHKQLGLRRGST 111
           FNVKSNM RHFK+H++    +  T
Sbjct: 337 FNVKSNMLRHFKSHEKKAASKKET 360

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 45/56 (80%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           QC +C KVF+RSS+LQ+H LVHTGDRPF C   SC K+FNVKSNM RH++ H++ G
Sbjct: 382 QCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKRG 437

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 55/90 (61%), Gaps = 4/90 (4%)

Query: 16  ILGLPRHSSAPLTSAPQ----RPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVH 71
           IL +P  SS+    +P+    R S + +   A  L RY CS C K F R+S+L++H  +H
Sbjct: 170 ILSIPTDSSSSAAVSPRVTGRRTSVLSSNNVASNLHRYICSDCGKGFARASSLRTHRNIH 229

Query: 72  TGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           TGDRPF CP  +C KSFN +SNM RH K H
Sbjct: 230 TGDRPFTCPFKNCGKSFNARSNMLRHHKLH 259

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 79.0 bits (193), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 42/57 (73%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           RY CS C K F R S+L +H+  HTGD+P+ CPH SCSK FN +SNM RH+KTH +L
Sbjct: 236 RYGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKTHFKL 292

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 76.3 bits (186), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 5   PASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKL-----LRYQCSRCLKVFT 59
           PA    AGP   + +    +      P      P P + P L     LR QC  C KV +
Sbjct: 52  PAGMPLAGPPPRMVVAPQMATATRVMPTHVQVAPGPVQGPVLNQAVRLRKQCPVCGKVCS 111

Query: 60  RSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           R S L++H L+HTGD PF C   +C+KSFNVKSNM RH K+H++
Sbjct: 112 RPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLKSHER 155

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 79.3 bits (194), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 44/58 (75%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           ++Y CS C K F R S+L +H+ +HTG++PF CP ++C+KSFN KSNM RH+K H +L
Sbjct: 303 IKYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFKL 360

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 78.6 bits (192), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (73%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           LR QC  C K+ +R S L++H L+HTGD PF CP  SC+KSFNVKSNM RH K+H++ G 
Sbjct: 268 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGA 327

Query: 107 R 107
           +
Sbjct: 328 K 328

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 79.0 bits (193), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 2/57 (3%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH--KQL 104
           QC  C K  TR+S LQ+H+LVHTGDRPF C  S C K FNVKSNMNRH+K H  KQL
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQL 548

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 75.1 bits (183), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 56/101 (55%), Gaps = 9/101 (8%)

Query: 9   SWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHI 68
           S A    +L +P    + LTSA   P  +P       L    C  CLK FTR ++L +H+
Sbjct: 78  STANSHRLLDVPSGPCSSLTSATTSP--IP-------LTDKTCPVCLKEFTRKTSLNTHL 128

Query: 69  LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRRG 109
           L+H   RP+ C +  C K+FNVKSN+NRH K HK+  L+ G
Sbjct: 129 LIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQELKGG 169

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 48/67 (71%), Gaps = 2/67 (2%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH--KQ 103
           LLR QC  C K+ +R + L++H+L+HTGD PF CP  +C KSFNVKSNM RH K+H  KQ
Sbjct: 146 LLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQ 205

Query: 104 LGLRRGS 110
           + L + +
Sbjct: 206 VKLAKKT 212

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 47/72 (65%), Gaps = 6/72 (8%)

Query: 37  VPTPAEA------PKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           +PTPA+          LR QC  C K+ +R S L++H ++HTGD PF CP   C+KSFNV
Sbjct: 437 IPTPAKIQSNLTLATKLRKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNV 496

Query: 91  KSNMNRHFKTHK 102
           KSNM RH K+HK
Sbjct: 497 KSNMFRHLKSHK 508

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 72.8 bits (177), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 7/76 (9%)

Query: 34  PSAVPTPAEAPKLLR-------YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSK 86
           P+A P+P  +P  L          C  CLK FTR ++L +H+L+H   RP++C +++C+K
Sbjct: 54  PAARPSPFGSPPALSPLMALNSKTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNK 113

Query: 87  SFNVKSNMNRHFKTHK 102
           SFNVKSN+NRH + H+
Sbjct: 114 SFNVKSNLNRHLRIHR 129

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 76.3 bits (186), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 46/66 (69%)

Query: 40  PAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFK 99
           P+ + ++ +Y C  C K F R S+L +H+ +HTG++P+VCP+  C KSFN KSNM RH+K
Sbjct: 249 PSISEEIAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYK 308

Query: 100 THKQLG 105
            H +L 
Sbjct: 309 LHFKLN 314

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query: 39  TPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHF 98
           T A   K  +Y+C +C K F R S+L +H+ +HTGD+PFVCP  +C K+FN KSNM RH 
Sbjct: 225 TSAHRQKFPKYECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHH 284

Query: 99  KTH 101
           K H
Sbjct: 285 KLH 287

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + QC  C KV TR+S+LQ+H+L+HTG RPF C    C K+FNVKSNMNRH K H
Sbjct: 446 KKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH 499

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 71.2 bits (173), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           LR QC  C K+ +R S L++H L+HTGD PF C   +C KSFNVKSNM RH K+H+
Sbjct: 64  LRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSHE 119

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (58%), Gaps = 10/92 (10%)

Query: 11  AGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILV 70
           +G +HI    RH ++P T        V   A     +   C++C K FTR SAL++H+LV
Sbjct: 204 SGKQHISYAQRHHNSPTT-------VVKGKANGKADI---CAQCGKQFTRPSALRTHMLV 253

Query: 71  HTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           H+GD+PF C    C+K FNVKSN+ RH K HK
Sbjct: 254 HSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 48/86 (55%), Gaps = 15/86 (17%)

Query: 16  ILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDR 75
           +LG PR S      APQR               Y C+ C K F R+S+L++H  +HTGDR
Sbjct: 165 VLGPPRLSPPVQNKAPQR---------------YVCTECGKGFARASSLRTHRNIHTGDR 209

Query: 76  PFVCPHSSCSKSFNVKSNMNRHFKTH 101
           PF CP  +C KSFN +SNM RH K H
Sbjct: 210 PFTCPFKNCGKSFNARSNMLRHHKLH 235

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 73.9 bits (180), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 44/61 (72%)

Query: 44  PKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           PK  +Y C  C K F R S+L++H+ +HTG +P++CP+++C K FN KSNM RHFK H +
Sbjct: 410 PKNFKYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHYR 469

Query: 104 L 104
           L
Sbjct: 470 L 470

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 34/57 (59%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C KV +R S L++H L+HTGD PF C    CSKSFNVKSNM RH +TH++
Sbjct: 183 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQK 239

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 73.2 bits (178), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (67%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           RY C++C KVF R S+L +H   HTGD+P+ CP  +C K FN +SNM RH+K H +  +
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFKTDI 255

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 73.9 bits (180), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 39/54 (72%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + QC  C K  TRSS+L  H+ VHTGDRP++C    C K+FNVKSNMNRH+K H
Sbjct: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLH 387

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 73.2 bits (178), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 39/56 (69%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           LR QC  C KV +R S L++H L+HTGD PF CP   C K+FNVKSNM RH K H+
Sbjct: 283 LRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHE 338

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 72.8 bits (177), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C K+ +R S L++H L+HTGD PF C    CSKSFNVKSNM RH K+H++
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHER 308

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 72.8 bits (177), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C K+ +R S L++H L+HTGD PF C    CSKSFNVKSNM RH K+H++
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHER 308

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 72.8 bits (177), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C K+ +R S L++H L+HTGD PF C    CSKSFNVKSNM RH K+H++
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHER 308

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (69%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           LR QC  C K+ +R S L++H L+HTGD PF C    CSKSFNVKSNM RH K+H++  +
Sbjct: 338 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLKSHERRLI 397

Query: 107 RRG 109
           ++ 
Sbjct: 398 KKN 400

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/62 (51%), Positives = 43/62 (69%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           LR QC  C K+ +R S L++HIL+HTGD PF C    C K+FNVKSN+ RH K+H++  L
Sbjct: 282 LRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNSL 341

Query: 107 RR 108
            +
Sbjct: 342 NK 343

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           K+ R+QC  C K+ TRSS+LQ+H+ VHT  RPF C   +C K+FNVKSN+NRH K H
Sbjct: 377 KVARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QCS C KV +R S L++H L+HTGD PF C    C K+FNVKSNM RH K+H++
Sbjct: 207 LRKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSHER 263

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C KV +R S L++H L+HTGD PF C    C+KSFNVKSNM RH +TH++
Sbjct: 185 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 241

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C KV +R S L++H L+HTGD PF C    C+KSFNVKSNM RH +TH++
Sbjct: 183 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 72.0 bits (175), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C K+ +R S L++H L+HTGD PF C    C+KSFNVKSNM RH K+H++
Sbjct: 252 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (70%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           LR QC  C K+ +R S L++H L+HTGD PF C   +C+K+FNVKSNM RH K H++  +
Sbjct: 198 LRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVI 257

Query: 107 RR 108
           ++
Sbjct: 258 KK 259

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 70.9 bits (172), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 41/57 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           LR QC  C KV +R S L++H L+HTGD PF C    C+KSFNVKSNM RH +TH++
Sbjct: 183 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQK 239

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 37  VPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNR 96
           +PTP +  K +R QC  C KV  R S+L++H+ +HTG RPF+C    C K FNVKSNM R
Sbjct: 284 LPTPNKRRKCVRNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVR 343

Query: 97  HFKTHK 102
           H++ H+
Sbjct: 344 HYRLHQ 349

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 49/79 (62%)

Query: 23  SSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS 82
           ++ PL++       +    +   + R QC  C K+ TR ++LQ+H+L+H+G RP+ C   
Sbjct: 362 TTEPLSNDVLETERLKLMLDLSTIRRRQCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWP 421

Query: 83  SCSKSFNVKSNMNRHFKTH 101
           +C K FNVKSNMNRH+K H
Sbjct: 422 ACEKMFNVKSNMNRHYKIH 440

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 36/54 (66%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           RY C+ C K F R S+L +H   HTGD+PF CP  +C K FN +SNM RH+K H
Sbjct: 237 RYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKLH 290

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 71.2 bits (173), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 43/58 (74%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           ++Y C+ C K F R S+L +H+ +HTG +P+ CPH SCSK+FN KSNM RH+K H +L
Sbjct: 268 IKYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFKL 325

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 70.9 bits (172), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++ C  CLK F R S+L +H+ +HTG++P+ CP  +C+KSFN KSNM RH+K H +L 
Sbjct: 172 KFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFKLS 229

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 71.2 bits (173), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 44/64 (68%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           KL + +C  CLK F R S+L++H+ +HTG +PF CP   C KSFN +SNM RH+K H ++
Sbjct: 710 KLTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKLHFKI 769

Query: 105 GLRR 108
           G  R
Sbjct: 770 GNNR 773

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 70.5 bits (171), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVK 91
           +R S   T + A + ++Y C  C K F R S+L +H  +HTG++P+ CP + C K+FN K
Sbjct: 259 KRMSHQNTSSLAYQQMKYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAK 318

Query: 92  SNMNRHFKTH 101
           SNM RH+K H
Sbjct: 319 SNMLRHYKLH 328

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 68.2 bits (165), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 42/53 (79%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C+ C K FTR ++LQ+H+L+HT  +P+ CP+ +C+K+FNVKSN+ RH + HK+
Sbjct: 118 CAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 69.7 bits (169), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 43/57 (75%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           L+ QC  C K+ +R S L++H L+HTG  PF CP  +C+KSFNVKSNM RH+K+H++
Sbjct: 256 LKRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHER 312

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 70.1 bits (170), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           +R QC  C KV +R S L++H L+HTGD PF C    C+KSFNVKSN+ RH K+H+
Sbjct: 368 MRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLKSHE 423

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 39  TPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHF 98
           TP E   L R QC  C KV +R S L++H+LVHTG +P+ C    C++SFNVKSNM RH+
Sbjct: 276 TPNEK-NLARNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHY 334

Query: 99  KTHKQ 103
           K H++
Sbjct: 335 KNHEK 339

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 69.7 bits (169), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 46/68 (67%)

Query: 35  SAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNM 94
           +A+P    +  L + QC  C ++ +R S LQ+H+ +HTGD+P+ CP  +C K FNVKSNM
Sbjct: 327 NAMPINDSSLPLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNM 386

Query: 95  NRHFKTHK 102
            RH+K H+
Sbjct: 387 LRHYKRHE 394

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 68.9 bits (167), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 39/54 (72%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           QC  C K+ +R S L++H L+H+GD PF C    C+K+FNVKSNM RHFK H++
Sbjct: 256 QCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEK 309

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%)

Query: 43  APKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
            PK +   C  CLK FTR ++LQ+H+L+HT  +P+ C +  C+K+FNVKSN+ RH + HK
Sbjct: 153 VPKGVGKTCHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIHK 212

Query: 103 QLGLRR 108
           +   R+
Sbjct: 213 RNNSRQ 218

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y+C+ C K F R S+L +H+ +HTGD+P+ C + +C K FN KSNM RH+K H
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLH 356

