Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06776g2.530ON40940918200.0
Kwal_26.80012.530ON41341812581e-172
SAKL0A09416g2.530ON38541610391e-139
YHR004C (NEM1)2.530ON4463729201e-120
Suva_8.582.530ON4524099001e-117
CAGL0K02959g2.530ON4643728941e-116
Skud_8.492.530ON4474108841e-115
NCAS0F009302.530ON4224498801e-115
TDEL0A030502.530ON3554108631e-113
Smik_8.532.530ON4463708541e-110
NDAI0H014202.530ON4483898541e-110
KAFR0A018302.530ON4424168421e-109
TPHA0G035002.530ON3923628351e-108
Kpol_348.82.530ON4224608291e-107
AGL070W2.530ON3434068211e-107
Ecym_72572.530ON3524148191e-106
KNAG0C058502.530ON4433658261e-106
ZYRO0B01958g2.530ON3363427311e-93
TBLA0I014602.530ON3933597352e-93
KLLA0E18613g2.530ON3744466715e-84
SAKL0G12870g5.202ON3991492517e-23
Kpol_2002.1005.202ON4771582511e-22
Smik_12.535.202ON4141712455e-22
YLR019W (PSR2)5.202ON3971622429e-22
Smik_12.825.202ON3921622411e-21
NDAI0I021705.202ON3911642401e-21
TBLA0C060905.202ON4841602422e-21
Skud_12.875.202ON3921602383e-21
CAGL0D05610g5.202ON4471532376e-21
Ecym_71045.202ON4921642387e-21
Suva_10.995.202ON3851682357e-21
KLTH0B03388g5.202ON4091602359e-21
Skud_12.575.202ON4151602351e-20
AAL158W5.202ON4781622361e-20
NDAI0D018605.202ON5141662371e-20
YLL010C (PSR1)5.202ON4271712351e-20
KNAG0M017405.202ON4811542361e-20
Kpol_478.165.202ON3501602321e-20
NCAS0D027405.202ON3981502332e-20
Kwal_33.151405.202ON4101492332e-20
KAFR0J009905.202ON4831592342e-20
KLLA0F15620g5.202ON4141602322e-20
CAGL0D03234g5.202ON4101602322e-20
TDEL0E042705.202ON4531602332e-20
Suva_10.655.202ON4151602261e-19
ZYRO0B10428g5.202ON4821652272e-19
TPHA0N006705.202ON4521502262e-19
NCAS0A068005.202ON4731512244e-19
TPHA0E030705.202ON4941642235e-19
TBLA0H019905.202ON6881542212e-18
YPL063W (TIM50)8.527ON4761001755e-13
Smik_16.1728.527ON4771001685e-12
Suva_16.2498.527ON4801001667e-12
TDEL0B031908.527ON4771041668e-12
SAKL0H10296g8.527ON4781001659e-12
NDAI0E029108.527ON4411001613e-11
NCAS0C022108.527ON4911001613e-11
ZYRO0F09130g8.527ON4891001579e-11
Kpol_457.58.527ON4891001571e-10
Kwal_27.119908.527ON4741001571e-10
KLLA0E23101g8.527ON4801041561e-10
CAGL0H05159g8.527ON4851001561e-10
TBLA0A005408.527ON4851001552e-10
KLTH0E12254g8.527ON4761001542e-10
TPHA0I020008.527ON4781001542e-10
Skud_16.2188.527ON4801041543e-10
Ecym_11778.527ON4901001401e-08
ADR045W8.527ON476991346e-08
KAFR0E010208.527ON4481001338e-08
KNAG0A020608.527ON4501451321e-07
ZYRO0A04950g3.188ON61840695.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06776g
         (409 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   705   0.0  
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   489   e-172
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   404   e-139
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   358   e-120
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   351   e-117
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   348   e-116
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   345   e-115
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   343   e-115
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   337   e-113
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   333   e-110
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    333   e-110
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   328   e-109
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   326   e-108
Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   323   e-107
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   320   e-107
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   320   e-106
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   322   e-106
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   286   1e-93
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   287   2e-93
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   263   5e-84
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   101   7e-23
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...   101   1e-22
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    99   5e-22
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    98   9e-22
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    97   1e-21
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     97   1e-21
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    98   2e-21
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    96   3e-21
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    96   6e-21
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    96   7e-21
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    95   7e-21
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    95   9e-21
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    95   1e-20
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    96   1e-20
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     96   1e-20
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    95   1e-20
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    96   1e-20
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    94   1e-20
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    94   2e-20
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    94   2e-20
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    95   2e-20
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    94   2e-20
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    94   2e-20
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    94   2e-20
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    92   1e-19
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    92   2e-19
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    92   2e-19
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    91   4e-19
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    91   5e-19
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    90   2e-18
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    72   5e-13
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    69   5e-12
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    69   7e-12
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    69   8e-12
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    68   9e-12
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    67   3e-11
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     67   3e-11
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    65   9e-11
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    65   1e-10
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    65   1e-10
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    65   1e-10
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    65   1e-10
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    64   2e-10
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    64   2e-10
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    64   2e-10
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    64   3e-10
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    59   1e-08
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    56   6e-08
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    56   8e-08
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    55   1e-07
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...    31   5.9  

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/409 (86%), Positives = 354/409 (86%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWTLLWSMLAF 60
           MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWTLLWSMLAF
Sbjct: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWTLLWSMLAF 60

Query: 61  LPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR 120
           LPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR
Sbjct: 61  LPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR 120

Query: 121 ISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSL 180
           ISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRR          KTSRQSL
Sbjct: 121 ISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQQQQPKTSRQSL 180

Query: 181 KTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXX 240
           KT                   MGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIH     
Sbjct: 181 KTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHSMSRG 240

Query: 241 XXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPV 300
                  QGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPV
Sbjct: 241 TSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPV 300

Query: 301 IDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVD 360
           IDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVD
Sbjct: 301 IDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVD 360

Query: 361 NAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAFTNV 409
           NAIQVEGWIS              EALRFTTDIRNVLALKSGEHAFTNV
Sbjct: 361 NAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAFTNV 409

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  489 bits (1258), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 290/418 (69%), Gaps = 18/418 (4%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARID-----VAPKEAQKRKRARWTLLW 55
           MNAISYLTNN L PK E  +++P  +E S   N   +     +  K+ +K +  RW  LW
Sbjct: 1   MNAISYLTNNALTPKPEGPSSSPENIEGSADVNVSGNGKNPQLKVKKTRKSRGIRWAFLW 60

Query: 56  SMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNA---EGDSKSEASAGT 112
           S+L FLPNL+VVKP+LFVWFVITFPLSLIER+S+ E+ G G +++    G+  S+    T
Sbjct: 61  SILVFLPNLLVVKPILFVWFVITFPLSLIERSSTPESAG-GTESSLQRTGNLYSDEQVST 119

Query: 113 ISPKNSS--RISTITEEEDDLAGEEMILQADTVKGSLTVTSGAK-ERPQDKGRRXXXXXX 169
            S    S  RI+TI EE+DDL G+E+ LQ DTVKGSLT T+    E  QD  RR      
Sbjct: 120 TSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSRRQQHS-- 177

Query: 170 XXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDL 229
               K SRQS K                    MGRFLFPKKLIPQSVLNRRK RTLVLDL
Sbjct: 178 ----KGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLDL 233

Query: 230 DETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVF 289
           DETLIH            QGHMVEVKFA SGISTLYHVHKRPYCDLFLT IA WYELVVF
Sbjct: 234 DETLIHSMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVVF 293

Query: 290 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIID 349
           TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLS V PN  LSDIFIID
Sbjct: 294 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAPNTLLSDIFIID 353

Query: 350 NSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAFT 407
           NSPVSYAMHVDNAIQVEGWIS              EALRFTTD+RN+LALKSGEHAF+
Sbjct: 354 NSPVSYAMHVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFS 411

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  404 bits (1039), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 220/416 (52%), Positives = 271/416 (65%), Gaps = 43/416 (10%)

Query: 1   MNAISYLTNNILPPKHEEST--------ATPHRVEDSEKANARIDVAPKEAQKRKRARWT 52
           MNAISY+TN++ PPK +E+         A  H      + NA  D   K  Q +K  + +
Sbjct: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHGTVSKSEQNAPEDDEDKN-QTKKATKLS 59

