Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06754gna 1ON82782742760.0
Kwal_26.7996na 1ON78279634750.0
SAKL0A09394gna 1ON79772632240.0
Smik_10.20na 2ON79972631080.0
Skud_10.5na 2ON79972631070.0
TDEL0C00130singletonON79272631060.0
YJL212C (OPT1)na 2ON79972631030.0
KLLA0E00397gsingletonON79372630920.0
Suva_6.290na 2ON80172630890.0
ZYRO0D00330gna 3ON79872630310.0
KNAG0G02310singletonON79072529270.0
KLTH0E01496gna 3ON81474013970.0
Kwal_55.19788na 3ON81073913881e-180
SAKL0G15224gsingletonON80573613811e-179
SAKL0F14674gna 3ON80573613741e-178
KLLA0E00419gna 3ON79473113611e-176
ABR156Wna 3ON79677412821e-164
Ecym_7185na 3ON80072512581e-160
SAKL0D09350gna 4ON8877218661e-102
TPHA0C05020singletonON8967318621e-101
Kwal_55.19561singletonON8827358601e-101
YPR194C (OPT2)na 5ON8777238551e-100
ZYRO0G22484gsingletonON8216878405e-99
Skud_16.498na 5ON8777238411e-98
ZYRO0D09922gsingletonON9227288403e-98
KLLA0D15378gsingletonON8697218365e-98
ZYRO0C18568gsingletonON8216838311e-97
Suva_16.526na 5ON8777248322e-97
Kpol_455.13na 5ON8927248235e-96
Ecym_2739na 4ON8677508155e-95
ZYRO0D13332gsingletonON8897318112e-94
ADL399CsingletonON8857457641e-87
ACL205CsingletonON8907547518e-86
Smik_16.458na 5ON8556347349e-84
AGL027WsingletonON8777467094e-80
ZYRO0D17974gsingletonON7767244411e-44
ZYRO0G16236g5.282ON50783771.2
KLTH0G06798g5.282ON522102752.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06754g
         (827 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {...  1651   0.0  
Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {O...  1343   0.0  
SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {...  1246   0.0  
Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}...  1201   0.0  
Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}  ...  1201   0.0  
TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON}      1201   0.0  
YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}  O...  1199   0.0  
KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly s...  1195   0.0  
Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C ...  1194   0.0  
ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON...  1172   0.0  
KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {O...  1132   0.0  
KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {...   542   0.0  
Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {...   539   e-180
SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]...   536   e-179
SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]...   533   e-178
KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar ...   528   e-176
ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-synteni...   498   e-164
Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar t...   489   e-160
SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} simila...   338   e-102
TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON}            336   e-101
Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON...   335   e-101
YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON} ...   333   e-100
ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} simi...   328   5e-99
Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {...   328   1e-98
ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} simila...   328   3e-98
KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]...   326   5e-98
ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} simi...   324   1e-97
Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {...   325   2e-97
Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON} (24582..2...   321   5e-96
Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {O...   318   5e-95
ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]...   317   2e-94
ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON} Non-s...   298   1e-87
ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON} Non-s...   293   8e-86
Smik_16.458 Chr16 complement(787205..789133,789181..789306,78932...   287   9e-84
AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-synteni...   277   4e-80
ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]...   174   1e-44
ZYRO0G16236g Chr7 complement(1332425..1333948) [1524 bp, 507 aa]...    34   1.2  
KLTH0G06798g Chr7 (544397..545965) [1569 bp, 522 aa] {ON} simila...    33   2.6  

>KLTH0D06754g Chr4 complement(588021..590504) [2484 bp, 827 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 827

 Score = 1651 bits (4276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/827 (97%), Positives = 806/827 (97%)

Query: 1   MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVVEHGENXXXXXXLGQE 60
           MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVVEHGEN      LGQE
Sbjct: 1   MLYKEATSSTEAAMHRSSEDKSPAHNSNHLKMGKEVKIVDTLQVVEHGENSSDSSSLGQE 60

Query: 61  LSPGGSHVTYLSRGHLANEGAGAEGKXXXXXXXXXXXXXXXVWEGNVSLLQNSPFPEVRA 120
           LSPGGSHVTYLSRGHLANEGAGAEGK               VWEGNVSLLQNSPFPEVRA
Sbjct: 61  LSPGGSHVTYLSRGHLANEGAGAEGKTEQEIIEEEELTEQTVWEGNVSLLQNSPFPEVRA 120

Query: 121 TVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKIL 180
           TVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKIL
Sbjct: 121 TVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKIL 180

Query: 181 ALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAG 240
           ALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAG
Sbjct: 181 ALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAG 240

Query: 241 YMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSM 300
           YMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSM
Sbjct: 241 YMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSM 300