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 30  APQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFN 89
           +P     V T A   KL  Y C  C K F R S+L++H  + +G+RP+ CP+S+C+KSFN
Sbjct: 221 SPGHKVEVETSAFDEKL-GYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFN 279

Query: 90  VKSNMNRHFKTHKQL 104
            KSNM RH+K H +L
Sbjct: 280 AKSNMLRHYKLHFRL 294

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 68.2 bits (165), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 41/59 (69%)

Query: 47  LRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++Y C  C K F R S+L +H+ +HTG +P+ CP S+C KSFN KSNM RH+K H +L 
Sbjct: 276 VKYCCKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFKLS 334

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 67.4 bits (163), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 41/57 (71%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +++C  C K F R S+L +H  +HTG +P+VCP+ +C KSFN KSNM RH+K H +L
Sbjct: 207 KFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFKL 263

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 67.0 bits (162), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 44/78 (56%)

Query: 26  PLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCS 85
           PL ++P      P    A K     C  C K F R SAL++H++VH  D+P+ C H  C 
Sbjct: 202 PLLNSPLHTRKNPYRGSAYKKNGSVCEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQ 261

Query: 86  KSFNVKSNMNRHFKTHKQ 103
           K FNVKSNM RH + HK+
Sbjct: 262 KRFNVKSNMLRHMRKHKE 279

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 67.4 bits (163), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH--KQLGL 106
           Y+CS C K  TR+ +L +H+L+HT  RP+ C   +C K+FNVKSN+NRH K H  KQ   
Sbjct: 424 YECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLKKQKNS 483

Query: 107 RRG 109
            +G
Sbjct: 484 NKG 486

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 65.1 bits (157), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 39  TPAEAP-KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
            PA AP     ++C  C K F+R S L +H L+HTG +PFVC    C K FNVKSN+ RH
Sbjct: 100 VPARAPPSATLHECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRH 159

Query: 98  FKTHKQ 103
            K H +
Sbjct: 160 KKIHDK 165

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 67.0 bits (162), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 37/54 (68%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           C  C K F R SAL++H++VH  D+P+ C H  C K FNVKSNM RH + HK++
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMRKHKEV 304

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 44/65 (67%), Gaps = 3/65 (4%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           K +R QC  C KV  R S+L++H+ +HTG RPF+C    C K FNVKSNM RH++ H+  
Sbjct: 270 KGVRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQ-- 327

Query: 105 GLRRG 109
            L+RG
Sbjct: 328 -LQRG 331

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (61%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRRG 109
           QC  C K+ +R S L++H  +HTGD PF C   +C +SFNVKSNM RH K H +     G
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAKKAAESG 412

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%)

Query: 43  APKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           A  L   QC  C KV +R S L++H L+HTGD P+ C   +C+KSFNVKSNM RH K H+
Sbjct: 349 ATTLSGKQCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHE 408

Query: 103 Q 103
           +
Sbjct: 409 K 409

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 66.6 bits (161), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 40/56 (71%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           R +C  C K+ +R S L++H L+HTGD PF C  S C K+FNVKSNM RH K+H++
Sbjct: 230 RKKCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSHEK 285

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 67.0 bits (162), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%)

Query: 40  PAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFK 99
           P +  K + YQC  C K  +R+S+L SH+ +HT  RP+ C    C+K+FNVKSN+NRH K
Sbjct: 449 PNKEKKQVSYQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTK 508

Query: 100 TH 101
            H
Sbjct: 509 LH 510

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 37/53 (69%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           +C  C K+ +R S L++H L+HTGD PF C +  C KSFNVKSNM RH K H+
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHE 248

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 38/61 (62%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           Y C  C KVF R SAL++H ++H G  P++C    C+K FNVKSN+ RH K+H   G   
Sbjct: 199 YSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVKSHYGRGGAH 258

Query: 109 G 109
           G
Sbjct: 259 G 259

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 65.1 bits (157), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 7/71 (9%)

Query: 37  VPTPAEAPKLLRYQ----CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKS 92
           +  PA +P   RY+    C  C +  TR S L++H+L+HTG+ PF C    CSK FNV+S
Sbjct: 245 IVGPAASP---RYETNKTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRS 301

Query: 93  NMNRHFKTHKQ 103
           NMNRH  +HK+
Sbjct: 302 NMNRHVNSHKR 312

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 65.1 bits (157), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (68%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           +Y C+ C K F R S+L +H  +HTG +PF CP + C+K+FN +SNM RH+K H +L 
Sbjct: 232 KYCCNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFKLA 289

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 1/74 (1%)

Query: 29  SAPQRPSAVPTPAEAPKLLR-YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKS 87
             P  P +   P+   K  R ++C  C K+ TRS++L+SH+L+HTG++P+ C   +C  S
Sbjct: 275 DEPTTPKSTSRPSREKKPARIHKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTS 334

Query: 88  FNVKSNMNRHFKTH 101
            +VKSN+ RH+K+H
Sbjct: 335 SSVKSNITRHYKSH 348

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (69%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C +C K F R S L++H+++H G  PF C   +CSK FNVKSN+ RH+++H
Sbjct: 216 YCCPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSH 268

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 63.2 bits (152), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/53 (50%), Positives = 38/53 (71%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +QC  C +V TRS +L +H+LVHT D+PF C    C K+F++KSN++RH K H
Sbjct: 426 HQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIH 478

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 62.0 bits (149), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++C  C K F+R S L +H L+HTG +P+ C   +C K FNVKSN+ RH K H +
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C  C K FTR S LQ H+L+HT  +PF C  S C K FNVKSN+NRH + H+Q
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKC--SFCEKEFNVKSNLNRHERIHRQ 223

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C  C K FTR S LQ H+L+HT  +PF C  S C K FNVKSN+NRH + H+Q
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKC--SFCDKEFNVKSNLNRHERIHRQ 219

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 42/68 (61%), Gaps = 2/68 (2%)

Query: 38  PTPAEAPK--LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
           P  +EAP    L++ C  C K F R SAL++H ++H G  P+ C  + CSK FNVK N+ 
Sbjct: 205 PVVSEAPARPKLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLL 264

Query: 96  RHFKTHKQ 103
           RH++ H +
Sbjct: 265 RHYRIHTK 272

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 34/51 (66%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C  C +   R S L++H+L HTG RPF C H  CSKSFNV+SNM RH + H
Sbjct: 206 CKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLH 256

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 22  HSSAPLTSAPQRPSAVPTPAEAPKLLRYQ----CSRCLKVFTRSSALQSHILVHTGDRPF 77
           H  A +      PS    P   P    Y     C+ C +  TR S L++H+L+HTG+ PF
Sbjct: 197 HYQATIERLQPTPSLSTNPRSVPNWRDYDPKKTCTVCGRHCTRPSTLKTHMLIHTGELPF 256

Query: 78  VCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
            C    C K FNV+SNM RH  +HK+  +++
Sbjct: 257 ECNWPGCRKRFNVRSNMKRHLNSHKRKLIKK 287

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 37/51 (72%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C  C K  TRS++L++H+L+HTG RPF C   +C  S +VKSN+ RHFK+H
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSH 337

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 60.5 bits (145), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 34/51 (66%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C  C +   R S L++H+L HTG RPF C H  C+KSFNV+SNM RH + H
Sbjct: 215 CKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLH 265

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 57.8 bits (138), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%)

Query: 56  KVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           K F+R S L++HI+VH+  +PF C +  C+KS+NVKSN+ RH K HK
Sbjct: 153 KEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 48/95 (50%)

Query: 7   SPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQS 66
           SP+ A        PR +SA  ++   RP+     +   +  RY C  C+K FT S  L  
Sbjct: 160 SPATAPAAGETSAPRPASAMSSATTSRPTGKRARSPIEQRRRYVCKTCVKGFTTSGHLAR 219

Query: 67  HILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           H  +HTG++  VCPH  C + F+   N  +H+KTH
Sbjct: 220 HNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYKTH 254

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           C  C K FTR  ++  H++VHT  +P+ C +  C K FNVK N+ RH K HK
Sbjct: 157 CPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVKGNLQRHSKCHK 208

>SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} similar
           to uniprot|P21192 Saccharomyces cerevisiae YLR131C ACE2
           Transcription factor that activates expression of early
           G1-specific genes localizes to daughter cell nuclei
           after cytokinesis and delays G1 progression in daughters
           localization is regulated by phosphorylation potential
           Cdc28p substrate
          Length = 798

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 11/103 (10%)

Query: 10  WAGPEHILGLPRHSSAPLTSAPQRPSAVPT---PAEAPKLLR------YQCS--RCLKVF 58
           + G +H+L    H    +  +P + +  PT   P E  + +R      +QC    C K F
Sbjct: 569 FEGSKHLLSNSDHGHVHINGSPIKITRKPTTLPPGEIDRYVRELPDKTFQCMYPDCNKTF 628

Query: 59  TRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            R   ++SHI  H  DRP+VC +  C+K+F    ++ RH KTH
Sbjct: 629 RRRYNIRSHIQTHLEDRPYVCDYEGCTKAFVRNHDLIRHKKTH 671

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLR 107
           RY C  C+K FT S  L  H  +HTG++  VCPH  C + F+   N  +H+KTH    LR
Sbjct: 200 RYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTH----LR 255

Query: 108 RGS 110
           R +
Sbjct: 256 RNT 258

>TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.326
           YLR131C
          Length = 572

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 15  HILGLPRHSSAPLTSAPQRPSAVPTPA------EAPKLLRYQCSR--CLKVFTRSSALQS 66
           H+ G+P       + A ++ S +P  A      E P  L ++C    C K+F R   ++S
Sbjct: 383 HVTGIPGTGGNSPSRASRKLSTLPQGAIDQYVREIPDRL-FECIYPGCHKIFKRRYNIRS 441

Query: 67  HILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           HI  H  DRP+VC H  C+K+F    ++ RH KTH +
Sbjct: 442 HIQTHLEDRPYVCDHEGCTKAFVRNHDLLRHKKTHAE 478

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 2/59 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLR 107
           ++C  C K ++ SS+L+ HI  HTG++P  CP   C+K FN  SN+ +H +THK+   R
Sbjct: 720 FKCHLCPKSYSTSSSLRIHIRTHTGEKPLSCP--ICNKRFNESSNLAKHIRTHKRENCR 776

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C+ C K F     L  H+ VH+G+RPF C    C KS++  S++  H +TH
Sbjct: 692 FRCAECGKCFNTQDILTQHLRVHSGERPFKC--HLCPKSYSTSSSLRIHIRTH 742

 Score = 38.5 bits (88), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 46  LLRYQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           L  Y+C    C KVF +   L  H+ VH+  +PF C  + C K FN +  + +H + H
Sbjct: 659 LSSYKCEWEGCNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVH 714

 Score = 29.6 bits (65), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%)

Query: 42  EAPKLLRYQCSRCLKVFTRSSALQSHI---LVHTGDRPFVCPHSSCSKSFNVKSNMNRHF 98
           E P+    + + C K F  + +L  HI    V +G   + C    C+K F  K  + RH 
Sbjct: 624 EEPQSCICKWAGCNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHL 683

Query: 99  KTHKQ 103
           K H +
Sbjct: 684 KVHSK 688

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 54.7 bits (130), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 3/65 (4%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH---KQL 104
           ++QC  C   FT S  L  H  +HTG++ +VCPH SC + F+   N  +H++TH   KQ 
Sbjct: 211 KFQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYRTHLKKKQR 270

Query: 105 GLRRG 109
             ++G
Sbjct: 271 QAKKG 275

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           Y+C+ C K FT+   L++H+ +HTG++PF C    CSK F+ K N+  H  TH+++
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEKV 469

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           + C  C K F+R   L +H++ H   RPFVC  + C K+F    NM  H
Sbjct: 444 FSCEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSH 492

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 36  AVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
            V  P  A  + +++C+ C K+F + + L+ H+  H GD+P+ C  + C K F    N+ 
Sbjct: 375 GVEKPIGANGIKQHECNICHKLFIQLTHLEVHLRSHLGDKPYKC--TWCGKGFTQGGNLK 432

Query: 96  RHFKTH 101
            H + H
Sbjct: 433 THVRLH 438

>KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598
           YMR037C
          Length = 620

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C +C+K F RS  L+ H+  VH+ DRPF C  + C K F+   N+++H KTHK+ G
Sbjct: 563 FKCGQCVKAFKRSEHLKRHVRSVHSNDRPFAC--TLCEKKFSRSDNLSQHLKTHKKHG 618

>TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1.326
           YJL056C
          Length = 778

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C   F+ +S+L+ H   HTG++P  C  + C K FN  SN+++H KTHK+
Sbjct: 701 YKCDMCGNSFSSASSLKVHKRTHTGEKPLSC--NVCGKRFNSSSNLSKHVKTHKK 753