Query: 53  LLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERA-SSSENQGMGFD-NAEGDSKSEASA 110
           LLWS++ FLPN  ++KPVLF W++ITFPL+LIE + +  E++  G + N+ GD +   S 
Sbjct: 60  LLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEEKTPSI 119

Query: 111 GTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXX 170
             I          + E+E+DLAG+E+ILQ D VKGSL+  S +++    K          
Sbjct: 120 NII----------VEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKA--------- 160

Query: 171 XXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLD 230
               ++R S+++                   MGRFLFPKKLIPQSVLN  K++ LVLDLD
Sbjct: 161 ----STRSSIRSGSTGTALGSRR--------MGRFLFPKKLIPQSVLNNEKKKILVLDLD 208

Query: 231 ETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFT 290
           ETLIH            QGHMVEVKFA SGIS+LY VHKRPYCDLFL+K+AKWY LVVFT
Sbjct: 209 ETLIHSMSRGTSSSNSSQGHMVEVKFAVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFT 268

Query: 291 ASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDN 350
           ASMKEYADPVIDWLESSF G FS+RLYRQDCILRDGVGYIKDLS ++   SL++I I+DN
Sbjct: 269 ASMKEYADPVIDWLESSFSGSFSQRLYRQDCILRDGVGYIKDLS-LISKKSLNEIIIVDN 327

Query: 351 SPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           SP+SYAM+VDNAIQVEGWIS              EALRFTTDIRNVL+LKSGE AF
Sbjct: 328 SPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIRNVLSLKSGEQAF 383

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  358 bits (920), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 187/372 (50%), Positives = 237/372 (63%), Gaps = 37/372 (9%)

Query: 52  TLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIER-ASSSENQGMGFDNAEGD-----SK 105
           ++LW++L FLP  +++KP++ +WFV TFPLS+IER    ++ +  G + +E +     S 
Sbjct: 94  SILWALLLFLPYYLIIKPLMSLWFVFTFPLSVIERRVKHTDKRNRGSNASENELPVSSSN 153

Query: 106 SEASAGTISPKNSSRISTITEE-EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRR 163
              S+   +PKN + ++TI E  EDDL A +E+ILQ D VKGSL      K RP+   + 
Sbjct: 154 INDSSEKTNPKNCN-LNTIPEAVEDDLNASDEIILQRDNVKGSLLRAQSVKSRPRSYSKS 212

Query: 164 XXXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRR 223
                      T                          MGRFLFPKKLIP+SVLN +K++
Sbjct: 213 ELSLSNHSSSNT--------------------VFGTKRMGRFLFPKKLIPKSVLNTQKKK 252

Query: 224 TLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKW 283
            LV+DLDETLIH            QGH+VEVKF  SGI TLY +HKRPYCDLFLTK++KW
Sbjct: 253 KLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRPYCDLFLTKVSKW 312

Query: 284 YELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV------ 337
           Y+L++FTASMKEYADPVIDWLESSFP  FS+R YR DC+LRDGVGYIKDLS+V       
Sbjct: 313 YDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSIVKDSEENG 372

Query: 338 --PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRN 395
              ++SL D+ IIDNSPVSYAM+VDNAIQVEGWIS              EA+R++TD+RN
Sbjct: 373 KGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRN 432

Query: 396 VLALKSGEHAFT 407
           +LALK GE AF 
Sbjct: 433 ILALKHGEKAFN 444

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  351 bits (900), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 186/409 (45%), Positives = 246/409 (60%), Gaps = 33/409 (8%)

Query: 15  KHEESTATPHRVEDSEKANARIDVAPKEAQK-RKRARWTLLWSMLAFLPNLIVVKPVLFV 73
           +H  ST  P+  +  E+    +    K      K    ++LW++L FLP  +++KP++ +
Sbjct: 57  QHNSSTEGPNEPKQDEECTYSVSTKRKALHSILKEKIVSILWAILLFLPYYLIIKPLMSL 116

Query: 74  WFVITFPLSLIER--ASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR---ISTITE-E 127
           WFV TFPL++IER    + +      D+    S   + +G  + K  ++   ++TI E  
Sbjct: 117 WFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSHSGDFNEKQDAKNRNLNTIHEIV 176

Query: 128 EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXXXX 186
           EDDL A +E+ILQ D VKGSL   +      + K RR           ++  ++      
Sbjct: 177 EDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRYSKSEASLTNHSTANTV------ 230

Query: 187 XXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXX 246
                          MGRFLFPKKLIP+S+LN +K++ LV+DLDETLIH           
Sbjct: 231 ----------FGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRGTTHSNS 280

Query: 247 XQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLES 306
            QGH+VEVKF  SGISTLY +HKRPYCDLFLTK +KWY+L++FTASMKEYADPVIDWLE 
Sbjct: 281 SQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPVIDWLEG 340

Query: 307 SFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN---------ASLSDIFIIDNSPVSYAM 357
           SF   FS+R YR DC+LRDGVGYIKDLS++  +         +SL D+ IIDNSPVSYAM
Sbjct: 341 SFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSSLDDVIIIDNSPVSYAM 400

Query: 358 HVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           +VDNAIQVEGWIS              EA+R++TD+RN+LALK GE AF
Sbjct: 401 NVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 449

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  348 bits (894), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/372 (49%), Positives = 235/372 (63%), Gaps = 48/372 (12%)

Query: 51  WTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIE-----RASSSENQGMGFDNAEGDSK 105
           + ++WS++ F PN I++KP LFVWF++TFPLSLIE     R  ++EN+ +        S+
Sbjct: 122 FIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHL--------SQ 173

Query: 106 SEASAGTISPKNSSRISTITE--EEDDLAGEEMILQADTVKGSLTVT---SGAKERPQDK 160
           S A+    SP  S R++ I E  E+D ++GE M LQ D +KGSL  T   S      +D+
Sbjct: 174 SPATNKDNSP--SKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDR 231

Query: 161 GRRXXXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRR 220
           G++              +S                      MGRF FPKKLIP+S+L   
Sbjct: 232 GKKTTSTPSHTSNILGTKS----------------------MGRFQFPKKLIPRSILYSE 269

Query: 221 KRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKI 280
           K++TLV+DLDETLIH            Q H++EV+FA SG+STLY+VHKRPYCDLFL+K+
Sbjct: 270 KKKTLVIDLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKV 329

Query: 281 AKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV---- 336
            KWY L++FTASMKEYADPVIDWLESSF G F++R+YR  CI RDGVGYIKDL  +    
Sbjct: 330 CKWYNLIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPY 389

Query: 337 VPNAS--LSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIR 394
             NA+  L+D+ IIDNSPVSYAMHVDNAIQVEGWIS              EALR+TTD+R
Sbjct: 390 SKNATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVR 449

Query: 395 NVLALKSGEHAF 406
           NVLALK+ E AF
Sbjct: 450 NVLALKNSEKAF 461

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  345 bits (884), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/410 (45%), Positives = 247/410 (60%), Gaps = 39/410 (9%)

Query: 15  KHEESTATPHRVEDSEKANARIDVAPKEAQK-RKRARWTLLWSMLAFLPNLIVVKPVLFV 73
           +H  ST      + +E  N  + + PK  +   +R   ++LW++L FLP  +++KP++ +
Sbjct: 56  QHNHSTDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSL 115

Query: 74  WFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKN------SSRISTITEE 127
           WFV TFPLS+IER     ++        G+  S  S+G  +  N      +  ++TI E 
Sbjct: 116 WFVFTFPLSVIERRVKHTDKRHKEPGNSGNV-SSTSSGNGNDSNEKAGSKNGNLNTIPET 174

Query: 128 -EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXXX 185
            +DDL A +E+ILQ D VKGSL        + Q    R           T+  +  T   
Sbjct: 175 VDDDLNASDEIILQRDNVKGSLL-------KAQSVKSRSRSYSKSDVSLTNHSNTNTVFG 227

Query: 186 XXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXX 245
                           MGRFLFPKKLIP+S+LN +K++ LV+DLDETLIH          
Sbjct: 228 TKR-------------MGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRSTTHSN 274

Query: 246 XXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLE 305
             QGH+VEVKF  SGI TLY +HKRPYCD FLTK+++WY+L++FTASMKEYADPVIDWLE
Sbjct: 275 SSQGHLVEVKFGISGIPTLYFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLE 334

Query: 306 SSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN---------ASLSDIFIIDNSPVSYA 356
           SSFP  FS+R YR DC+LRDGVGYIKDLS++  +         +SL D+ IIDNSPVSYA
Sbjct: 335 SSFPANFSKRYYRSDCVLRDGVGYIKDLSIIKSSEENGKGSSPSSLDDVIIIDNSPVSYA 394

Query: 357 MHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           M+VDNAIQVEGWIS              EA+R++TD+RN+LALK GE AF
Sbjct: 395 MNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAF 444

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  343 bits (880), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/449 (44%), Positives = 259/449 (57%), Gaps = 73/449 (16%)

Query: 1   MNAISYLTNNILPPKH----EESTATPHRVE------------------DSEKANARIDV 38
           MNA+SY+++++  P H    +E T  P   E                  D + +    D 
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60

Query: 39  APKEAQKRKRARW---------TLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASS 89
           +     ++  A +          L W+ + F P  ++VKP+LF+WF++TFPL L+ER   
Sbjct: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGM- 119

Query: 90  SENQGMGFDNAEGDSKSEASAGTISPKNSSRISTITEE-EDDLAG-EEMILQADTVKGSL 147
              +       + D  S+ +A  + P  S  ++ I E  EDDLAG +E+ LQ DT+KGSL
Sbjct: 120 ---KHRTLLKNKLDENSQKNAERV-PTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSL 175

Query: 148 TVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLF 207
              + AK+    K  +           TS  S +                    MG+FLF
Sbjct: 176 LKATSAKQLSSSKTVKSISSN-----NTSFSSKR--------------------MGKFLF 210

Query: 208 PKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHV 267
           PKKLIP+S++   +R+ LVLDLDETLIH            QGH+VEVKF+ SG+STLY+V
Sbjct: 211 PKKLIPRSIVQTNRRKKLVLDLDETLIHSMSRGTTHSNSSQGHIVEVKFSVSGVSTLYYV 270

Query: 268 HKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGV 327
           HKRPYCD FL+K++KWY+L++FTASMKEYADPVIDWLE S P KFS+RLYR DCILRDGV
Sbjct: 271 HKRPYCDFFLSKVSKWYDLIIFTASMKEYADPVIDWLEDSLPDKFSQRLYRTDCILRDGV 330

Query: 328 GYIKDLSVVVPNA----------SLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXX 377
           GYIKDLSV+   +          SL +I IIDNSP+SYAM+V+NAIQVEGWIS       
Sbjct: 331 GYIKDLSVISEASGMKNISALPPSLGEIIIIDNSPISYAMNVENAIQVEGWISDPTDNAL 390

Query: 378 XXXXXXXEALRFTTDIRNVLALKSGEHAF 406
                  EALRFTTD+RNVLALK+GE AF
Sbjct: 391 LNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/410 (45%), Positives = 252/410 (61%), Gaps = 61/410 (14%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWT-LLWSMLA 59
           MNA+SY+++ +   K +++  T    ED E    ++ V  +E   R+R+++T   W+++ 
Sbjct: 1   MNAVSYISDQL--SKRDKNGKT----EDVED---KVAVQKREKIVRRRSKFTSYAWAVIL 51

Query: 60  FLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSS 119
           F P  +++KP   +W++I+ PL LIE    S  Q            ++ S GT+      
Sbjct: 52  FFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQ---------RKSTKRSTGTLQ----- 97

Query: 120 RISTITE-EEDDLAG-EEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSR 177
              +I+E EEDDLAG +E+ LQ D VKGSL         P    R             ++
Sbjct: 98  ---SISELEEDDLAGGDEIFLQRDAVKGSLA--------PAKYRRSRSGSRSSTVMLGTK 146

Query: 178 QSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXX 237
           +                       MGRFLFPKKLIP+SVL+  KR+ LV+DLDETLIH  
Sbjct: 147 R-----------------------MGRFLFPKKLIPRSVLHAEKRKRLVVDLDETLIHSA 183

Query: 238 XXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYA 297
                     QGHMVE++FA SG+STLY+VHKRP+CDLFL+K++KWY+LVVFTASM+EYA
Sbjct: 184 SRTTSHSNSAQGHMVEIRFAISGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA 243

Query: 298 DPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV-PNASLSDIFIIDNSPVSYA 356
           DPVIDWLE SF G+FS+RLYR +CILRDGVGYIKDLS+V  P  +L ++ ++DNSP+SYA
Sbjct: 244 DPVIDWLEGSFSGRFSKRLYRNNCILRDGVGYIKDLSIVCGPTVTLGEVILVDNSPISYA 303

Query: 357 MHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           M+VDNAIQVEGWIS              EALR+TTD+R++LALK+ E AF
Sbjct: 304 MNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  333 bits (854), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/370 (51%), Positives = 239/370 (64%), Gaps = 35/370 (9%)

Query: 52  TLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIER--ASSSENQGMGFDNAEGDSKSEAS 109
           ++LW++L FLP  +V+KP++ +W+V TFPLS+IER    + +      DN  G   S +S
Sbjct: 94  SILWALLLFLPYYLVIKPLMSLWYVFTFPLSVIERRVKHTDKRNKESSDNENGSPTSSSS 153

Query: 110 AGTISPKNSSR---ISTITEE-EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRX 164
           AG  S K +S+   ++TI+E  EDDL A +E+ILQ D VKGSL      K R +   +  
Sbjct: 154 AGDSSEKINSKNCNLNTISETVEDDLNASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSE 213

Query: 165 XXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRT 224
                     T+  S  T                   MGRFLFPKKLIP+SVLN +K++ 
Sbjct: 214 VSL-------TNHSSTNTVFGTKR-------------MGRFLFPKKLIPKSVLNTQKKKK 253

Query: 225 LVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWY 284
           LV+DLDETLIH            QGH+VEVKF  SGI TLY +HKRPYCDLFLTK++KWY
Sbjct: 254 LVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHKRPYCDLFLTKVSKWY 313

Query: 285 ELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV------- 337
           EL++FTASMKEYADPVIDWLESSFP  FSRR YR DC+LRDGVGYIKDLS++        
Sbjct: 314 ELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIKDLSIIKNSEENEK 373

Query: 338 -PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNV 396
             ++SL D+ IIDNSPVSYAM+VDNAIQVEGWIS              EA+R++TD+RN+
Sbjct: 374 GSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNI 433

Query: 397 LALKSGEHAF 406
           LALK GE AF
Sbjct: 434 LALKHGEKAF 443

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  333 bits (854), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 175/389 (44%), Positives = 239/389 (61%), Gaps = 39/389 (10%)

Query: 30  EKANARIDVAPKEAQKRKRARWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASS 89
           E+ ++ ++V   + +K K    ++LWS L F P ++++KP+LF+W+++TFPLSLIER + 
Sbjct: 83  EEGHSSLNVT--DDRKTKNNVTSILWSFLLFFPKILIIKPILFLWYILTFPLSLIERGTK 140

Query: 90  SENQGMGFDNAEGDSKSEA--SAGTISPKNSSRISTITE--EEDDLAGEEMILQADTVKG 145
              +           K E      +  P+  S++  I E  E+D ++G+ + LQ D VKG
Sbjct: 141 YRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSKLDAINELTEDDLVSGDGIYLQRDNVKG 200

Query: 146 SLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRF 205
           SL   S  ++                   +  +S+KT                   MG+F
Sbjct: 201 SLLKASSVRQ------------------PSLSRSMKTMVSNNTSFSSKR-------MGKF 235

Query: 206 LFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLY 265
           LFPKKLIP+S+    +R+ LVLDLDETLIH            QGH+VEVKF++SG+S LY
Sbjct: 236 LFPKKLIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLY 295

Query: 266 HVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRD 325
           +VHKRPYCD FL+K+ KWY+L++FTASMKEYADPVIDWLE+SF G F+ R YR DCI RD
Sbjct: 296 YVHKRPYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRD 355

Query: 326 GVGYIKDLSVV-------VPNAS-LSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXX 377
           GVGYIKDL+++       VP  S LS++ I+DNSP+SYAM+ DNAIQVEGWIS       
Sbjct: 356 GVGYIKDLTIIKDDSNVSVPQTSTLSEVIILDNSPISYAMNADNAIQVEGWISDPTDTAL 415

Query: 378 XXXXXXXEALRFTTDIRNVLALKSGEHAF 406
                  EALR+TTD+R++LALK+GE AF
Sbjct: 416 LNLLPLLEALRYTTDVRSILALKNGERAF 444