 Score = 35.0 bits (79), Expect = 0.019,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C    C + FT+   L  H+ VHT  +PF C   +C K+F+ +  + +H + H
Sbjct: 643 YYCKWENCDRRFTQKQKLVRHLRVHTHYKPFTC--KTCGKNFSNQEILIQHQRVH 695

>NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {ON}
           Anc_2.598
          Length = 730

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++CS C+K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 673 FKCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 728

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F+ SS+L+ HI  HTG++P  C    C K FN  SN+++H KTHK+
Sbjct: 799 YKCDICNKKFSISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKK 851

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 31  PQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           PQR   +       K   Y+C  C + F+    L  H   H+G++P+ C    C+K F++
Sbjct: 753 PQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--DICNKKFSI 810

Query: 91  KSNMNRHFKTH 101
            S++  H +TH
Sbjct: 811 SSSLKIHIRTH 821

 Score = 30.4 bits (67), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 5/87 (5%)

Query: 19  LPRHSSAP-LTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHI-LVHT--GD 74
           +P+   AP LT +    S +P P + P+ +  Q + C   F+ +  L  H+  VH   G 
Sbjct: 680 VPKSDEAPDLTLSINDVSNIP-PLKQPEQVVCQWNNCNTSFSNAQELNDHLEAVHLTRGK 738

Query: 75  RPFVCPHSSCSKSFNVKSNMNRHFKTH 101
             + C    C ++F  +  + RH K H
Sbjct: 739 SEYQCLWHDCHRTFPQRQKLIRHLKVH 765

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 42  EAPKLLR----YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
           EA  L R    YQC    C + F +   L  H+ VH+  +P+ C   +C + F+ +  + 
Sbjct: 730 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLV 787

Query: 96  RHFKTH 101
           +H +TH
Sbjct: 788 QHTRTH 793

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 29  SAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKS 87
           S P R S   +P E  +   ++C  C K F RS  L+ HI  VH+ +RPF C  S C K 
Sbjct: 601 SKPSRNSKSSSPIEEDEK-PFKCQECTKAFRRSEHLKRHIRSVHSTERPFHC--SYCDKK 657

Query: 88  FNVKSNMNRHFKTHKQLG 105
           F+   N+++H KTHK+ G
Sbjct: 658 FSRSDNLSQHLKTHKKHG 675

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT +S+L+ HI  HTG++P  C    C K+FN  SN+++H KTH +L
Sbjct: 766 FQCHLCDKRFTIASSLKIHIRTHTGEKPLKC--KICGKAFNESSNLSKHIKTHFKL 819

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 50  QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +C  C K F+    L+ H   HTG++PF C    C K F + S++  H +TH
Sbjct: 739 KCPVCNKCFSNLETLKQHQRTHTGEKPFQC--HLCDKRFTIASSLKIHIRTH 788

 Score = 37.4 bits (85), Expect = 0.003,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 48  RYQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +YQC    C K FT+   +  H+ VH+G +P  CP   C+K F+    + +H +TH
Sbjct: 707 QYQCHWHGCSKKFTQRQKMVRHLKVHSGYKPCKCP--VCNKCFSNLETLKQHQRTH 760

 Score = 29.3 bits (64), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 3/51 (5%)

Query: 54  CLKVFTRSSALQSHI---LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C +VF     L +H+    +  G   + C    CSK F  +  M RH K H
Sbjct: 682 CDQVFNSKEDLNTHLENDHLLKGQSQYQCHWHGCSKKFTQRQKMVRHLKVH 732

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           Y+CS C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H +TH+
Sbjct: 634 YKCSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHE 685

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 12/67 (17%)

Query: 45  KLLRY----------QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNM 94
           KLLR+          +C  CLK F+    LQ H+  H+G++P+ C H  C K F   S++
Sbjct: 592 KLLRHLRVHTRYKPCKCVHCLKTFSTQDILQQHMRTHSGEKPYKCSH--CGKGFATSSSL 649

Query: 95  NRHFKTH 101
             H +TH
Sbjct: 650 RIHIRTH 656

 Score = 33.5 bits (75), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C    C +V T+   L  H+ VHT  +P  C H  C K+F+ +  + +H +TH
Sbjct: 576 YVCGWENCGRVITQRQKLLRHLRVHTRYKPCKCVH--CLKTFSTQDILQQHMRTH 628

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++C  C K F+ SS+L+ HI  HTG++P  C    C K FN  SN+N+H KTH++
Sbjct: 763 FKCHLCGKSFSVSSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLNKHLKTHRK 815

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  CLK F+    L  H+  H+G++PF C    C KSF+V S++  H +TH
Sbjct: 735 FKCQVCLKSFSSEDTLNQHMRTHSGEKPFKC--HLCGKSFSVSSSLKIHIRTH 785

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            Y C    C + FT+   +  H+ VH+G +PF C    C KSF+ +  +N+H +TH
Sbjct: 704 EYHCHWKGCCRKFTQRQKMVRHLKVHSGYKPFKC--QVCLKSFSSEDTLNQHMRTH 757

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 4/78 (5%)

Query: 29  SAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKS 87
           S P R S   +P E  +   ++C  C K F RS  L+ HI  VH+ +RPF C  S C K 
Sbjct: 622 SKPPRNSKSSSPVEEEEK-PFKCQECTKAFRRSEHLKRHIRSVHSSERPFHC--SYCDKK 678

Query: 88  FNVKSNMNRHFKTHKQLG 105
           F+   N+++H KTHK+ G
Sbjct: 679 FSRSDNLSQHLKTHKKHG 696

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ DRPF C +  C K F+   N+++H KTH++ G
Sbjct: 504 FKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHG 559

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 4/92 (4%)

Query: 14  EHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCS--RCLKVFTRSSALQSHILVH 71
           + IL  P   +  LT+ P R S      E P  + Y+C   +C K F R   ++SHI  H
Sbjct: 523 DEILSSPTKITRKLTTLP-RGSIDVYVKELPDRM-YECLYPQCGKTFKRRYNIRSHIQTH 580

Query: 72  TGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
             DRP+ C +  C K+F    ++ RH KTH++
Sbjct: 581 LEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQE 612

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 53.5 bits (127), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H KTHK+
Sbjct: 794 YKCHICDKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKK 846

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 2/71 (2%)

Query: 31  PQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           PQR   +       K   Y+C  C + F+    L  H   H+G++P+ C    C K F +
Sbjct: 748 PQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICDKKFAI 805

Query: 91  KSNMNRHFKTH 101
            S++  H +TH
Sbjct: 806 SSSLKIHIRTH 816

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 6/93 (6%)

Query: 15  HILGLPR---HSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-V 70
           H+L  P    H  +P  + P        P + P+ +  Q   C K FT +  L +H+  V
Sbjct: 668 HLLHCPNPQTHELSPGLALPVNDVTNALPFKQPEQVICQWDGCNKQFTNAQELNNHLESV 727

Query: 71  HT--GDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           H   G   + C    C ++F  +  + RH K H
Sbjct: 728 HLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVH 760

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            YQC    C + F +   L  H+ VH+  +P+ C   +C + F+ +  + +H +TH
Sbjct: 735 EYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 788

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 53.5 bits (127), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H  +HTG+RP+ C    C K F+ K N+  HF TH++L
Sbjct: 536 FQCEYCGKRFTQGGNLRTHQRLHTGERPYSC--ELCGKKFSRKGNLAAHFLTHQKL 589

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H L H   +P+VC    C+KSF    NM  H
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAH 612

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVK 91
           Q    V  P  A  + +++C  C + FT+S+ L+ H+  H G +PF C +  C K F   
Sbjct: 491 QLVGGVEKPKSAHGIKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQG 548

Query: 92  SNMNRHFKTH 101
            N+  H + H
Sbjct: 549 GNLRTHQRLH 558

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           YQC+ C K FT+   L++H  +HTG++P+ C    C+K F+ K N+  H  THK+L
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSC--KICNKRFSRKGNLTAHVLTHKKL 598

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H+L H   +P+ C   +C+K+F    NM  H
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 17  LGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRP 76
           +G P  S++P T  P      PT +   K   +QC  C + F++S+ L+ HI  H G +P
Sbjct: 488 MGSPLLSTSPQT--PVNNDLSPTRSRTKKKT-HQCPYCHRFFSQSTHLEVHIRSHIGYKP 544

Query: 77  FVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  + C K F    N+  H + H
Sbjct: 545 YQC--NFCGKKFTQGGNLKTHQRLH 567

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H KTHK+
Sbjct: 795 YKCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHKK 847

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 31  PQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           PQR   +       K   Y+C  C + F+    L  H   H+G++P+ C    C+K F +
Sbjct: 749 PQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAI 806

Query: 91  KSNMNRHFKTH 101
            S++  H +TH
Sbjct: 807 SSSLKIHIRTH 817

 Score = 29.6 bits (65), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            YQC    C + F +   L  H+ VH+  +P+ C   +C + F+ +  + +H +TH
Sbjct: 736 EYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLVQHTRTH 789

>AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR146C (SWI5) and
           YLR131C (ACE2)
          Length = 844

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           +QC    C K+F R   ++SHI  H  DRPF C H  C+K+F    ++ RH KTH +
Sbjct: 674 FQCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAE 730

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 6/81 (7%)

Query: 26  PLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSC 84
           P  S P+  S  P   E      ++C  C K F RS  L+ HI  VH+ +RPF C  S C
Sbjct: 422 PSASRPRNKSTSPAEEEEKP---FKCQECTKAFRRSEHLKRHIRSVHSSERPFHC--SYC 476

Query: 85  SKSFNVKSNMNRHFKTHKQLG 105
            K F+   N+++H KTHK+ G
Sbjct: 477 DKKFSRSDNLSQHLKTHKKHG 497

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 44  PKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           P L  ++C+ C K F RS  L+ HI  VH+ +RPF C +  C K F+   N+++H KTHK
Sbjct: 457 PLLKTFKCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNY--CEKKFSRSDNLSQHLKTHK 514

Query: 103 QLG 105
           + G
Sbjct: 515 KHG 517

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++C  C K F+ S++L+ HI  HTG++P  C    C + FN  SN+++H KTH+ 
Sbjct: 668 FKCHLCDKSFSVSTSLKIHIRTHTGEKPLEC--KVCGRRFNESSNLSKHMKTHEH 720

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y+C  C K F+    L+ H  VH+G++PF C    C KSF+V +++  H +TH
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKC--HLCDKSFSVSTSLKIHIRTH 690

 Score = 35.4 bits (80), Expect = 0.014,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y C    C K F++   +  H+ VH+G +P+ C    CSK F+    + +H + H
Sbjct: 609 KYTCFWHGCNKEFSQRQKIVRHLKVHSGFKPYKC--EVCSKCFSSDETLKQHSRVH 662

 Score = 27.7 bits (60), Expect = 6.2,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 52  SRCLKVFTRSSALQSHI---LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C   F  S  L +H+    +  G   + C    C+K F+ +  + RH K H
Sbjct: 582 NNCNLTFNSSEELNAHLESFHLTKGKSKYTCFWHGCNKEFSQRQKIVRHLKVH 634

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ DRPF C +  C K F+   N+++H KTH++ G
Sbjct: 698 FKCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHG 753

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 52.4 bits (124), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 38  PTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNR 96
           P+ AE      + C +CLK F RS  L+ H+  VH+ +RP+ C  + C K F+   N+++
Sbjct: 592 PSTAEDDMEKPFHCEQCLKAFKRSEHLKRHVRSVHSQERPYGC--NICDKKFSRSDNLSQ 649

Query: 97  HFKTHKQLG 105
           H KTHK+ G
Sbjct: 650 HLKTHKRHG 658

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           +QC  C K FT+   L++H+ +HTG+RP+ C    C K F+ K N+  H  TH+
Sbjct: 515 FQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 566

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C +C K F+R   L +H+L H   +PF C    C+KSF    N+K++ NR H +T  +
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTLNR 602

Query: 104 L 104
           L
Sbjct: 603 L 603

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 11/77 (14%)

Query: 34  PSAVPTPA------EAPK---LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSC 84
           PS +P P+      E PK   + +++C  C K FT+S+ L+ H+  H G +PF C +  C
Sbjct: 463 PSIIPPPSQLVGGVEKPKSRGVKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--C 520

Query: 85  SKSFNVKSNMNRHFKTH 101
            K F    N+  H + H
Sbjct: 521 GKRFTQGGNLRTHVRLH 537

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           ++C+ C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H KTH+
Sbjct: 686 FKCTYCTKQFATSSSLRIHIRTHTGEKPLKC--KICGKRFNESSNLSKHMKTHE 737

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query: 33  RPSAVPTPAEAPKLLR----YQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSK 86
            P A+    E+  + R    YQCS   C K FT+   L  H+ VH+G +PF CPH  C+K
Sbjct: 608 NPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKCPH--CTK 665

Query: 87  SFNVKSNMNRHFKTH 101
            F+ +  + +H +TH
Sbjct: 666 KFSTEDILQQHIRTH 680

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  C K F+    LQ HI  H+G+RPF C +  C+K F   S++  H +TH
Sbjct: 658 FKCPHCTKKFSTEDILQQHIRTHSGERPFKCTY--CTKQFATSSSLRIHIRTH 708

 Score = 35.4 bits (80), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 27  LTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL---VHTGDRPFVCPHSS 83
           LT     PS   T  E+  + ++  + C +VF    AL +HI    +  G   + C   +
Sbjct: 577 LTPVSYDPSEGSTGDESVHVCKW--ANCSQVFPNPEALNNHIESQHIPRGQSSYQCSWDT 634

Query: 84  CSKSFNVKSNMNRHFKTH 101
           CSKSF  +  + RH K H
Sbjct: 635 CSKSFTQRQKLLRHLKVH 652

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           +QC  C K FT+   L++H+ +HTG+RP+ C    C K F+ K N+  H  TH+
Sbjct: 519 FQCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 570

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C +C K F+R   L +H+L H   +PF C    C+KSF    N+K++ NR H +T  +
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQTLNR 606

Query: 104 L 104
           L
Sbjct: 607 L 607

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 46/92 (50%), Gaps = 12/92 (13%)

Query: 19  LPRHSSAPLTSAPQRPSAVPTPA------EAPK---LLRYQCSRCLKVFTRSSALQSHIL 69
           +PR++   L      PS +P P+      E PK   + +++C  C K FT+S+ L+ H+ 
Sbjct: 453 VPRNADGSLM-LEDAPSIIPPPSQLVGGVEKPKSRGVKQHECPYCHKCFTQSTHLEVHVR 511

Query: 70  VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            H G +PF C +  C K F    N+  H + H
Sbjct: 512 SHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C+ C K F RS  L+ HI  VH+ +RPF C +  C K F+   N+++H KTHK+ G
Sbjct: 590 FKCTDCEKAFRRSEHLKRHIRSVHSSERPFACNY--CEKKFSRSDNLSQHLKTHKKHG 645

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF CP  +C K F+   N+ +H KTHK+ G
Sbjct: 765 FKCETCGKAFRRSEHLKRHIRSVHSSERPFACP--TCDKKFSRSDNLAQHIKTHKKRG 820

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           +QC +C K F RS  L+ H+  VH+ +RPF C  + C K F+   N+++H KTHK+ G
Sbjct: 712 FQCDQCTKSFRRSEHLKRHVRSVHSKERPFAC--NLCEKKFSRSDNLSQHLKTHKKHG 767

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 35  SAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSN 93
           S  P  A    +  ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N
Sbjct: 513 SITPMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDN 570

Query: 94  MNRHFKTHKQLG 105
           +++H KTHK+ G
Sbjct: 571 LSQHLKTHKKHG 582

>KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.281
           YBR066C
          Length = 254

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 4/105 (3%)

Query: 1   MQRQPASPSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLL----RYQCSRCLK 56
           ++R P + S+  P  I  L       L+    +P A  +  +    L    +Y C+ C K
Sbjct: 133 VERTPRTLSYNSPNRIEKLDTSQVTFLSLKGSKPLARNSREDLSATLEQRRKYLCTTCTK 192

Query: 57  VFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            FT S  L  H  +HTG++  +CP   C + F+ + N  +H++TH
Sbjct: 193 GFTTSGHLARHKRIHTGEKNHLCPFEGCKQRFSRQDNCLQHYRTH 237

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y C  C K FT S  L  H  +HTG++  VCP+  C + FN   N  +H+KTH
Sbjct: 401 KYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTH 454

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           ++C  C K FT SS+L+ HI  HTG++P  C  + C K FN  SN+++H K H+
Sbjct: 574 FKCQFCDKRFTTSSSLRIHIRTHTGEKPLAC--NVCGKRFNESSNLSKHMKIHE 625

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 4/55 (7%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           YQC    C K F +   L  HI VHTG +PF CPH  CSK+F+ +  +++H +TH
Sbjct: 516 YQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKCPH--CSKTFSTEDILSQHIRTH 568

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 12/71 (16%)

Query: 41  AEAPKLLR----------YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           A+  KLLR          ++C  C K F+    L  HI  H+G+RPF C    C K F  
Sbjct: 528 AQRQKLLRHIKVHTGYKPFKCPHCSKTFSTEDILSQHIRTHSGERPFKCQF--CDKRFTT 585

Query: 91  KSNMNRHFKTH 101
            S++  H +TH
Sbjct: 586 SSSLRIHIRTH 596

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y C  C K F  SS+L+ H+  HTG++P  C  + C K F   SN+N+H KTH++
Sbjct: 669 YHCDICGKRFAISSSLKIHVRTHTGEKPLQC--AVCGKRFIESSNLNKHMKTHEK 721

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y+C +C K F+    L+ H+ +H+G++P+ C    C K F + S++  H +TH
Sbjct: 641 YKCPQCQKCFSSDETLKQHLRIHSGEKPYHC--DICGKRFAISSSLKIHVRTH 691

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 48  RYQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y CS   C K FT+   +  H+ VHT  +P+ CP   C K F+    + +H + H
Sbjct: 610 QYTCSWAGCGKTFTQRQKIARHLKVHTRYKPYKCP--QCQKCFSSDETLKQHLRIH 663

>KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {ON}
           Anc_2.598 YMR037C
          Length = 443

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C  + C K F+   N+++H KTHK+ G
Sbjct: 386 FKCDTCYKAFRRSEHLKRHIRSVHSTERPFAC--TICDKKFSRSDNLSQHLKTHKKHG 441

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H +TH++
Sbjct: 605 YKCVHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHER 657

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 12/67 (17%)

Query: 45  KLLRY----------QCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNM 94
           KLLR+          +C  C K F+    LQ HI  H+G++P+ C H  C K F   S++
Sbjct: 563 KLLRHLRVHTRYKPCKCPHCAKTFSTQDILQQHIRTHSGEKPYKCVH--CGKGFATSSSL 620

Query: 95  NRHFKTH 101
             H +TH
Sbjct: 621 RIHIRTH 627

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C    C KV T+   L  H+ VHT  +P  CPH  C+K+F+ +  + +H +TH
Sbjct: 547 YVCGWENCGKVITQRQKLLRHLRVHTRYKPCKCPH--CAKTFSTQDILQQHIRTH 599

 Score = 29.6 bits (65), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 3/51 (5%)

Query: 54  CLKVFTRSSALQSHIL-VHT--GDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C++VF     L  HI  VH   G   +VC   +C K    +  + RH + H
Sbjct: 521 CMQVFNSCEELNGHIEKVHIPRGKSSYVCGWENCGKVITQRQKLLRHLRVH 571

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 380 FKCKECAKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 435

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F  SS+L+ HI  HTG++P  C    C K FN  SN+++H KTH++
Sbjct: 796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHQK 848

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 31  PQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNV 90
           PQR   +       K   Y+C  C + F+    L  H   H+G++P+ C    C+K F +
Sbjct: 750 PQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKC--HICNKKFAI 807

Query: 91  KSNMNRHFKTH 101
            S++  H +TH
Sbjct: 808 SSSLKIHIRTH 818

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 25  APLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHI-LVHT--GDRPFVCPH 81
           AP  ++    S +P P + P+ +  Q   C K F+ +  L  H+  VH   G   + C  
Sbjct: 684 APDMTSANDVSNIP-PIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLW 742

Query: 82  SSCSKSFNVKSNMNRHFKTH 101
             C ++F  +  + RH K H
Sbjct: 743 HDCHRTFPQRQKLIRHLKVH 762

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 42  EAPKLLR----YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
           EA  L R    YQC    C + F +   L  H+ VH+  +P+ C   +C + F+ +  + 
Sbjct: 727 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC--KTCKRCFSSEETLV 784

Query: 96  RHFKTH 101
           +H +TH
Sbjct: 785 QHTRTH 790

>Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {ON}
           complement(39687..41171) [1485 nt, 495 aa]
          Length = 494

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/78 (35%), Positives = 44/78 (56%), Gaps = 3/78 (3%)

Query: 29  SAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKS 87
           +A +R S++   +       ++C  C K F RS  L+ HI  VH+ +RPF C +  C K 
Sbjct: 417 TASKRNSSISINSNDEIEKPFKCGDCTKQFRRSEHLKRHIRSVHSKERPFPCKY--CDKK 474

Query: 88  FNVKSNMNRHFKTHKQLG 105
           F+   N+++H KTHK+ G
Sbjct: 475 FSRSDNLSQHLKTHKKHG 492

>KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.598
           YMR037C
          Length = 370

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 48  RYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           +++CS C K F RS  L+ H   VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 312 QFKCSECEKGFKRSEHLKRHFRSVHSNERPFPC--MLCEKKFSRSDNLSQHLKTHKKHG 368

>CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {ON}
           some similarities with uniprot|P38082 Saccharomyces
           cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 314

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++ C  CL  FT S  L  H  +HTG++  VCPH  C++SF+   N  +H++TH
Sbjct: 251 KHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTH 304

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 51.2 bits (121), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +++C+ C K F+++  L +H  +HTG+RP+ C    C+K F+ K N+  H  THK+L
Sbjct: 376 QHKCAYCDKRFSQTGNLNTHQRLHTGERPYEC--HICNKRFSRKGNLTAHVITHKKL 430

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH-FKTHKQLGLR 107
           Y+C  C K F+R   L +H++ H   +P++C    C+K F    NM  H  K H +  LR
Sbjct: 405 YECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVHQNKFHYETILR 464

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH+ L
Sbjct: 568 FQCEYCGKRFTQGGNLRTHTRLHTGEKPYSC--EKCGKRFSRKGNLAAHMLTHENL 621

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y C +C K F+R   L +H+L H   +P+ C    CSKSF    N+K++ NR H +T  Q
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQTLNQ 655

Query: 104 LGLR 107
           L  R
Sbjct: 656 LTQR 659

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 12/92 (13%)

Query: 19  LPRHSSAPLTSAPQRPSAVPTPAE---------APKLLRYQCSRCLKVFTRSSALQSHIL 69
           +PR +   L      PS +P P+E         A  + +++C  C K FT+S+ L+ H+ 
Sbjct: 502 VPRSADGSLM-IEDTPSLIPPPSELVGGVEKPKARGVKQHECPYCHKCFTQSTHLEVHVR 560

Query: 70  VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
            H G +PF C +  C K F    N+  H + H
Sbjct: 561 SHIGYKPFQCEY--CGKRFTQGGNLRTHTRLH 590

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H+ +HTG++P+ C    C + F+ K N+  H  TH+ L
Sbjct: 531 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHENL 584

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y+C +C + F+R   L +H L H   +PF C    C+KSF    NM  H
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 607

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C K FT+S+ L+ H+  H G +PF C +  C K F    N+  H + H
Sbjct: 502 QHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 50.8 bits (120), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           ++C  C K FT+   L++H  +HTG++P+ C H  CSK F+ K N+  H  TH+++
Sbjct: 500 FECQFCGKRFTQGGNLRTHQRLHTGEKPYACQH--CSKRFSRKGNLAAHQLTHREV 553

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H L H   +PF+C   +C K+F    NM  H
Sbjct: 528 YACQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%)

Query: 40  PAEAPKLL--RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           PA+ P+    +++C  C   F +++ L+ H+  H G +PF C    C K F    N+  H
Sbjct: 461 PAQTPQQQQKKHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQF--CGKRFTQGGNLRTH 518

Query: 98  FKTH 101
            + H
Sbjct: 519 QRLH 522

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 50.8 bits (120), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           YQC  C + F+R   L +HIL H   +PFVC   +C KSF    NM  H
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAH 406

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H  +HTG++P+ C   SC + F+ K N+  H  THK L
Sbjct: 330 FQCQFCGKKFTQGGNLRTHQRLHTGEKPYQC--ESCGRRFSRKGNLAAHILTHKNL 383

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C ++F++S+ L+ HI  H G +PF C    C K F    N+  H + H
Sbjct: 301 KHECPYCHRLFSQSTHLEVHIRSHIGYKPFQC--QFCGKKFTQGGNLRTHQRLH 352

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 50.4 bits (119), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           + C  C K F+ SS+L+ HI  HTG++P  C  + C K FN  SN+++H K H++
Sbjct: 572 FHCHYCRKQFSTSSSLRVHIRTHTGEKPLSC--TVCGKRFNESSNLSKHMKIHER 624

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C  C K F+    L  HI  H+G+RPF C +  C K F+  S++  H +TH
Sbjct: 546 CPHCPKTFSTDDILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 50.4 bits (119), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H+ +HTG++P+ C    C + F+ K N+  H  TH+ L
Sbjct: 514 FQCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHENL 567

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y+C +C + F+R   L +H L H   +PF C    C+KSF    NM  H
Sbjct: 542 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAH 590

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C K FT+S+ L+ H+  H G +PF C +  C K F    N+  H + H
Sbjct: 485 QHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 50.4 bits (119), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           KL   Q   C K+F R   ++SHI  H  DRP++C    C K+F    ++ RH K+H +
Sbjct: 625 KLFECQYHGCGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHAE 683