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  328 bits (842), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 181/416 (43%), Positives = 245/416 (58%), Gaps = 53/416 (12%)

Query: 20  TATPHR----VEDSEKANARIDVAPKEAQKRKRAR----------WTLLWSMLAFLPNLI 65
            A+P +    V+D+   N    +  K+   RKR            ++LL +++ F+P  +
Sbjct: 54  NASPEKGLSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYL 113

Query: 66  VVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTIT 125
            + P+++VWF++T PL+L+ER       G+   + +  ++   + G  S  +  R  +  
Sbjct: 114 FLNPLIYVWFILTLPLTLVER-------GIKLRDRKKKAELRGNFGESSELSPLRSISEV 166

Query: 126 EEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXXX 185
            EED    +E  LQ DT+KGSL   S   ++P    R           K   +++ T   
Sbjct: 167 GEEDLSTSDEFFLQRDTIKGSLLRASS--DKPPVFQR------YKSTIKQDHEAMNTNIF 218

Query: 186 XXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXX 245
                           MGRFLFPKKLIP+S+L   +++TLV+DLDETLIH          
Sbjct: 219 GTKK------------MGRFLFPKKLIPRSILCNERKKTLVVDLDETLIHSVSRGTTHVN 266

Query: 246 XXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLE 305
             QGH+VEVKF+ +GISTLY+VHKRP+CDLFL+K++KWY +V+FTASMKEYADPVIDWLE
Sbjct: 267 SSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYADPVIDWLE 326

Query: 306 SSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV------------PNASLSDIFIIDNSPV 353
            SF G F++RLYR +C+LRDGVGYIKDLSV+V            P   L ++ IIDNSPV
Sbjct: 327 GSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNANHAQDNKTFLPVEGLHEVIIIDNSPV 386

Query: 354 SYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAFTNV 409
           SYA++VDNAIQVEGWIS              EALR+TTD+RNVLALK+GE  F NV
Sbjct: 387 SYALNVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMFENV 442

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  326 bits (835), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 178/362 (49%), Positives = 223/362 (61%), Gaps = 46/362 (12%)

Query: 68  KPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTI--- 124
           KP+LF W+++TFPL+L E+ +S  N G   D+   +S S+AS  +I+  N+  ++     
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNS--NNGRSRDSQTANSLSDAS--SIANNNAFYVTKGRKR 106

Query: 125 TEE--------EDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTS 176
           TE+        EDD+ G EMILQ DTVKGSL   S   + P   G             + 
Sbjct: 107 TEQLQNLDSVLEDDMKGGEMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSV 166

Query: 177 RQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHX 236
               K                    MGRFLFPKKLIP+S+L+  +++ LVLDLDETLIH 
Sbjct: 167 AFGTK-------------------KMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHS 207

Query: 237 XXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEY 296
                      Q H+VEVKF  SGISTLY+VHKRPYCDLFL+ ++KWY+L++FTASMKEY
Sbjct: 208 ISRSNSNSNNAQAHLVEVKFQISGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEY 267

Query: 297 ADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSV------------VVPNASLSD 344
           ADPVIDWLESSF G FS+R YR  CILRDGVGYIKDLS+            V  N+ L +
Sbjct: 268 ADPVIDWLESSFVGNFSKRYYRNHCILRDGVGYIKDLSIINDTNDDHGNELVRANSILHE 327

Query: 345 IFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEH 404
           I +IDNSPVSYAM+VDNAIQVEGWIS              E+LR+TTD+RN+L+LK+GE 
Sbjct: 328 IILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNILSLKNGER 387

Query: 405 AF 406
           AF
Sbjct: 388 AF 389

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  323 bits (829), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/460 (40%), Positives = 253/460 (55%), Gaps = 94/460 (20%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSE-----------KANARIDVAPKEAQKRKRA 49
           MNA+SY+++N++ P  EE   +  + ED +            +  +I    ++       
Sbjct: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60

Query: 50  RWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEAS 109
           R TL+  +L F P  ++VKP+ F+WF+ITFP++L E+    +N+ +         KS A+
Sbjct: 61  RSTLVLVLL-FFPKYLLVKPIFFLWFLITFPITLFEQ----KNKKL--------PKSSAN 107

Query: 110 AGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXX 169
             T+S    S+   I  EED   G E+ILQ DT+ GSL + S A ++   + R       
Sbjct: 108 LDTMS---KSKNLNILVEEDLSGGGEIILQRDTLNGSL-LKSRANQQHSHQSRHAKSSSS 163

Query: 170 XXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDL 229
                + +                        +GRFLFPKKLIP+S+L+  +++ LVLDL
Sbjct: 164 SVGLISKK------------------------IGRFLFPKKLIPRSILHSGRKKKLVLDL 199

Query: 230 DETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVF 289
           DETLIH            Q H+VEVKF  SGISTLY+VHKRPYCDLFL+K+ +WY+L++F
Sbjct: 200 DETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIF 259

Query: 290 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV------------- 336
           TASMKEYADPVIDWLE+SF G FS+R YR DCILRDGVGYIKDLS+V             
Sbjct: 260 TASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGSHAASTTS 319

Query: 337 -----------------------------VPNASLSDIFIIDNSPVSYAMHVDNAIQVEG 367
                                        + N  LS++ +IDNSPVSYAM+VDNAIQV+G
Sbjct: 320 HNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQG 379

Query: 368 WISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAFT 407
           WIS              E+LR TTD+RN+L+LK+GE AF 
Sbjct: 380 WISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFN 419

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  320 bits (821), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 189/406 (46%), Positives = 232/406 (57%), Gaps = 64/406 (15%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQKRKRARWTLLWSMLAF 60
           MN++SYLT          +     R   SE+  A++      A+    A    +W +L F
Sbjct: 1   MNSLSYLTG----ATQHAAGKGDGRWPGSERGLAKVREEQDAARAGVGAGAAWVWRVLFF 56

Query: 61  LPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSR 120
           LP  +VVKPV+ VWFV+TFPLSLIE+ SS E      D A G   +E             
Sbjct: 57  LPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEA-----DGAPGPEAAEEEQ---------- 101

Query: 121 ISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSL 180
                 E+DDLAGE M+LQ D+VK S   TS +       G                   
Sbjct: 102 -LAEAVEDDDLAGESMVLQEDSVKSSRPSTSRSSYTSTRLG------------------- 141

Query: 181 KTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXX 240
                                  +FLFPKKLIPQS+L   +++ LVLDLDETLIH     
Sbjct: 142 -----------------------KFLFPKKLIPQSILQTDRKKLLVLDLDETLIHSMSRS 178

Query: 241 XXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPV 300
                  QGHMVEV FA SG+STLY+VHKRPYCDLFL++++KWY+LV+FTASMKEYADPV
Sbjct: 179 TSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLFLSRVSKWYDLVIFTASMKEYADPV 238

Query: 301 IDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVD 360
           IDWLES    +FS+R YR DC+LRDGVGY+KDLS++  N  L DI I+DNSP+SYAM+VD
Sbjct: 239 IDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSIISKN--LQDIIIVDNSPISYAMNVD 296

Query: 361 NAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           NAIQVEGWIS              E LRFTTD RN+L+LK+GE AF
Sbjct: 297 NAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  320 bits (819), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/414 (42%), Positives = 233/414 (56%), Gaps = 71/414 (17%)

Query: 1   MNAISYLTNNILPPKHEES--------TATPHRVEDSEKANARIDVAPKEAQKRKRARWT 52
           MN++SYLT +  P    +         ++ P+  E+ E  N  +      +Q  K  R +
Sbjct: 1   MNSLSYLTGSSQPTSSSKEELRFPFSESSLPNVTEEQEVENGEV------SQDSKGGRPS 54

Query: 53  LLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGT 112
            +W ++ FLP  +++KP+  +WFV+TFPL+LIE  SS +      +    +S+       
Sbjct: 55  WVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSKDGSVEEEEVIPTNSQGSGGGEV 114

Query: 113 ISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXX 172
           I             E+DDL GE M+L  D++K S   TS +       G           
Sbjct: 115 I-------------EDDDLVGESMVLHEDSIKSSRPSTSRSSYTSTRLG----------- 150

Query: 173 XKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDET 232
                                          +FLFPKKLIPQS+L   +++ LVLDLDET
Sbjct: 151 -------------------------------KFLFPKKLIPQSILQTDRKKVLVLDLDET 179

Query: 233 LIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTAS 292
           LIH            QGHMVEV F+ SG+S+LY+VHKRPYCDLFL+++ KWY+LV+FTAS
Sbjct: 180 LIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKRPYCDLFLSRVCKWYDLVIFTAS 239

Query: 293 MKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSP 352
           M+EYADPVIDWLES    +F++R YR DCILRDG+GY+KDL+++  N  L D  I+DNSP
Sbjct: 240 MREYADPVIDWLESGISARFTKRKYRSDCILRDGIGYVKDLTMISKN--LQDTIIVDNSP 297

Query: 353 VSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           VSYAM+VDNAIQVEGWIS              E LRFTTD RN+L+LK+GEHAF
Sbjct: 298 VSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  322 bits (826), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/365 (49%), Positives = 230/365 (63%), Gaps = 34/365 (9%)

Query: 51  WTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASA 110
           W +L  ++ FLP  ++ KP+L +WF++T PL+L+ER       G+   N       + S 
Sbjct: 101 WNVLVFVIFFLPTYLIYKPLLLLWFLVTLPLALVER-------GIKLRNRPKMKTEKVSE 153

Query: 111 GTISPKNSSRISTITEE-EDDL-AGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXX 168
             +S  + S++ +I EE E+DL AG+E  LQ D VKGSL   +  K     K ++     
Sbjct: 154 LVLS--DPSKLGSINEEVEEDLAAGDEFYLQRDIVKGSLLKATTNKHHTPLKSKKNSAQN 211

Query: 169 XXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLD 228
                     ++                     MGRFLFPKKLIP+S+LNR K++TLV+D
Sbjct: 212 QHGNETHPNSTV----------------FGTKKMGRFLFPKKLIPKSILNREKKKTLVMD 255

Query: 229 LDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVV 288
           LDETLIH            QGH+VEVKF+ SG+STLY+V KRPYCDLFLTK++KWY++V+
Sbjct: 256 LDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYVFKRPYCDLFLTKVSKWYDIVI 315

Query: 289 FTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLS----- 343
           FTASMKEYADPVIDWLESSF GKFSRRLYR DCILRDGVGYIKDL +V   ++L      
Sbjct: 316 FTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGVGYIKDLKMVTRGSNLGTSPDR 375

Query: 344 --DIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKS 401
             D+ I+DNSPVSYA++VDNAIQVEGWI+              EAL  TTD+RN+L+LK+
Sbjct: 376 LEDVIIVDNSPVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKN 435

Query: 402 GEHAF 406
           GE AF
Sbjct: 436 GEKAF 440

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  286 bits (731), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 161/342 (47%), Positives = 200/342 (58%), Gaps = 65/342 (19%)

Query: 65  IVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTI 124
           I +KP   +WFVIT PL LIE    S+ +           +S +  G I  K        
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQK----------VESTSRKGEIIRKK------- 101

Query: 125 TEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLKTXX 184
            E +DDLA +EM LQ DTVKG L        R +  G +                     
Sbjct: 102 -EVDDDLAEDEMFLQRDTVKGGL--------RGKAFGTKK-------------------- 132

Query: 185 XXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXX 244
                            MGRFLFPKKL+PQS+L   +++ LV+DLDETLIH         
Sbjct: 133 -----------------MGRFLFPKKLVPQSILFAERKKRLVVDLDETLIHSATRSVSHS 175

Query: 245 XXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWL 304
              QGHMVEV+F  S ISTLY+VHKRP+CDLFL+K++KWY+L++FTASMKEYADPVIDWL
Sbjct: 176 NSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWL 235

Query: 305 ESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQ 364
           ESSF GKF +RLYR +C++R+GVGYIKDLSVV     L ++ +IDNSP SYA + DNAIQ
Sbjct: 236 ESSFTGKFCKRLYRHNCVVREGVGYIKDLSVV--TEVLDEVVLIDNSPTSYARNEDNAIQ 293

Query: 365 VEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           VEGWIS              EALR+ TD+R++L LK+GE A 
Sbjct: 294 VEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKAL 335

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  287 bits (735), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 212/359 (59%), Gaps = 42/359 (11%)

Query: 65  IVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEASAGTISPKNSSRISTI 124
           I++KP++F+W++ TFPL LIE+ +              + K + +   I PK +S  S+ 
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQHT--------------NRKYKDTPPLIDPKIAS--SSA 100

Query: 125 TEEEDDLAGEEMILQADTVKGSL---TVTSGAKERPQDKGRRXXXXXXXXXXKTSRQSLK 181
           T+ +D  + +E+ILQ D++KGSL     TS A                    K   +S+ 
Sbjct: 101 TDLDDLNSNDEIILQTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVY 160

Query: 182 TXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXX 241
           +                   MGRFLFPKKLIP S+L   KR+ L+LDLDETLIH      
Sbjct: 161 SLTSNFIGSKN---------MGRFLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNI 211

Query: 242 XXXXXXQGHMVEVKFATSG------------ISTLYHVHKRPYCDLFLTKIAKWYELVVF 289
                   H++EVKF T              +S+LY+V+KRPYCD FL  ++ WY+L++F
Sbjct: 212 SSSTISNYHLIEVKFPTPTSAPTSAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIF 271

Query: 290 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPN--ASLSDIFI 347
           TASMKEYADPVIDWLE SF G F +RLYR  CILRDG+GYIKDLSV+  +  ++L+++ +
Sbjct: 272 TASMKEYADPVIDWLEDSFNGNFQKRLYRNHCILRDGIGYIKDLSVLNTDNQSTLNELIL 331

Query: 348 IDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXXXXEALRFTTDIRNVLALKSGEHAF 406
           IDNSP+S+AM+VDNAIQV+GWIS              E+LR TTD+RN+LALK+GE AF
Sbjct: 332 IDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHTTDVRNILALKNGERAF 390

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  263 bits (671), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 159/446 (35%), Positives = 218/446 (48%), Gaps = 110/446 (24%)

Query: 1   MNAISYLTNNILPPKHEESTATPHRVEDSEKANARIDVAPKEAQ---------------- 44
           MNAIS+L+N         +   P  V   EK    +D  P   Q                
Sbjct: 1   MNAISFLSN---------ALPAPQEVPIKEKEGILVDPTPTNTQPNKVKNKTTTASTTTS 51

Query: 45  ---------KRKRARWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGM 95
                    KR R     +W +L FLPN +++KP++ +W+VITFPL+L+E  ++  N+G+
Sbjct: 52  TTTTSTATNKRNRPFMRWIWCILIFLPNYLLIKPIITIWYVITFPLNLME-TNTQGNKGL 110

Query: 96  GFDNAEGDSKSEASAGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKE 155
               +E DS++E            ++S    EED    +E+I+  D +K           
Sbjct: 111 IQVGSETDSRTE------------KLSKYVVEEDLSPTDEIIINQDKMK----------P 148

Query: 156 RPQDKGRRXXXXXXXXXXKTSRQSLKTXXXXXXXXXXXXXXXXXXXMGRFLFPKKLIPQS 215
           RP                                            +G+F FPKKL+PQS
Sbjct: 149 RP----------------------------------------ITEYLGKFHFPKKLVPQS 168

Query: 216 VLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQG---------HMVEVKFATSGISTLYH 266
           +L    R+ LVLDLDETLIH                       H+VEV+F  + ISTLY+
Sbjct: 169 MLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPMIHLVEVRFPQTNISTLYN 228

Query: 267 VHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDG 326
           V KRPYCD+FL + ++WY++ +FTASMKEYADPVIDWL+ +   +F  R YR+DC LR G
Sbjct: 229 VAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTCSVQFHYRWYREDCTLRPG 288

Query: 327 VGYIKDLSVVVPNA----SLSDIFIIDNSPVSYAMHVDNAIQVEGWISXXXXXXXXXXXX 382
           VGY+KD+  V         LS + IIDNSP+SYAMH+DNAIQV GWI+            
Sbjct: 289 VGYVKDIGTVATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLP 348

Query: 383 XXEALRFTTDIRNVLALKSGEHAFTN 408
             +A+R  TD R +LALKSG  + +N
Sbjct: 349 LLKAMRHVTDSRCILALKSGRASISN 374

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 81/149 (54%), Gaps = 11/149 (7%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIA 281
           ++ LVLDLDETL+H                VE+      +    +V KRP  D FL ++ 
Sbjct: 229 KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDDQVHNV----YVIKRPGVDEFLERVG 282