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  C K F  SS+L+ HI  HTG++P  C    C K+FN  SN+++H KTH
Sbjct: 695 FKCDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTH 745

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +QCS C K F+    L+ H   H+G++PF C    C K F + S++  H +TH
Sbjct: 667 FQCSICKKHFSNEETLKQHERTHSGEKPFKC--DICGKRFAISSSLKIHIRTH 717

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y+C  + C K+F++   L  H+ VH+G +PF C  S C K F+ +  + +H +TH
Sbjct: 636 QYECHWANCHKIFSQRQRLVRHMRVHSGYKPFQC--SICKKHFSNEETLKQHERTH 689

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           ++C  C + F R    + H+  HTG++P+ C   +C+KSF+    + RHF+TH +   RR
Sbjct: 17  FRCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRTHTRTVQRR 76

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           YQC  C K F+R   L +H+L H   +PF+C   +C+KSF    NM  H
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGH 597

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           YQC  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  THK++
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQC--ELCGKRFSRKGNLAAHVLTHKKI 574

 Score = 37.7 bits (86), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 36  AVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
            V  P  +  + +++C  C + FT+ + L+ HI  H G +P+ C +  C K F    N+ 
Sbjct: 480 GVEKPFGSHGVKQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNLR 537

Query: 96  RHFKTH 101
            H + H
Sbjct: 538 THERLH 543

>Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062W
           (REAL)
          Length = 639

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           + C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 582 FNCKDCDKAFRRSEHLKRHIRSVHSAERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 637

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 43  APKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           A +  R+ C  C   FT S  L  H  +HTG++  +CPH  C + F+   N N+H++TH
Sbjct: 147 AGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 573 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 628

>Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%)

Query: 43  APKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           A +  R+ C  C   FT S  L  H  +HTG++  +CPH  C + F+   N N+H++TH
Sbjct: 147 AGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 38  PTPAEAP-KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNR 96
           PT A    +  R+ C  C   FT S  L  H  +HTG++  +CPH  C + F+   N N+
Sbjct: 141 PTKANTTGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQ 200

Query: 97  HFKTH 101
           H++TH
Sbjct: 201 HYRTH 205

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           +QC+ C K F RS  L+ H+  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 484 FQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKRHG 539

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 571 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 626

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHI-LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 584 FKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 639

>NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598
          Length = 972

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++CS C K F RS  L+ H   VH+ +RPF C    C+K F+   N+++H KTHK+ G
Sbjct: 915 FKCSDCEKAFRRSEHLKRHFRSVHSAERPFGCMF--CTKRFSRSDNLSQHLKTHKKHG 970

>TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.598
           YMR037C
          Length = 365

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C++C K F RS  L+ HI  VH+ +RP+ C    C K+F+   N+++H KTHK+ G
Sbjct: 308 FKCNKCEKKFKRSEHLKRHIRSVHSTERPYHC--QFCEKNFSRSDNLSQHLKTHKRHG 363

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           R+ C  C   FT S  L  H  +HTG++  +CPH  C + F+   N N+H++TH
Sbjct: 152 RHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTH 205

>KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.326
           YLR131C
          Length = 623

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 50/90 (55%), Gaps = 10/90 (11%)

Query: 20  PRHSSAPLTSAPQRPSAVPTPAEAPKLLR------YQC--SRCLKVFTRSSALQSHILVH 71
           P   S+P+  A ++P+ +P P    K ++      ++C    C K+F R   ++SHI  H
Sbjct: 426 PEVHSSPM-RARRKPTTLP-PGSIDKYIKELPDKLFECLYKDCHKLFKRRYNIRSHIQTH 483

Query: 72  TGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
             DRP++C + +C+K+F    ++ RH K+H
Sbjct: 484 LEDRPYICDYENCNKAFVRNHDLVRHKKSH 513

>Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}
           YDR043C (REAL)
          Length = 232

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 3   RQPASPSWAGPEHI-LGLPRHSSAPLTSAPQRPSAVPTPAEAPKLL---RYQCSRCLKVF 58
           RQ  S + +  E+  +G  R+S   L +  QR     T ++   L    +Y C  C + F
Sbjct: 128 RQTDSGTVSNDEYDNMGNIRYS---LKTRKQRTDPKNTLSDEEDLEQRRKYICKICARGF 184

Query: 59  TRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           T S  L  H  +HTG++   CP+  C++ F+   N  +H++TH + G
Sbjct: 185 TTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKG 231

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y+C  C K F  S++L+ HI  HTG++P  C    C + FN  SN+++H KTH
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCK--VCGRCFNESSNLSKHMKTH 675

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           YQC +C K F+    L  H  VH+G++P+ C    C K F + +++  H +TH
Sbjct: 597 YQCPQCQKCFSTEDTLNQHKRVHSGEKPYEC--HICHKRFAISNSLKIHIRTH 647

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 48  RYQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y C    C K F++   L  H+ VH+  +P+ CP   C K F+ +  +N+H + H
Sbjct: 566 QYTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCP--QCQKCFSTEDTLNQHKRVH 619

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 3   RQPASPSWAGPEHILGLPRHSSAPLTSAPQRPS---AVPTPAEAPKLLRYQC--SRCLKV 57
           R  +SP     E    L  +S++  T A QR S    +P P + P    + C  + C + 
Sbjct: 487 RSMSSPVMIKAEQENDL-NNSNSTRTRARQRVSRSKKLPEPTK-PDETEFCCKWAGCNER 544

Query: 58  FTRSSALQSHIL---VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           F  +  L  H+    +  G   + C    C+K+F+ +  + RH K H
Sbjct: 545 FKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVH 591

>KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weakly
           similar to uniprot|P33748 Saccharomyces cerevisiae
           YMR037C MSN2 Transcriptional activator related to Msn4p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 694

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C +C K F RS  L+ H+  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 621 FKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKKHG 676

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 49.3 bits (116), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           Y+C  C K F+ SS+L+ H+  HTG++PF C    C K F   SN ++H K H+ 
Sbjct: 928 YKCEICGKSFSISSSLKIHVRTHTGEKPFEC--KVCGKRFVESSNYSKHMKVHQH 980

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  C + F+    L  H   H+G++P+ C    C KSF++ S++  H +TH
Sbjct: 900 FKCDVCSRCFSSKETLIQHYRTHSGEKPYKC--EICGKSFSISSSLKIHVRTH 950

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 49  YQCS--RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y+C    C KVF +   +  H+  H+G +PF C    CS+ F+ K  + +H++TH
Sbjct: 870 YECKWHNCHKVFKQRQKILRHLKTHSGFKPFKC--DVCSRCFSSKETLIQHYRTH 922

 Score = 28.1 bits (61), Expect = 4.9,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 47  LRYQC--SRCLKVFTRSSALQSHI---LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++ QC    C  VF     L +H+    +  G   + C   +C K F  +  + RH KTH
Sbjct: 835 VKLQCHWEDCTDVFATPEELSNHLENFHLPRGKNSYECKWHNCHKVFKQRQKILRHLKTH 894

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  C K FTR   L+SH+  HT +RPF+C  SSC K+F  + +  RH   H
Sbjct: 392 FACELCDKRFTRPYNLKSHLRTHTNERPFIC--SSCGKAFARQHDRKRHEDLH 442

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 26/60 (43%), Gaps = 7/60 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKTH 101
           + CS C K F R    + H  +HTG + +VC           C K F     + RHFKT 
Sbjct: 420 FICSSCGKAFARQHDRKRHEDLHTGKKRYVCGGHLKDGTAWGCGKKFARSDALGRHFKTE 479

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           YQC  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH+++
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQKV 596

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C  C K F+R   L +H+L H   +PF+C   +C++SF    N+K++ NR H  T K 
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHLDTLKM 630

Query: 104 L 104
           L
Sbjct: 631 L 631

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 41  AEAPKLL-----RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
            E PK L     +++C  C ++F +S+ L+ HI  H G +P+ C +  C K F    N+ 
Sbjct: 502 VEKPKTLHEGSKQHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLR 559

Query: 96  RHFKTH 101
            H + H
Sbjct: 560 THQRLH 565

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 47.8 bits (112), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 30/54 (55%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           RY C  C + FT S  L  H  +HTG++  VCP   C + F+   N  +H++TH
Sbjct: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTH 152

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C  C K F+R   L +HI+ H   +PFVC    C+K+F    N+K++ NR H  T  +
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 677

Query: 104 LGLR 107
           L  R
Sbjct: 678 LTQR 681

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 590 FLCECCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCGKRFSRKGNLAAHIVTHQKL 643

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 36  AVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
            V  P  +  + +++C  C + FT+S+ L+ H+  H G +PF+C    C K F    N+ 
Sbjct: 549 GVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFLC--ECCGKRFTQGGNLR 606

Query: 96  RHFKTH 101
            H + H
Sbjct: 607 THQRLH 612

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 54  CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C KVF R   ++SHI  H  DRP+VC    C K+F    ++ RH K+H +
Sbjct: 578 CNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKKSHAE 627

>Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {ON}
           YLR131C (ACE2) - zinc finger transcription factor
           [contig 171] FULL
          Length = 745

 Score = 48.9 bits (115), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 10/93 (10%)

Query: 19  LPRHSSAPLTSAPQRPSAVPTPAEAPKLLR------YQC--SRCLKVFTRSSALQSHILV 70
           L  H  +PL    ++P+ +P P E  K ++      ++C    C K F R   ++SHI  
Sbjct: 551 LEHHYPSPLKIT-KKPTTLP-PGEIDKFVKELPDKTFECLHPDCGKTFRRRYNIRSHIQT 608

Query: 71  HTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           H  DRP+ C    C K+F    ++ RH KTH +
Sbjct: 609 HLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAE 641

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 452 FQCQYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCGKRFSRKGNLAAHVVTHQKL 505

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C  C K F+R   L +H++ H   +PF+C    C+K+F    N+K++ NR H  T  +
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHLNTLNE 539

Query: 104 L 104
           L
Sbjct: 540 L 540

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 19  LPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFV 78
           L   +S  L  + Q    V  P  +  + +++C  C + FT+S+ L+ H+  H G +PF 
Sbjct: 394 LIDETSGILPPSSQLVGGVEKPKGSHGVKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQ 453

Query: 79  CPHSSCSKSFNVKSNMNRHFKTH 101
           C +  C K F    N+  H + H
Sbjct: 454 CQY--CGKRFTQGGNLRTHQRLH 474

>Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON}
           (17106..18125) [1020 nt, 340 aa]
          Length = 339

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 48  RYQCSR--CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           RY+C+   C KV+ R S LQ H   HT +RP+ C + +C K F    ++  H  TH Q+ 
Sbjct: 13  RYKCTYEGCTKVYDRPSLLQQHRYSHTNERPYFCDYENCGKRFMRPCHLRVHQWTHSQVK 72

Query: 106 LR 107
            R
Sbjct: 73  PR 74

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 48.1 bits (113), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           K  R++C  C + FT S  L  H  +HTG++  VCP   C+  F+   N  +H+KTH
Sbjct: 157 KRRRFECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYKTH 213

>CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {ON}
           some similarities with uniprot|P33748 Saccharomyces
           cerevisiae YMR037c MSN2
          Length = 597

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           + C  C K F RS  L+ H+  VH+ DRPF C    C K F+   N+++H KTHK+ G
Sbjct: 535 FGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSC--HLCEKKFSRSDNLSQHIKTHKKSG 590

>Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON}
           YER028C (REAL)
          Length = 406

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           ++C  C + F R    + H+  HTG++P  C    C KSF+    + RH +THK+   RR
Sbjct: 17  FKCEFCSRGFHRLEHKKRHVRTHTGEKPHACSFRGCPKSFSRSDELKRHLRTHKKTTQRR 76

>TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {ON}
           Anc_2.598 YMR037C
          Length = 523

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C +C K F RS  L+ H+  VH+ +RPF C  + C K F+   N+++H KTHK+ G
Sbjct: 466 FKCGQCEKAFRRSEHLKRHVRSVHSSERPFPC--TFCDKRFSRSDNLSQHLKTHKKHG 521

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPFVC  S C K+F  + +  RH   H
Sbjct: 499 YACDMCDKKFTRPYNLKSHLRTHTNERPFVC--SICGKAFARQHDRKRHEDLH 549

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 7/60 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKTH 101
           + CS C K F R    + H  +H+G + ++C  +        C K F     + RHFKT 
Sbjct: 527 FVCSICGKAFARQHDRKRHEDLHSGKKRYICGGTLKDGTKWGCGKKFARSDALGRHFKTE 586

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C + F R    + H+ +HTG++P+ C + +CSK F+    +NRH K H
Sbjct: 19  YLCEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVH 71

>Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa]
           {ON} complement(101434..102513) [1080 nt, 360 aa]
          Length = 359

 Score = 48.1 bits (113), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 9/85 (10%)

Query: 27  LTSAPQRPSAVP-TPAEAPK-----LLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVC 79
           +T+ P+R   +P T    P      L  + C  C + F R   L+ H+  +H G++PF C
Sbjct: 275 ITTMPKRIGTLPKTRGRKPSPILDPLKLFACEHCDRRFKRQEHLKRHVRSLHMGEKPFSC 334