Query: 282 KWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNAS 341
           K YE+VVFTAS+  Y DP++D L+    G    RL+R  C   DG  YIK+LS +     
Sbjct: 283 KLYEVVVFTASVSRYGDPLLDILDPR--GAVHHRLFRDSCYNYDG-NYIKNLSQI--GRP 337

Query: 342 LSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           LSD+ I+DNSP SY +H  +AI +  W S
Sbjct: 338 LSDLIILDNSPASYILHPQHAIPISSWFS 366

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 83/158 (52%), Gaps = 25/158 (15%)

Query: 220 RKRRTLVLDLDETLIHXXXXXXXXXX-------XXQGHMVEVKFATSGISTLYHVHKRPY 272
           + ++ LVLDLDETL+H                   Q H V             +V KRP 
Sbjct: 305 KNKKCLVLDLDETLVHSSFKYIDTADFVLPVTIDDQTHQV-------------YVIKRPG 351

Query: 273 CDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKD 332
            D FL ++ K +E+VVFTAS+  Y DP++D L+SS       RL+R+ C + DG  Y+K+
Sbjct: 352 VDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKN 408

Query: 333 LSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 409 LSQI--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 444

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 91/171 (53%), Gaps = 13/171 (7%)

Query: 202 MGRFLFP--KKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATS 259
            G++  P  K L+P    N + ++ L+LDLDETL+H                VE+     
Sbjct: 222 QGQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVH 279

Query: 260 GISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ 319
            +    +V KRP  + FL ++ K +E+VVFTAS+  Y DP++D L++        RL+R+
Sbjct: 280 NV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD--KVIHHRLFRE 333

Query: 320 DCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
            C   +G  YIK+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 334 ACYNYEG-NYIKNLSQI--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 381

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 97.8 bits (242), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 90/162 (55%), Gaps = 15/162 (9%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH-- 268
           L+P  +   ++++ L+LDLDETL+H              H  +          +++V+  
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFKYM--------HSADFVLPVEIDDQVHNVYVI 267

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL ++++ YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 324

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 325 YIKNLSQI--GRPLSETIILDNSPASYIFHPQHAVPISSWFS 364

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 97.4 bits (241), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 90/162 (55%), Gaps = 15/162 (9%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH-- 268
           L+P  +   ++++ L+LDLDETL+H              H  +          +++V+  
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYM--------HTADFVLPVEIDDQVHNVYVI 262

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL+++ + YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  
Sbjct: 263 KRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 319

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 320 YIKNLSQI--GRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 97.1 bits (240), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 88/164 (53%), Gaps = 15/164 (9%)

Query: 209 KKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH 268
           + L+P        ++ LVLDLDETL+H              H  +          +++V+
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVY 259

Query: 269 --KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDG 326
             KRP  D FL ++A+ YE+VVFTAS+  Y DP++D L+SS       RL+R+ C   +G
Sbjct: 260 VIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG 317

Query: 327 VGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
             Y+K+L+ +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 318 -NYVKNLAQI--GRPLSEIVILDNSPASYMFHPQHAIPISSWFS 358

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 86/160 (53%), Gaps = 9/160 (5%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P      + ++ L+LDLDETL+H               ++ ++     I  +Y V KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPDF----ILPIEIEDGQIHNVY-VIKR 355

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL ++ KWYE+V+FTAS+  YA+P++D L+       + RL+R  C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDH-NLINHRLFRDACYNYEN-NFI 413

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     L DI I+DNSP SY  H  +AI +  W S
Sbjct: 414 KNLSQI--GRPLHDIIILDNSPASYIFHPQHAIPISSWFS 451

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 89/160 (55%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P  +   ++++ L+LDLDETL+H                VE+      +    +V KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL ++++ YE+VVFTAS+  YA+P++D L+ +  G    RL+R+ C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 322 KNLSQI--GRPLSETIILDNSPASYIFHPQHAVPISSWFS 359

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 95.9 bits (237), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 82/153 (53%), Gaps = 15/153 (9%)

Query: 220 RKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH--KRPYCDLFL 277
           + ++ LVLDLDETL+H              H  +          +++V+  KRP  D FL
Sbjct: 275 KHKKCLVLDLDETLVHSSFKYL--------HTADFVLPVDIDDQIHNVYVIKRPGVDEFL 326

Query: 278 TKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVV 337
            ++ + YE+VVFTAS+  Y DP++D L+ S       RL+R  C   +G  YIK+LS + 
Sbjct: 327 QRVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQI- 382

Query: 338 PNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
               LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 383 -GRPLSEIIILDNSPPSYIFHPQHAIPISSWFS 414

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 59/164 (35%), Positives = 86/164 (52%), Gaps = 15/164 (9%)

Query: 209 KKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH 268
           + L+P       +R+ LVLDLDETL+H              H  +        + +++V+
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVY 360

Query: 269 --KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDG 326
             KRP  D FL ++ + YE+VVFTAS+  Y DP++D L+         RL+R  C   +G
Sbjct: 361 VIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDKH--NVVHHRLFRDSCYNYEG 418

Query: 327 VGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
             YIK+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 419 -NYIKNLSQI--GRPLSDLIILDNSPASYIFHPHHAIPISSWFS 459

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 95.1 bits (235), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 92/168 (54%), Gaps = 22/168 (13%)

Query: 206 LFPKKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLY 265
           L P KL+P      ++++ L+LDLDETL+H              H  +          ++
Sbjct: 204 LLPPKLLP-----FQQKKCLILDLDETLVHSSFKYL--------HTADFVLPVEIDDQVH 250

Query: 266 HVH--KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCI 322
           +V+  KRP  D FL ++++ YE+VVFTAS+  YA+P++D L+   P +    RL+R+ C 
Sbjct: 251 NVYVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLD---PNRTIHHRLFREACY 307

Query: 323 LRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
             +G  YIK+LS +     LS+  I+DNSP SY  H  +A+ +  W S
Sbjct: 308 NYEG-NYIKNLSQI--GRPLSETIILDNSPASYIFHPQHAVPISSWFS 352

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 84/160 (52%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P        ++ LVLDLDETL+H               ++ V+     +  +Y V KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADF----VIPVEIDNQ-VHNVY-VIKR 281

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL  + + YE+VVFTAS+  Y DP++D L+ +       RL+R  C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNH--CIHHRLFRDSCYNYDG-NYI 338

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 339 KNLSQI--GRPLSDLIILDNSPASYIFHPQHAIPISSWFS 376

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 87/160 (54%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P    + + ++ L+LDLDETL+H                VE+      +    +V KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  + FL ++ K +E+VVFTAS+  Y DP++D L+++       RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 345 KNLSQI--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 382

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 85/162 (52%), Gaps = 15/162 (9%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH-- 268
           L+P      R R+ LVLDLDETL+H              H  +        + +++V+  
Sbjct: 297 LLPPQRPEFRGRKCLVLDLDETLVHSSFKYL--------HTADFVIPVEIDNQVHNVYVI 348

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL ++ + +E+VVFTAS+  Y DP++D L+         RL+R  C   +G  
Sbjct: 349 KRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQY--KAVHHRLFRDSCYNYEG-N 405

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           YIK+LS +     LSD+ I+DNSP SY  H  +A+ +  W S
Sbjct: 406 YIKNLSQI--GRPLSDLIILDNSPASYIFHPQHAVPISSWFS 445

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 22/166 (13%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFA-----TSGISTLY 265
           L P+  +  + ++ LVLDLDETL+H              ++    F         I  +Y
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFK----------YLPNADFNLPVNIDDQIHNVY 381

Query: 266 HVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCILR 324
            V KRP  D FL K+ K +E+V+FTAS+  Y DP++D L+    GK    RL+R+ C   
Sbjct: 382 -VIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPK--GKSIHHRLFREACYNY 438

Query: 325 DGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           +G  YIK+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 439 EG-NYIKNLSQM--GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 481

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (52%), Gaps = 13/171 (7%)

Query: 202 MGRFLFP--KKLIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATS 259
            G++  P    L+P    + + ++ L+LDLDETL+H                VE+     
Sbjct: 235 QGQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQVH 292

Query: 260 GISTLYHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQ 319
            +    +V KRP  + FL ++ K +E+VVFTAS+  Y DP++D L++        RL+R+
Sbjct: 293 NV----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFRE 346

Query: 320 DCILRDGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
            C   +G  YIK+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 347 ACYNYEG-NYIKNLSQI--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 394

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 81/154 (52%), Gaps = 21/154 (13%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFA-----TSGISTLYHVHKRPYCDLF 276
           R+ LVLDLDETL+H              ++    F         I  +Y V KRP  D F
Sbjct: 311 RKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY-VIKRPGVDEF 359

Query: 277 LTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV 336
           L ++ K YE+VVFTAS+  Y DP++D L+         RL+R+ C   +G  YIK+LS +
Sbjct: 360 LRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYEG-NYIKNLSQI 416

Query: 337 VPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
                LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 417 --GRPLSNIIILDNSPASYIFHPQHAIPISSWFS 448

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 88/160 (55%), Gaps = 10/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P    + + R+ LVLDLDETL+H                ++ +F         +V KR
Sbjct: 168 LLPPIQQSLQNRKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQFQN------VYVIKR 221

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL   +K +E+V+FTAS+++Y +P++D L+S+       RL+R  C   +G  YI
Sbjct: 222 PGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYI 279

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+L+ +     LSDI I+DNSP SY  H ++AI +  W S
Sbjct: 280 KNLAQL--GRPLSDIIILDNSPTSYLFHPNHAIPISSWFS 317

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 83/150 (55%), Gaps = 11/150 (7%)

Query: 221 KRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKI 280
            ++ LVLDLDETL+H                VE++     I  +Y V KRP  D FL ++
Sbjct: 227 NKKCLVLDLDETLVHSSFKYVRTADFVLP--VEIE---DQIHNVY-VIKRPGVDEFLKRV 280

Query: 281 AKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNA 340
            + YE+VVFTAS+  Y DP+++ L+ S       RL+R+ C   +G  YIK+L+ +    
Sbjct: 281 GELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-NYIKNLAQI--GR 335

Query: 341 SLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
            LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 336 PLSDIIILDNSPASYMFHPQHAIPISSWFS 365

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 81/149 (54%), Gaps = 11/149 (7%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIA 281
           ++ LVLDLDETL+H               ++ V+     I  +Y V KRP  D FL  + 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADF----VIPVEIDNQ-IHNVY-VIKRPGVDEFLKLVG 293

Query: 282 KWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNAS 341
           + YE+VVFTAS+  Y DP++D L+ +       RL+R  C   DG  YIK+LS +     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQI--GRP 348

Query: 342 LSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 349 LSDLIILDNSPASYIFHPQHAIPISSWFS 377

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 86/159 (54%), Gaps = 15/159 (9%)

Query: 213 PQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPY 272
           P+  L+R+K   LVLDLDETL+H                V        I  +Y V KRP 
Sbjct: 306 PEKSLSRKK--CLVLDLDETLVHSSFKYLK-----SADFVLPVDIDDQIHNVY-VIKRPG 357

Query: 273 CDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGK-FSRRLYRQDCILRDGVGYIK 331
            D FL ++ + +E+VVFTAS+  Y DP++D L+    GK    RL+R+ C   +G  YIK
Sbjct: 358 VDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDK---GKSIHHRLFREACYNYEG-NYIK 413

Query: 332 DLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           +LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 414 NLSQL--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 450

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 88/160 (55%), Gaps = 12/160 (7%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P++ + + K+  LVLDLDETL+H               ++ V+     +  +Y V KR
Sbjct: 234 LLPKADMFKGKK-CLVLDLDETLVHSSFKYLRTADF----VIPVEIDNQ-VHNVY-VIKR 286

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL +I + YE+VVFTAS+  Y DP++D L+         RL+R  C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NYI 343

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LSD+ I+DNSP SY  H  +AI +  W S
Sbjct: 344 KNLSQI--GRPLSDMIILDNSPASYIFHPQHAIPISSWFS 381

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 83/160 (51%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P      + ++ LVLDLDETL+H                V        +  +Y V KR
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRT-----ADFVLPVNIDDQVHNVY-VIKR 282

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL ++ + YE+VVFTAS+  Y DP++D L+         RL+R+ C   +G  YI
Sbjct: 283 PGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQH--KSIHHRLFREACYNYEG-NYI 339

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LS+I I+DNSP SY  H  +AI V  W S
Sbjct: 340 KNLSQI--GRPLSEIIILDNSPASYIFHPQHAIPVSSWFS 377

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 83/160 (51%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P        ++ LVLDLDETL+H               ++ V      I  +Y V KR
Sbjct: 272 LLPPRAPAFNGKKCLVLDLDETLVHSSFKYLRTADF----VLPVDIDDQ-IHNVY-VIKR 325

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  D FL ++   YE+VVFTAS+  Y DP++D L+         RL+R+ C   +G  YI
Sbjct: 326 PGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKH--KTIHHRLFRESCYNYEG-NYI 382

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LSDI I+DNSP SY  H  +AI +  W S
Sbjct: 383 KNLSQI--GRPLSDIIILDNSPASYIFHPQHAIPISSWFS 420

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 86/160 (53%), Gaps = 11/160 (6%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKR 270
           L+P    + + ++ L+LDLDETL+H                VE+      +    +V KR
Sbjct: 234 LLPPPDKSIKDKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 271 PYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYI 330
           P  + FL ++ K +E+VVFTAS+  Y DP++D L++        RL+R+ C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREACYNYEG-NYI 344

Query: 331 KDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           K+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 345 KNLSQI--GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 382

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 84/165 (50%), Gaps = 21/165 (12%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFA-----TSGISTLY 265
           L+P    +   ++ LVLDLDETL+H              ++    F         I  +Y
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFK----------YLKGADFVLPVDIDDQIHNVY 350

Query: 266 HVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRD 325
            V KRP  D FL K+   +E+V+FTAS+  Y DP++D L+         RL+R+ C   +
Sbjct: 351 -VMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKH--KSVHHRLFREACYNYE 407

Query: 326 GVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
           G  YIK+LS +     LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 408 G-NYIKNLSQI--GRPLSEIIILDNSPASYIFHPQHAIPISSWFS 449

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 81/150 (54%), Gaps = 13/150 (8%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIA 281
           R+ LVLDLDETL+H               ++ V      +  +Y V KRP  D FL  + 
Sbjct: 282 RKCLVLDLDETLVHSSFKYLNIADF----VLPVDIDNQ-VQNVY-VSKRPGVDEFLKIVG 335

Query: 282 KWYELVVFTASMKEYADPVIDWLESSFPGKF-SRRLYRQDCILRDGVGYIKDLSVVVPNA 340
             YE++VFTAS+  Y +P++D L+   P K+   RL+R  C + +G  Y+K+LS +    
Sbjct: 336 DLYEVIVFTASVSRYGNPLMDILD---PHKYIHHRLFRDSCYVYEG-NYVKNLSQI--GR 389

Query: 341 SLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
            L DI I+DNSP SY  H  +AI +  W S
Sbjct: 390 PLGDIIILDNSPASYIFHPQHAIPISSWFS 419

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 90.9 bits (224), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 14/151 (9%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIA 281
           ++ LVLDLDETL+H                V        I  +Y V KRP  + FL ++ 
Sbjct: 302 KKCLVLDLDETLVHSSFKYLQT-----ADFVLPVNIDEQIHNVY-VIKRPGVEEFLKRVG 355

Query: 282 KWYELVVFTASMKEYADPVIDWLESSFPGK--FSRRLYRQDCILRDGVGYIKDLSVVVPN 339
           + +E+VVFTAS+  Y DP++D L+   PG+     RL+R+ C   +G  YIK+LS +   
Sbjct: 356 ELFEVVVFTASVARYGDPLLDILD---PGRQLIHHRLFREACYNYEG-NYIKNLSQM--G 409

Query: 340 ASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
             LS+I I+DNSP SY  H  +AI +  W S
Sbjct: 410 RPLSEIIILDNSPASYIFHPQHAIPISSWFS 440

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 88/164 (53%), Gaps = 18/164 (10%)

Query: 211 LIPQSVLNRRKRRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVH-- 268
           L P+ +    +++ L+LDLDETL+H                 +     +  +  +HV+  
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVDS--------ADFVIPVTIDNQTHHVYVI 363

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGK--FSRRLYRQDCILRDG 326
           KRP  D FL ++++ YE+VVFTAS+  Y DP+++ L+   P       RL+R+ C   +G
Sbjct: 364 KRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILD---PANTIIHHRLFRESCYTYEG 420