Query: 80  PHSSCSKSFNVKSNMNRHFKTHKQL 104
               C K F+   N+N+H KTH   
Sbjct: 335 --HICEKKFSRSDNLNQHIKTHSNF 357

>KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weakly
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 746

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 32  QRPSAVPTPAEAPKLLR------YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSS 83
           ++P+ +P P E  K ++      ++C    C K F R   ++SHI  H  DRP++C    
Sbjct: 561 RKPTTLP-PGEIDKYVKELPDKTFECLHPDCGKNFRRRYNIRSHIQTHLEDRPYICDFPD 619

Query: 84  CSKSFNVKSNMNRHFKTHKQ 103
           C+K+F    ++ RH KTH +
Sbjct: 620 CNKAFVRNHDLIRHKKTHAE 639

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++C  C K F  SS+L+ HI  HTG++P  C    C + F+  SN+N+H K+H++
Sbjct: 675 FECRICGKRFAVSSSLKIHIRTHTGEKPLQCK--ICGRRFSESSNLNKHMKSHQK 727

 Score = 42.7 bits (99), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y+C  C K F+    L  H   H+G++PF C    C K F V S++  H +TH
Sbjct: 647 YKCQDCGKCFSSEDTLTQHKRTHSGEKPFEC--RICGKRFAVSSSLKIHIRTH 697

 Score = 34.7 bits (78), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 25  APLTSAPQRPSAVPTPAEAPKLLR----YQCS--RCLKVFTRSSALQSHILVHTGDRPFV 78
              T      +A+ T  EA  L +    Y C    C K F +   L  H+ VH+G +P+ 
Sbjct: 589 GDCTEVFDSAAALTTHLEALHLEKGKSEYHCHWHGCDKRFAQRQKLVRHLKVHSGYKPYK 648

Query: 79  CPHSSCSKSFNVKSNMNRHFKTH 101
           C    C K F+ +  + +H +TH
Sbjct: 649 C--QDCGKCFSSEDTLTQHKRTH 669

>CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {OFF}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 291

 Score = 47.8 bits (112), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 5/61 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C  C K F+R   L +H + H   RPF+C   +C+KSF    N+KS+ N+ H  T K 
Sbjct: 11  YECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFHLDTLKV 70

Query: 104 L 104
           L
Sbjct: 71  L 71

>KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {ON}
           Anc_8.144 YER130C
          Length = 472

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS V  P++     ++ C  C + F R   L+ HIL +H G++ F CP   C K+F+ 
Sbjct: 388 RKPSLVDDPSK-----QFGCKYCPRKFKRQEHLKRHILSLHVGEKRFGCPI--CGKNFSR 440

Query: 91  KSNMNRHFKTH 101
             N+N+H KTH
Sbjct: 441 SDNLNQHIKTH 451

>Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON}
           YDR146C (REAL)
          Length = 708

 Score = 48.1 bits (113), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 53  RCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
            C K F R   ++SHI  H  DRP+ C H  C+K+F    ++ RH K+H++
Sbjct: 555 ECTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCNKAFVRNHDLIRHKKSHQE 605

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 74  DRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           D+ F C +  C+K+F  + N+  H +TH
Sbjct: 546 DKTFECLYPECTKTFKRRYNIRSHIQTH 573

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 47.8 bits (112), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           Y C  C K FTR   L+SH+  HT +RP+VC  S C K+F    + NRH   H   G RR
Sbjct: 469 YACDICDKKFTRPYNLKSHLRSHTDERPYVC--SVCGKAFARMHDKNRHEDLHT--GKRR 524

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKTH 101
           Y CS C K F R      H  +HTG R +VC           C K F     + RHFKT 
Sbjct: 497 YVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKT- 555

Query: 102 KQLG 105
            +LG
Sbjct: 556 -ELG 558

>Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON}
           complement(5351..7621) [2271 nt, 757 aa]
          Length = 756

 Score = 47.8 bits (112), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 49  YQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGL 106
           Y+C    C K+F R   ++SHI  H  DRP++C    C+KSF    ++ RH K+H +  L
Sbjct: 580 YECLYPNCHKIFKRRYNIRSHIQTHLKDRPYICDFQECNKSFVRNHDLVRHKKSHSKRKL 639

>TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.4 bits (111), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  C + F R+   + HI  HTG++P +CP   C+KSF+    + RH K H
Sbjct: 16  FKCPMCHRGFYRAEHKKRHIRTHTGEKPHLCPILGCNKSFSRTDELKRHMKVH 68

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           ++C  C K FT++  L++H  +HTG+RPF C    C K+F  + N+  H  TH+ +
Sbjct: 508 FECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHESI 561

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           YQC+ C K+F++S+ L  HI  H G +PF C    C K F    N+  H + H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 41.6 bits (96), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           ++C +C K F R   L +H   H   +P++C   +C K F+   NM  H
Sbjct: 536 FKCDKCDKTFARRGNLTAHEFTHESIKPYICRLDNCFKRFSQLGNMKSH 584

>YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}
           SWI5Transcription factor that recruits the Mediator and
           Swi/Snf complexes; activates transcription of genes
           expressed at the M/G1 phase boundary and in G1 phase;
           required for expression of the HO gene controlling
           mating type switching; localization to the nucleus
           occurs during G1 and appears to be regulated by
           phosphorylation by Cdc28p kinase
          Length = 709

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 54  CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K F R   ++SHI  H  DRP+ C H  C K+F    ++ RH K+H++
Sbjct: 557 CTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQE 606

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 437 FQCEFCGKRFTQGGNLRTHQRLHTGEKPYNC--EMCGKRFSRKGNLAAHALTHQKL 490

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 5/57 (8%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKT 100
           Y C  C K F+R   L +H L H   +P++C   +C+KSF    N+K++ NR H KT
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLKT 521

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVK 91
           Q    V  P  +  + +++C  C + FT+S+ L+ H+  H G +PF C    C K F   
Sbjct: 392 QLVGGVEKPKSSHGMKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEF--CGKRFTQG 449

Query: 92  SNMNRHFKTH 101
            N+  H + H
Sbjct: 450 GNLRTHQRLH 459

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF+C  S C+K+F  + +  RH   H
Sbjct: 651 YACELCDKKFTRPYNLKSHLRTHTNERPFIC--SICNKAFARQHDRKRHEDLH 701

 Score = 34.7 bits (78), Expect = 0.024,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS C K F R    + H  +HTG + ++C           C K F     + RHFKT
Sbjct: 679 FICSICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGTSWGCGKKFARSDALGRHFKT 737

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 47.4 bits (111), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 652 FACDYCGKRFTQGGNLRTHERLHTGEKPYSC--DICDKKFSRKGNLAAHLVTHQKL 705

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H++ H   +PFVC   +C K+F    NM  H
Sbjct: 680 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAH 728

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + +++C  C ++F++++ L+ H+  H G +PF C +  C K F    N+  H + H
Sbjct: 621 IKKHECPYCHRLFSQATHLEVHVRSHIGYKPFACDY--CGKRFTQGGNLRTHERLH 674

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF----NVKSNMNR-HFKTHKQ 103
           Y+C RC + F+R   L +H L H   +PF C    C+K+F    N+K++ NR H +T  +
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQTLNR 638

Query: 104 LGLR 107
           L  R
Sbjct: 639 LTQR 642

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++HI +HTG++P+ C    C + F+ K N+  H  TH  L
Sbjct: 551 FSCEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTHDNL 604

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 41  AEAPK---LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
            E PK   + ++QC  C K FT+S+ L+ H+  H G +PF C    C K F    N+  H
Sbjct: 512 VEKPKSKGVKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTH 569

Query: 98  FKTH 101
            + H
Sbjct: 570 IRLH 573

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 621 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSC--DICDKKFSRKGNLAAHLVTHQKL 674

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H++ H   +PFVC   +C+K+F    NM  H
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C ++F++++ L+ H+  H G +PFVC +  C K F    N+  H + H
Sbjct: 592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

>YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON}
           Protein of unknown function; transcription is regulated
           by Haa1p, Sok2p and Zap1p transcriptional activators;
           computational analysis suggests a role as a
           transcription factor; C. albicans homolog (MNL1) plays a
           role in adaptation to stress
          Length = 443

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P  ++     ++ C  C + F R   L+ H+  +H  ++PF C    C+K+F+ 
Sbjct: 377 RKPSLIPDASK-----QFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSR 429

Query: 91  KSNMNRHFKTHKQL 104
             N+N+H KTH  L
Sbjct: 430 SDNLNQHVKTHASL 443

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           +R S V   A+  +   + C  C K F RS  L+ H+  VH+ +RPF C    C K F+ 
Sbjct: 635 RRSSVVMESAKELEEKPFHCHICSKSFKRSEHLKRHVRSVHSNERPFAC--HICDKKFSR 692

Query: 91  KSNMNRHFKTHKQLG 105
             N+++H KTHK+ G
Sbjct: 693 SDNLSQHIKTHKKHG 707

>Ecym_2536 Chr2 complement(1041642..1042364) [723 bp, 240 aa] {ON}
           similar to Ashbya gossypii AGL246W
          Length = 240

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 46/100 (46%), Gaps = 15/100 (15%)

Query: 2   QRQPAS-PSWAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTR 60
           +RQ  S PSW   +   G  R  S+  T       A  TP+E  K   + CS+C  VF R
Sbjct: 124 KRQKKSMPSWGNRKK--GHTRDLSSSFT-------ASETPSEERK---FHCSKCELVFRR 171

Query: 61  SSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKT 100
           S  L+ H  VH    P +C  S C K F  K  + RHF T
Sbjct: 172 SGDLRRHEKVHLSILPNIC--SLCGKGFARKDALKRHFNT 209

>KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.144
           YER130C
          Length = 402

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++P+ +P   +      Y C  C + F R   L+ HI  +H G +P+ C    C++ F+ 
Sbjct: 337 RKPTLIPDNTK-----HYSCEYCERRFKRQEHLKRHIRSLHLGAKPYTC--HICARKFSR 389

Query: 91  KSNMNRHFKTHK 102
             N+N+H KTH+
Sbjct: 390 SDNLNQHTKTHE 401

>TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543
           YPR186C
          Length = 424

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           RY C  C + F++ S L+ H+ VH+ D+P  C  SSC K F     + RH  TH
Sbjct: 81  RYICDECHRSFSKKSHLERHVYVHSQDKPLHC--SSCGKGFTTGQQLRRHEITH 132

 Score = 38.9 bits (89), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 54  CLKVFTRSSALQSH-ILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K FTR S L  H  +VH G + ++C    C +SF+ KS++ RH   H Q
Sbjct: 58  CNKAFTRPSLLTEHQEVVHQGKKRYIC--DECHRSFSKKSHLERHVYVHSQ 106

 Score = 35.8 bits (81), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 51  CSRCLKVFTRSSALQSHILVHTG---DRPFVCPHSSCSKSFNVKSNMNRHFKT 100
           C  C K F R   LQ+H++ H     + P+ C  +SC+KSF   S +  H K+
Sbjct: 167 CKICNKEFQRPYRLQNHMVKHHNPVLENPYQCSFASCAKSFKTWSQLQTHVKS 219

 Score = 34.3 bits (77), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 51  CSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF 88
           CS C K FT    L+ H + HT  + F CP+  C++SF
Sbjct: 112 CSSCGKGFTTGQQLRRHEITHT--KSFKCPYDECNESF 147

 Score = 32.7 bits (73), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 67  HILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK--QLGLR 107
           H+L++T  R   CP+  C ++F  +    +H   HK  QL L+
Sbjct: 342 HLLLNTVGRKLRCPYDKCYRTFKTEEKFQKHLDKHKIHQLKLK 384

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           ++C  C + F R    + HI  HTG++P  C   SC KSF+    + RH +TH     RR
Sbjct: 17  FKCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRTHAGSSQRR 76

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 622 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSC--DICDKKFSRKGNLAAHLVTHQKL 675

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H++ H   +PFVC   +C+K+F    NM  H
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 698

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C ++F++++ L+ H+  H G +PFVC +  C K F    N+  H + H
Sbjct: 593 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 644

>YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}
           NRG1Transcriptional repressor that recruits the
           Cyc8p-Tup1p complex to promoters; mediates glucose
           repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 231

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 22  HSSAPLTSAPQRPSAVPTPAEAPKLL---RYQCSRCLKVFTRSSALQSHILVHTGDRPFV 78
           +S   L +  QR     T ++   L    +Y C  C + FT S  L  H  +HTG++   
Sbjct: 144 NSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHC 203

Query: 79  CPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           CP+  C++ F+   N  +H++TH + G
Sbjct: 204 CPYKGCTQRFSRHDNCLQHYRTHLKKG 230

>Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON}
           YER130C (REAL)
          Length = 442

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P  ++     ++ C  C + F R   L+ H+  +H  ++PF C    C+K+F+ 
Sbjct: 376 RKPSLIPDASK-----QFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSR 428