Query: 327 VGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
             Y+K+LS +     L++I I+DNSP SY  H  +AI +  W S
Sbjct: 421 -NYVKNLSQL--GRPLNEIIILDNSPASYIFHPQHAIPISSWFS 461

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 81/154 (52%), Gaps = 21/154 (13%)

Query: 222 RRTLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFA-----TSGISTLYHVHKRPYCDLF 276
           ++ L+LDLDETL+H              ++    F         I  +Y V KRP  D F
Sbjct: 518 KKCLILDLDETLVHSSFK----------YLTSADFVIPVDIDEQIHNVY-VIKRPGVDQF 566

Query: 277 LTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV 336
           L  ++K +E+VVFTAS+  Y DP++D L+         RL+R+ C   +G  YIK+LS +
Sbjct: 567 LETVSKIFEVVVFTASVSRYGDPLLDVLDKH--RCIHHRLFREACYDYEG-NYIKNLSQI 623

Query: 337 VPNASLSDIFIIDNSPVSYAMHVDNAIQVEGWIS 370
                LS++ I+DNSP SY  H  +AI +  W S
Sbjct: 624 --GRPLSELIILDNSPASYIFHPQHAIPISSWFS 655

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 62/100 (62%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  LS + IID  P SY +  +NAI +E W
Sbjct: 275 HIKDLSKL--NRDLSKVIIIDTDPNSYKLQPENAIPMEPW 312

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  +++++E+V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  LS + IID  P SY +  +NAI ++ W
Sbjct: 275 HIKDLSKL--NRDLSKVIIIDTEPNSYKLQPENAIPMDPW 312

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 62/100 (62%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  +++++E+V+F+++   Y++ + + L+       S  L+++ C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDP-IHAFVSYNLFKEHCVYKDGV- 279

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  LS + IID  P SY +  +NAI +E W
Sbjct: 280 HIKDLSKL--NRDLSKVIIIDTDPNSYKLQPENAIPMEPW 317

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 62/104 (59%), Gaps = 4/104 (3%)

Query: 265 YHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 324
           +   KRP CD FL  ++++YE+V+F+++   YA+ + + L+       S  L+++ C+ +
Sbjct: 204 WRTAKRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYK 262

Query: 325 DGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           DGV +IKD+S +  N  L  +  ID  P +Y +  +NAI ++ W
Sbjct: 263 DGV-HIKDISKL--NRDLGKVVTIDTDPNTYKLQPENAIPMDPW 303

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   YA+ V + ++       +  LY++ C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L    IID  P SY +  +NAI V+ W
Sbjct: 274 HIKDLSKL--NRDLGKTMIIDTDPNSYKLQPENAIPVKPW 311

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y + + + L+       S  L+++ C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV- 293

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  ++ + IID  P +Y +  +NAI +E W
Sbjct: 294 HIKDLSKL--NRDVNKVLIIDTDPNNYKLQPENAIPMEPW 331

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y + + + L+       S  L+++ C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV- 285

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  ++ + IID  P +Y +  +NAI V+ W
Sbjct: 286 HIKDLSKL--NRDVNKVLIIDTEPNNYKLQPENAIPVKPW 323

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP CD FL  ++++YE+V+F+++   Y+D + + L+       S  L+++ C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKD+S +  N  +  + +ID  P  Y    +NAI  + W
Sbjct: 279 HIKDISKM--NRDVGKVVMIDTDPNCYKSQPENAIPAKPW 316

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y++ + + L+       S  LY++ C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLD-PIHAFISYNLYKEHCVYKEG-D 283

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L  + I+D  P SY +  +NAI ++ W
Sbjct: 284 HIKDLSKL--NRDLGKVIIVDTDPASYKLQPENAIPMQPW 321

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y+D V + L+       +  L+++ C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L    IID  P +Y +  +NAI ++ W
Sbjct: 270 HIKDLSKL--NRDLGKTVIIDCDPNAYKLQPENAIPMKPW 307

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 265 YHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 324
           +   KRP  D FL  ++++YE+V+F+++   YA+ + + L+       +  L+++ C+ +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFITYNLFKEHCLYK 274

Query: 325 DGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           DGV +IKDLS +  N  L  + IID    S+ +  +NAI +E W
Sbjct: 275 DGV-HIKDLSKL--NRDLGKVLIIDTDENSFKLQPENAIYLEPW 315

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   YA+ + + ++       S  L+++ C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L  + IID    SY +  +NAI ++ W
Sbjct: 281 HIKDLSKL--NRDLKKVMIIDTDENSYKLQPENAIPMDPW 318

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y+D + + L+       S  L+++ C+ +DGV 
Sbjct: 221 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDRIAEKLD-PIHAFVSYNLFKEHCLYKDGV- 278

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N     + IID  P SY +  +NAI ++ W
Sbjct: 279 HIKDLSKL--NRDEKKVLIIDVDPNSYKLQPENAIPMKPW 316

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y+D V + L+       +  L+++ C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 270

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L    I+D  P +Y +  +NAI +  W
Sbjct: 271 HIKDLSKL--NRDLGKTIIVDCDPNAYKLQPENAIPMRPW 308

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y++ + + L+       S  LY++ C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L  + IID  P +Y    +NAI V+ W
Sbjct: 275 HIKDLSKL--NRDLDKVLIIDCDPNNYKFQPENAIPVKPW 312

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 61/104 (58%), Gaps = 4/104 (3%)

Query: 265 YHVHKRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILR 324
           +   KRP  + FL  ++++YE+V+F+++   Y++   + L+       S  L+++ C+ +
Sbjct: 216 WRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDP-IHAFVSYNLFKEHCVYK 274

Query: 325 DGVGYIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           DGV +IKDLS +     LS + IID  P SY +  +NAI ++ W
Sbjct: 275 DGV-HIKDLSKL--KRDLSKVIIIDTDPNSYKLQPENAIPMDPW 315

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 58/100 (58%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   +++ + + L+       +  L+++ C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  L    IID    ++ +  +NAI  E W
Sbjct: 285 HIKDLSHL--NRDLGKTIIIDTDANAFKLQPENAIHAEPW 322

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 270 RPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGY 329
           RP  D  L  ++ +YE V+F ++   Y+  V++ L+       +  L++  C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLDP-IRAFITYNLFKDHCVYKDGI-H 274

Query: 330 IKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           IKDLS +  N  L    IID  P S  + ++NAI  E W
Sbjct: 275 IKDLSHL--NRDLGKTLIIDTDPNSVKLQMENAILAEPW 311

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 59/100 (59%), Gaps = 4/100 (4%)

Query: 269 KRPYCDLFLTKIAKWYELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVG 328
           KRP  D FL  ++++YE+V+F+++   Y++ + + L+       S  L+++ C+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 329 YIKDLSVVVPNASLSDIFIIDNSPVSYAMHVDNAIQVEGW 368
           +IKDLS +  N  ++ + IID    +Y +  +NAI ++ W
Sbjct: 249 HIKDLSKL--NRDVNKVIIIDTDKNNYKLQPENAIPMKPW 286

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 70/145 (48%), Gaps = 25/145 (17%)

Query: 224 TLVLDLDETLIHXXXXXXXXXXXXQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKW 283
           TLVL L++ L+H                           T +   KRP  D FL  ++++
Sbjct: 187 TLVLTLEDLLVHSEWSQ---------------------KTGWRTAKRPGVDYFLGYLSQY 225

Query: 284 YELVVFTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVVVPNASLS 343
           YE+V+F+++   Y++ + + L+       S  L+++ C+ +D V +IKDLS +  N  + 
Sbjct: 226 YEIVLFSSNYMMYSERIAEKLD-PLHAFISYNLFKEHCVYKDHV-HIKDLSKL--NRDVR 281

Query: 344 DIFIIDNSPVSYAMHVDNAIQVEGW 368
            + I+D    SY +  +NA+ +  W
Sbjct: 282 KVVIMDTDANSYKLQPENALPMAPW 306

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 290 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGY 329
           TA +K + + V   L++  P   S+R+Y++DC L   +G+
Sbjct: 101 TAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGF 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,551,190
Number of extensions: 1296856
Number of successful extensions: 4848
Number of sequences better than 10.0: 73
Number of HSP's gapped: 4860
Number of HSP's successfully gapped: 88
Length of query: 409
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 297
Effective length of database: 40,638,807
Effective search space: 12069725679
Effective search space used: 12069725679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)