Query: 91  KSNMNRHFKTHKQL 104
             N+N+H KTH  L
Sbjct: 429 SDNLNQHVKTHASL 442

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPFVC  + C K+F  + +  RH   H
Sbjct: 420 YDCVICEKKFTRPYNLRSHLRTHTNERPFVC--TVCGKAFAREHDRKRHEDLH 470

 Score = 34.7 bits (78), Expect = 0.029,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C+ C K F R    + H  +HTG + ++C           C K F     + RHFKT
Sbjct: 448 FVCTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFKT 506

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           + C  C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH++L
Sbjct: 611 FVCDYCGKRFTQGGNLRTHERLHTGEKPYSC--DICDKKFSRKGNLAAHLVTHQKL 664

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y C  C K F+R   L +H++ H   +PFVC   +C+K+F    NM  H
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 687

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +++C  C ++F++++ L+ H+  H G +PFVC +  C K F    N+  H + H
Sbjct: 582 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 633

>TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {ON}
           Anc_8.326 YLR131C
          Length = 850

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 32/57 (56%)

Query: 45  KLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           KL      +C K+F R   ++SHI  H  DRP++C    C+K+F    ++ RH K+H
Sbjct: 668 KLFECLYPKCHKIFKRRYNIRSHIQTHLEDRPYICDFDGCNKAFVRNHDLVRHKKSH 724

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C+ C K FTR   L+SH+  HT +RPF C  S C K+F  + +  RH   H
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRTHTDERPFSC--SVCGKAFARQHDRKRHEDLH 476

 Score = 36.2 bits (82), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 7/60 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKTH 101
           + CS C K F R    + H  +H+G + +VC           C K F     + RHFKT 
Sbjct: 454 FSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTE 513

>YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}
           CRZ1Transcription factor that activates transcription of
           genes involved in stress response; nuclear localization
           is positively regulated by calcineurin-mediated
           dephosphorylation
          Length = 678

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  C K FTR   L+SH+  HT +RPF+C  S C K+F  + +  RH   H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLH 619

 Score = 36.2 bits (82), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 597 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKT 655

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF C  + C K+F  + +  RH   H
Sbjct: 397 YTCEVCDKKFTRPYNLKSHLRTHTNERPFAC--TICGKAFARQHDRKRHEDLH 447

 Score = 33.5 bits (75), Expect = 0.077,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C+ C K F R    + H  +H+G + + C           C K F     + RHFKT
Sbjct: 425 FACTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPWGCGKKFARSDALGRHFKT 483

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++QC  C+K FT +  L  H  +HTG++   CPH  C+  F+   N  +H++TH
Sbjct: 267 KHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCNLWFSRNDNSLQHYQTH 320

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y C  C K  T S  L  H  +HTG++ + C H  C + F+   N  +H+KTH
Sbjct: 255 KYICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSRHDNCKQHYKTH 308

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  C K FTR   L+SH+  HT +RPF+C  S C K+F  + +  RH   H
Sbjct: 564 FACDVCGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLH 614

 Score = 35.8 bits (81), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 592 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKT 650

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 39  TPAEAPKLLR-YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           TP   P   R Y C  C + F R      HI  HTG++P  C  + C K F+ +  + RH
Sbjct: 11  TPYSGPDAPRPYVCPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRH 70

Query: 98  FKTHK 102
            + H+
Sbjct: 71  RRIHE 75

>Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON}
           YER130C (REAL)
          Length = 449

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 8/74 (10%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P   +     ++ C  C + F R   L+ H+  +H  ++PF C    C+K+F+ 
Sbjct: 383 RKPSLIPDATK-----QFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSR 435

Query: 91  KSNMNRHFKTHKQL 104
             N+N+H KTH  L
Sbjct: 436 SDNLNQHVKTHTSL 449

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 30  APQRPSAVPTPAEAPKLLR---YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCS 85
            P R S+V    E+ K L    + C  C K F RS  L+ H+  VH+ +RPF C    C 
Sbjct: 627 TPSRRSSVV--IESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICD 682

Query: 86  KSFNVKSNMNRHFKTHKQLG 105
           K F+   N+++H KTHK+ G
Sbjct: 683 KKFSRSDNLSQHIKTHKKHG 702

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT ++PFVC  + C K+F  + +  RH   H
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEKPFVC--NICGKAFARQHDRKRHEDLH 502

 Score = 33.5 bits (75), Expect = 0.060,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C+ C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 480 FVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHFKT 538

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLR 107
           R+ C  C K FT S  L  H  +HTG++   CP+  C + F+   N  +H++ H +  LR
Sbjct: 109 RHVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKRELR 168

>Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 23  SSAPLTSAPQRPSAVPTPAEAPKLL---RYQCSRCLKVFTRSSALQSHILVHTGDRPFVC 79
           S   L +  QR     T ++   L    +Y C  C + FT S  L  H  +HTG++   C
Sbjct: 145 SRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCC 204

Query: 80  PHSSCSKSFNVKSNMNRHFKTHKQLG 105
           P+  C++ F+   N  +H++TH + G
Sbjct: 205 PYKGCTQRFSRHDNCLQHYRTHLKKG 230

>Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}
           YDR043C (REAL)
          Length = 231

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 22  HSSAPLTSAPQR--PSAVPTPAEAPKLLR-YQCSRCLKVFTRSSALQSHILVHTGDRPFV 78
           +S   L +  QR  P    +  E  +L R Y C  C + FT S  L  H  +HTG++   
Sbjct: 144 NSKYSLKTRKQRTDPRNTLSDEEDLELRRKYICKICARGFTTSGHLARHNRIHTGEKNHC 203

Query: 79  CPHSSCSKSFNVKSNMNRHFKTH 101
           CP+  C++ F+   N  +H++TH
Sbjct: 204 CPYKGCTQRFSRHDNCLQHYRTH 226

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF C  + C K+F  + +  RH   H
Sbjct: 424 YACELCDKKFTRPYNLKSHLRTHTDERPFAC--NVCGKAFARQHDRKRHEDLH 474

 Score = 36.6 bits (83), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C+ C K F R    + H  +HTG + ++C  +        C K F     + RHFKT
Sbjct: 452 FACNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSWGCGKKFARSDALGRHFKT 510

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 46.2 bits (108), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  C K FTR   L+SH+  HT +RPF+C  S C K+F  + +  RH   H
Sbjct: 573 FACDVCGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLH 623

 Score = 35.4 bits (80), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 601 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKT 659

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF C  + C K+F  + +  RH   H
Sbjct: 408 YACELCDKKFTRPYNLKSHLRTHTDERPFAC--AICGKAFARQHDRKRHEDLH 458

 Score = 36.2 bits (82), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 7/60 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKTH 101
           + C+ C K F R    + H  +HTG + + C           C K F     + RHFKT 
Sbjct: 436 FACAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFKTE 495

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 8/80 (10%)

Query: 30  APQRPSAVPTPAEAPKLLR---YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCS 85
            P R S+V    E+ K L    + C  C K F RS  L+ H+  VH+ +RPF C    C 
Sbjct: 626 TPSRRSSVV--MESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICE 681

Query: 86  KSFNVKSNMNRHFKTHKQLG 105
           K F+   N+++H KTHK+ G
Sbjct: 682 KKFSRSDNLSQHIKTHKKHG 701

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           +Y C  C K  T S  L  H  +HTG++   CP   C++ F+ + N ++H++TH++
Sbjct: 262 KYYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCSQHYQTHRR 317

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF C  + C K+F  + +  RH   H
Sbjct: 438 YSCDLCNKKFTRPYNLKSHLRTHTDERPFAC--NMCGKAFARQHDRKRHEDLH 488

 Score = 35.0 bits (79), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C+ C K F R    + H  +H+G + +VC           C K F     + RHFKT
Sbjct: 466 FACNMCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKDGTSWGCGKKFARSDALGRHFKT 524

>Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON}
           (58087..59160) [1074 nt, 358 aa]
          Length = 357

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 41  AEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKT 100
           A+  K  +Y C  C K  T S  L  H  +HTG++   CP+  C++ F+   N  +H++T
Sbjct: 293 ADIVKRRKYICRVCSKGLTTSGHLARHYRIHTGEKNHFCPYEGCNQRFSRHDNCIQHYRT 352

Query: 101 H 101
           H
Sbjct: 353 H 353

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C  C K FTR   L+SH+  HT +RPF+C  S C K+F  + +  RH   H
Sbjct: 572 FACDVCGKKFTRPYNLKSHLRTHTNERPFIC--SICGKAFARQHDRKRHEDLH 622

 Score = 37.0 bits (84), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS C K F R    + H  +HTG + +VC           CSK F     + RHFKT
Sbjct: 600 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCSKKFARSDALGRHFKT 658

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH   HT +RPF C  S C K+F  + +  RH   H
Sbjct: 493 YACPVCDKKFTRPYNLKSHKRTHTNERPFSC--SQCGKTFAREHDRKRHEDLH 543

 Score = 38.9 bits (89), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + CS+C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 521 FSCSQCGKTFAREHDRKRHEDLHTGKKRYVCGGKLKSGESWGCGKRFARSDALGRHFKT 579

>KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar to
           uniprot|P39933 Saccharomyces cerevisiae YPR186C PZF1
           Transcription factor IIIA (TFIIIA) with putative
           Zn-fingers
          Length = 433

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           + C+ C + FTR + L+ H+  HT ++PF C H  C K    +  + RH  TH
Sbjct: 81  FTCTECGRQFTRKTHLERHMFTHTAEKPFHCSH--CGKGVTTRQQLRRHEITH 131

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 54  CLKVFTRSSALQSH-ILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C K FTR S L  H   VH G +PF C  + C + F  K+++ RH  TH
Sbjct: 57  CSKAFTRPSQLTEHQETVHQGLKPFTC--TECGRQFTRKTHLERHMFTH 103

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 41  AEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF 88
           AE P    + CS C K  T    L+ H + HT  R FVCPH  C +SF
Sbjct: 105 AEKP----FHCSHCGKGVTTRQQLRRHEITHT--RSFVCPHEGCGESF 146

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 17/113 (15%)

Query: 2   QRQPASPS-WAGPEHILGLPRHSSAPLTSAPQ----RPSAVPTPAEAPKLLRYQCSRCLK 56
           +R+PA PS  A P +I         PL S  +    R S+    +E+ +L   Q    L+
Sbjct: 290 EREPAEPSATASPNNI---------PLESGARPSRLRSSSTKHDSES-ELESIQTEVKLR 339

Query: 57  VFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK--QLGLR 107
            +  S      +L+++  R   CP+  C +SF  +     H + HK  QL L+
Sbjct: 340 KYFDSGKSSVSLLLNSAGRKLKCPYLGCYRSFKTEEKYEMHIQKHKIHQLKLK 392

 Score = 30.8 bits (68), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 43  APKLLRYQCSRCLKVFTRSSALQSHILVH---TGDRPFVCPHSSCSKSFNVKSNMNRHFK 99
           A  L +  C  C K F R   L++HI  H        + C H SC ++F   + + +H K
Sbjct: 158 AVHLQKLNCEFCGKKFQRPYRLKNHIAKHHNPDTVYKYQCSHGSCVEAFKTWTALQQHVK 217

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           ++C  C + F R    + HI  HTG++P  C    C KSF+    + RH +TH     R+
Sbjct: 14  FRCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTHTGTSQRK 73

>Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C
           (REAL)
          Length = 442

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 8/74 (10%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P  ++     ++ C  C + F R   L+ H+  +H  ++PF C    C+K+F+ 
Sbjct: 376 RKPSLIPDASK-----QFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTC--HICNKNFSR 428

Query: 91  KSNMNRHFKTHKQL 104
             N+N+H KTH  L
Sbjct: 429 SDNLNQHVKTHVSL 442

>Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON}
           YDR146C (REAL)
          Length = 691

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 54  CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K F R   ++SHI  H  DRP+ C +  C K+F    ++ RH K+H++
Sbjct: 539 CAKTFKRRYNIRSHIQTHLEDRPYSCDNPGCDKAFVRNHDLIRHKKSHQE 588

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 74  DRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           D+ F C +  C+K+F  + N+  H +TH
Sbjct: 529 DKSFECLYPGCAKTFKRRYNIRSHIQTH 556

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 45.4 bits (106), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C KVF+R   L+SH+  HT ++P+ C  S C K+F  + +  RH   H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRTHTDEKPYQC--SICGKAFARQHDKKRHEDLH 571

 Score = 42.0 bits (97), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 27/59 (45%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           YQCS C K F R    + H  +HTG + +VC           C K F     + RHFKT
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKT 607

>TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {ON}
           Anc_2.598 YMR037C
          Length = 746

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++C  C K F RS  L+ HI  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 689 FKCDTCGKNFRRSEHLKRHIRSVHSMERPFSC--DICLKKFSRSDNLSQHLKTHKKHG 744

>Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON}
           (33422..34600) [1179 nt, 393 aa]
          Length = 392

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K F R    + HI  HTG++P VC    C KSF+    + RH   H
Sbjct: 27  YICEICTKGFRRLEHKKRHIRTHTGEKPHVCTFQGCPKSFSRSDELKRHMNIH 79

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++ C  C   FT S  L  H  +HTG++ +VCP   C + F+   N  +H KTH
Sbjct: 157 KHVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHKTH 210

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 51/95 (53%), Gaps = 9/95 (9%)

Query: 10  WAGPEHILGLPRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHI- 68
           ++GP  I   P +S+ P     ++PS VP  ++     ++ C+ C + F R   ++ HI 
Sbjct: 380 FSGPISIPIQPINSNRPKPRG-RKPSIVPDGSK-----QFLCTICSRRFRRQEHMKRHIR 433

Query: 69  LVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
            +H  +RP+ C    C K+F+   N+N+H +TH +
Sbjct: 434 TIHFQERPYTC--YVCEKTFSRSDNLNQHLRTHTR 466

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           Y+C  C K F+R   L +H L H   +PFVC   +C+K+F    NM  H
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAH 704

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQL 104
           +QC+ C K FT+   L++H  +HTG++P+ C    C K F+ K N+  H  TH+ +
Sbjct: 628 FQCNFCGKRFTQGGNLRTHQRLHTGEKPYRC--EICDKRFSRKGNLAAHKLTHRDV 681

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 41  AEAPKLL-----RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMN 95
            E PK++     +++C  C ++F++S+ L+ HI  H G +PF C  + C K F    N+ 
Sbjct: 587 VEKPKVVHEGSKQHECPYCHRLFSQSTHLEVHIRSHLGYKPFQC--NFCGKRFTQGGNLR 644

Query: 96  RHFKTH 101
            H + H
Sbjct: 645 THQRLH 650

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 45.4 bits (106), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           + C  C K F RS  L+ H+  VH+ +RPF C    C K F+   N+++H KTHK+ G
Sbjct: 647 FHCHICPKSFKRSEHLKRHVRSVHSNERPFAC--HICDKKFSRSDNLSQHIKTHKKHG 702

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 48  RYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLG 105
           ++ C  C + F R   L+ H+  +H G++PF C    C K F+   N+N+H KTH + G
Sbjct: 339 QFACDFCDRRFKRQEHLKRHVRSLHMGEKPFDC--QICGKKFSRSDNLNQHVKTHSEGG 395

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           ++C  C K F R    + HI  HTG++P  C    C K F+    + RH +TH
Sbjct: 13  FKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTH 65

>NDAI0B01930 Chr2 (468399..469709) [1311 bp, 436 aa] {ON} Anc_8.144
          Length = 436

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P  ++     ++ C  C + F R   L+ H+  +H G +P+ C    C K+F+ 
Sbjct: 372 RKPSLIPDASK-----QFGCEYCERRFKRQEHLKRHVRSLHIGVKPYTC--HICQKNFSR 424

Query: 91  KSNMNRHFKTH 101
             N+++H KTH
Sbjct: 425 SDNLSQHIKTH 435

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +QC+ C + F+R + L+ H+  H+ D+PF C  S C K    K  + RH  TH
Sbjct: 81  FQCTVCARQFSRKTHLERHMFSHSEDKPFKC--SYCGKGVTTKQQLRRHEITH 131

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSF 88
           ++CS C K  T    L+ H + HT  R FVCPH  C +SF
Sbjct: 109 FKCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESF 146

 Score = 35.8 bits (81), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 54  CLKVFTRSSALQSH-ILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K F+R S L  H  +VH G +PF C  + C++ F+ K+++ RH  +H +
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQC--TVCARQFSRKTHLERHMFSHSE 105

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%)

Query: 37  VPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNR 96
           VP  A+  +L        LK +  S      +L+++  R   CP+  C ++F  +     
Sbjct: 319 VPDRAQESELDSIATEVHLKKYLDSGKSSISLLLNSAGRKLKCPYLKCYRTFKTEEKYEM 378

Query: 97  HFKTHK 102
           H + HK
Sbjct: 379 HIQKHK 384

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTG---DRPFVCPHSSCSKSFNVKSNMNRHFK-TH 101
           L +  C  C K F R   L++HI  H      + + C   SC ++F   S + +H K TH
Sbjct: 161 LQKLNCEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMKETH 220

Query: 102 KQL 104
            +L
Sbjct: 221 PKL 223

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 25/53 (47%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C   F R      HI  HTG++PF C    C K F+    + RH KTH
Sbjct: 12  YLCEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTH 64

>KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.326
           YLR131C
          Length = 645

 Score = 45.1 bits (105), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 54  CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K+F R   ++SHI  H  DRP+ C    C+K+F    ++ RH K+H +
Sbjct: 519 CKKLFKRRYNIRSHIQTHLEDRPYTCDFPGCTKAFVRNHDLVRHKKSHSE 568

>SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 385

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 1/81 (1%)

Query: 28  TSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKS 87
           T+ P R   +  PA+  +   Y+C  C K F R    + HI  HTG++P  C    C K 
Sbjct: 5   TAEPMRHKKMEYPADNDQR-PYKCELCNKGFHRLEHKRRHIRTHTGEKPHACTFPGCMKR 63

Query: 88  FNVKSNMNRHFKTHKQLGLRR 108
           F+    + RH + H     R+
Sbjct: 64  FSRSDELKRHLRIHTNTSKRK 84

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 44.7 bits (104), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 48  RYQC--SRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++QC   +C K F R   ++SHI  H  DRP+ C    C K+F    ++ RH K+H +
Sbjct: 485 KFQCLYPKCDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCDKAFVRNHDLIRHKKSHAE 542

 Score = 27.7 bits (60), Expect = 6.3,   Method: Composition-based stats.
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query: 74  DRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           D+ F C +  C K+F  + N+  H +TH
Sbjct: 483 DKKFQCLYPKCDKTFKRRYNIRSHIQTH 510

>NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa]
           {ON} Anc_7.543
          Length = 433

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           ++C +C K F+R + L+ H++ H+  +PF C H  C K    +  + RH  TH +
Sbjct: 88  FKCEQCDKQFSRKTHLERHLISHSDSKPFCCLH--CGKGVTTRQQLKRHEVTHTK 140

 Score = 40.0 bits (92), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 52  SRCLKVFTRSSALQSHILV-HTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           S C K FTR S L  H L  H G +PF C    C K F+ K+++ RH  +H
Sbjct: 62  SGCTKAFTRPSLLSEHQLTFHQGIKPFKC--EQCDKQFSRKTHLERHLISH 110

 Score = 32.0 bits (71), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 67  HILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           ++L++T  R F CP  +CS++F ++    +H + HK
Sbjct: 361 NLLLNTVGRKFRCPFLNCSRTFKLEERYKKHIEKHK 396

 Score = 31.6 bits (70), Expect = 0.34,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTG---DRPFVCPHSSCSKSFNVKSNMNRHFK 99
           L +  C  C K F R   LQ+HI  H       P+ C  ++C +SF   +    H K
Sbjct: 168 LEKLTCKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFANCHRSFRTWTLYQSHVK 224

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT ++PF+C    C+K+F  + +  RH   H
Sbjct: 580 YICELCNKTFTRPYNLKSHLRTHTNEKPFIC--KICNKAFARQHDRKRHEDLH 630

 Score = 33.1 bits (74), Expect = 0.085,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 7/59 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHS-------SCSKSFNVKSNMNRHFKT 100
           + C  C K F R    + H  +HTG + ++C           C K F     + RHFKT
Sbjct: 608 FICKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALGRHFKT 666

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           L  +QC +C K F + S L+ H+  H+  +PF C  S C K    +  + RH  TH +
Sbjct: 77  LRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQC--SYCGKGVTTRQQLKRHEVTHTK 132

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 54  CLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           C K FTR S L  H L VH G R F C    C+KSF  KS++ RH  TH
Sbjct: 56  CDKAFTRPSILTEHQLSVHQGLRAFQC--DKCAKSFVKKSHLERHLYTH 102

 Score = 33.9 bits (76), Expect = 0.047,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%)

Query: 46  LLRYQCSRCLKVFTRSSALQSHILVHTG---DRPFVCPHSSCSKSFNVKSNMNRHFK 99
           L +  C  C K F R   L++HI  H     + P+ C  + C K F + S +  H K
Sbjct: 160 LHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIK 216

 Score = 32.7 bits (73), Expect = 0.13,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRH 97
           +QCS C K  T    L+ H + HT  + F+CP   C+  F     +  H
Sbjct: 108 FQCSYCGKGVTTRQQLKRHEVTHT--KSFICPEEGCNLRFYKHPQLRAH 154

 Score = 29.3 bits (64), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 22/36 (61%)

Query: 67  HILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHK 102
           ++L++T  R + C +++CS++F  K    +H   HK
Sbjct: 355 NLLLNTVGRKYRCFYNNCSRTFKTKEKYEKHIDKHK 390

>KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON}
           Anc_3.281 YBR066C
          Length = 249

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           +Y C  C K FT S  L  H  +HTG++   CP   C + F+ + N  +H++TH
Sbjct: 171 KYICKTCSKGFTTSGHLARHNRIHTGEKNHECPFEGCQQRFSRQDNCLQHYRTH 224

>SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar to
           uniprot|Q12041 Saccharomyces cerevisiae YDR253C MET32
           Zinc-finger DNA-binding protein, involved in regulating
           expression of the methionine biosynthetic genes
          Length = 205

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 20  PRHSSAPLTSAPQRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHILVHTGDRPFVC 79
           PR      TS+     +V    +  +  +YQC +C  VF RSS L+ H   H    P +C
Sbjct: 96  PRKKRHKSTSSSTEADSVEDVQQLNEDKKYQCDKCELVFRRSSDLRRHERAHLPILPNIC 155

Query: 80  PHSSCSKSFNVKSNMNRHFKT 100
             S C K F  K  + RH+ T
Sbjct: 156 --SLCGKGFARKDALKRHYDT 174

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%)

Query: 54  CLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQ 103
           C K F R   ++SHI  H  D+P+ C    C+K+F    ++ RH KTH +
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101
           Y C  C K FTR   L+SH+  HT +RPF C  + C K+F  + +  RH   H
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSC--AICGKAFARQHDRKRHEDLH 463

 Score = 35.4 bits (80), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 7/60 (11%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVC-------PHSSCSKSFNVKSNMNRHFKTH 101
           + C+ C K F R    + H  +HTG + + C           C K F     + RHFKT 
Sbjct: 441 FSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHFKTE 500

>NCAS0B04600 Chr2 complement(837037..838680) [1644 bp, 547 aa] {ON}
           Anc_8.144
          Length = 547

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 32  QRPSAVPTPAEAPKLLRYQCSRCLKVFTRSSALQSHIL-VHTGDRPFVCPHSSCSKSFNV 90
           ++PS +P   +     ++ C  C + F R   L+ H+  +H G++P+ C    C+K+F+ 
Sbjct: 483 RKPSLLPDATK-----QFACDYCERRFKRQEHLKRHVRSLHIGEKPYAC--HICNKNFSR 535

Query: 91  KSNMNRHFKTH 101
             N+ +H KTH
Sbjct: 536 SDNLTQHIKTH 546

>KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518
           YGL209W
          Length = 439

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           Y+C  C + F R    + H+  HTG++P  C    C+K F+    + RH +TH  +  R 
Sbjct: 20  YKCGICSRGFHRLEHKKRHLRTHTGEKPHKCVFPGCTKGFSRGDELKRHLRTHTGISSRN 79

>Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W
           (REAL)
          Length = 383

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTHKQLGLRR 108
           ++C  C + F R    + H+  HTG++P  C    C KSF+    + RH +TH     RR
Sbjct: 17  FRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQRR 76

>YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}
           MET31Zinc-finger DNA-binding protein, involved in
           transcriptional regulation of the methionine
           biosynthetic genes, similar to Met32p
          Length = 177

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 48/105 (45%), Gaps = 10/105 (9%)

Query: 2   QRQPASPSWAGPEHIL--GLPRHSSAPLTSAPQ----RPSAVPTPAEAPKLLRYQCSRCL 55
           Q  P S     PE++L  G P + +  L   P+    R        E  +L  Y C++C 
Sbjct: 44  QSSPLSAVIPAPENVLKAGEPENMARGLIRIPETQTKRTGGNNHSKEGAQL--YSCAKCQ 101

Query: 56  KVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKT 100
             F+RSS L+ H  VH+   P +C  S+C K F  K  + RH  T
Sbjct: 102 LKFSRSSDLRRHEKVHSLVLPHIC--SNCGKGFARKDALKRHSNT 144

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 3/60 (5%)

Query: 49  YQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFK-THKQLGLR 107
           Y+C+ C K+F R + L+ H L HT DR F+CP   C      + N+ +H K  H +L ++
Sbjct: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCP--WCKSKHKRRDNLFKHIKLKHMELLMK 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.129    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,874,115
Number of extensions: 442059
Number of successful extensions: 3375
Number of sequences better than 10.0: 628
Number of HSP's gapped: 2891
Number of HSP's successfully gapped: 883
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)