Query: 301 SRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPI 360
           SRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPI
Sbjct: 301 SRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPI 360

Query: 361 TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTY 420
           TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTY
Sbjct: 361 TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTY 420

Query: 421 DNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGK 480
           DNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGK
Sbjct: 421 DNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGK 480

Query: 481 EIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAF 540
           EIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAF
Sbjct: 481 EIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAF 540

Query: 541 VVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQG 600
           VVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQG
Sbjct: 541 VVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQG 600

Query: 601 LELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTC 660
           LELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTC
Sbjct: 601 LELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTC 660

Query: 661 NNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCH 720
           NNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCH
Sbjct: 661 NNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCH 720

Query: 721 SPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVV 780
           SPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVV
Sbjct: 721 SPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVV 780

Query: 781 IIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDKWW 827
           IIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDKWW
Sbjct: 781 IIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDKWW 827

>Kwal_26.7996 s26 complement(604470..606818) [2349 bp, 782 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 55] FULL
          Length = 782

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/796 (81%), Positives = 708/796 (88%), Gaps = 14/796 (1%)

Query: 32  MGKEVKIVDTLQVVEHGENXXXXXXLGQELSPGGSHVTYLSRGHLANEGAGAEGKXXXXX 91
           M KEVK V+TLQV E               S    HV ++    +  +GAG         
Sbjct: 1   MSKEVKKVETLQVWEK--------VENSSESSSQEHVPHV----INKDGAGIV--VEEEE 46

Query: 92  XXXXXXXXXXVWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGV 151
                     +WEG+V+ L NSPFPEVRATVP TDDPTIV+NHWRTWFLTTVFV+VFAGV
Sbjct: 47  SEAEGITDQTIWEGDVTALPNSPFPEVRATVPATDDPTIVVNHWRTWFLTTVFVVVFAGV 106

Query: 152 NQFFSLRYPSLSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTI 211
           NQFFSLRYPSLSINFLVAQVVCYP+GKILALLP+ DC RCPWFNLNPGPFTKKEHAVVTI
Sbjct: 107 NQFFSLRYPSLSINFLVAQVVCYPIGKILALLPQRDCARCPWFNLNPGPFTKKEHAVVTI 166

Query: 212 AVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACI 271
           AVALTSSTAYAMNILIAQTNFYNMKL AGYM+LLVWTSQML YGAAGLTRRWVV PAACI
Sbjct: 167 AVALTSSTAYAMNILIAQTNFYNMKLGAGYMVLLVWTSQMLGYGAAGLTRRWVVEPAACI 226

Query: 272 WPQTLISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFN 331
           WPQTLISVSLFDSLHNR++D + VNGW MSRYRFF+ V S SF+WYWVPGFLFKGLSYFN
Sbjct: 227 WPQTLISVSLFDSLHNRTVDASVVNGWKMSRYRFFIIVLSGSFIWYWVPGFLFKGLSYFN 286

Query: 332 VVLWGPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAV 391
           VVLWG KTRHNFIANTIFGVESGIGALPI+FDYTQ+SQA++GSVFATPYWVSANSCAS  
Sbjct: 287 VVLWGSKTRHNFIANTIFGVESGIGALPISFDYTQVSQAMSGSVFATPYWVSANSCASVF 346

Query: 392 LFFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLF 451
           +FF++ILPILYFTNTWYAKYMPVISG+T+DNTQQKYNVS+ILN D+S+N EKYK+YSPLF
Sbjct: 347 IFFILILPILYFTNTWYAKYMPVISGNTFDNTQQKYNVSKILNPDFSVNLEKYKAYSPLF 406

Query: 452 VPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDW 511
           VPFSYLLSYALNFAAV+AVFVHC LYNGK+IKNKFRNKN+GGQDIHMRLY+QNYKDCPDW
Sbjct: 407 VPFSYLLSYALNFAAVVAVFVHCALYNGKDIKNKFRNKNHGGQDIHMRLYTQNYKDCPDW 466

Query: 512 WYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIIT 571
           WY+VLQV+M+ LGF  +C F+SHLPAWAF VAL ISF+NFIPQGILEAVTNQHVGLNIIT
Sbjct: 467 WYLVLQVVMLGLGFATICGFDSHLPAWAFFVALVISFLNFIPQGILEAVTNQHVGLNIIT 526

Query: 572 ELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVIS 631
           ELICGYMLPF+PMAN+LFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFA+QIYAT+IS
Sbjct: 527 ELICGYMLPFKPMANVLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAIQIYATIIS 586

Query: 632 GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMW 691
           GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMP++LFSPGRIYNPIMW
Sbjct: 587 GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPQFLFSPGRIYNPIMW 646

Query: 692 FFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNT 751
           FFLIGL VP+IVF LQ+ FK N+ +KF H+PVFFAGP +IPPSTPYNY+L+FA+S+ LN 
Sbjct: 647 FFLIGLAVPLIVFALQRVFKHNQAIKFMHAPVFFAGPNSIPPSTPYNYSLFFAMSYVLNR 706

Query: 752 IRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRK 811
           IRKR+P WFSKYN+VMGAGVETGVALAVVIIFLCVQYPGG LNWWGN+VYKNTYDH YRK
Sbjct: 707 IRKRWPLWFSKYNYVMGAGVETGVALAVVIIFLCVQYPGGKLNWWGNSVYKNTYDHAYRK 766

Query: 812 FYNLKKGEKFGYDKWW 827
           +Y LKKGE FGYDKWW
Sbjct: 767 YYVLKKGETFGYDKWW 782

>SAKL0A09394g Chr1 complement(817374..819767) [2394 bp, 797 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 797

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/726 (80%), Positives = 654/726 (90%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           +WEG+ + L NSP+PEVRATVP TDDPTI LNHWRTWFLTTVFVIVFAGVNQFFSLRYPS
Sbjct: 72  IWEGDPTYLPNSPYPEVRATVPNTDDPTIELNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 131

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           LSINF+VAQV+CYP+GKILA LP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 132 LSINFIVAQVICYPIGKILATLPDWKCKRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 191

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AMNILIAQTNFYNMKL AGY +LLVWTSQML YGAAGL+RRWVV+PA+C+WPQTLISVSL
Sbjct: 192 AMNILIAQTNFYNMKLGAGYQVLLVWTSQMLGYGAAGLSRRWVVNPASCVWPQTLISVSL 251

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FD+LH+  IDKT VNGWSM+RY+FF+ VF  SFVWYW+PGFLF GLSYFN +LWGPKTRH
Sbjct: 252 FDALHSGKIDKTIVNGWSMTRYKFFLYVFLFSFVWYWLPGFLFTGLSYFNFILWGPKTRH 311

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NFIAN IFGVESG+GA+PITFDYTQISQA+TGSVFATP+WVSAN+ AS +LFFV+ILPIL
Sbjct: 312 NFIANAIFGVESGLGAIPITFDYTQISQAMTGSVFATPFWVSANTYASVLLFFVVILPIL 371

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMP+IS STYDN Q  YNV++ILN D+SIN EKYK YSPL+VPFSYLLSYA
Sbjct: 372 YFTNTWYAKYMPIISTSTYDNQQNSYNVTKILNPDFSINLEKYKGYSPLYVPFSYLLSYA 431

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAV AVFVHC LY+GK+I +K RN N+GG DIHMRLYS+NYKDCPDWWY  LQV+ +
Sbjct: 432 LNFAAVTAVFVHCALYHGKDIISKLRNSNHGGSDIHMRLYSKNYKDCPDWWYGALQVVTL 491

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGF  VC +++H PAWAFV+AL ISF N +PQGILEA+TNQHVGLNIITEL+CGYMLP 
Sbjct: 492 GLGFATVCGWDTHFPAWAFVIALLISFANIVPQGILEAMTNQHVGLNIITELVCGYMLPL 551

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           +PMAN+LFKLYGFIVMR GL+LSRDLKLALYMKV PRLIFAVQIYA++ISGLVNVGIQEW
Sbjct: 552 KPMANVLFKLYGFIVMRHGLDLSRDLKLALYMKVSPRLIFAVQIYASLISGLVNVGIQEW 611

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           MR NI  +CS TQ DGF C+NGRTIFNASIIWS+P+YLFSPGRIYNP+MWFFLIGLVVP 
Sbjct: 612 MRHNIDGICSKTQKDGFICSNGRTIFNASIIWSLPQYLFSPGRIYNPLMWFFLIGLVVPF 671

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           IVF LQKKF  N+ LK+CHSPVFF GPGNIPPSTPYNY+L+FA S+ LN IRKR+PRWF 
Sbjct: 672 IVFFLQKKFPSNQFLKYCHSPVFFTGPGNIPPSTPYNYSLFFATSFLLNEIRKRWPRWFG 731

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMG+GVE GVAL+V IIFLCVQYPGG +NWWGN+V+KNTYDH Y+KFY+L KGE F
Sbjct: 732 KYNFVMGSGVEAGVALSVTIIFLCVQYPGGKVNWWGNSVWKNTYDHQYKKFYHLNKGETF 791

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 792 GYDKWW 797

>Smik_10.20 Chr10 complement(32201..34600) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/726 (77%), Positives = 645/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VW+G+ + L NSP+PEVRA V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPS
Sbjct: 74  VWKGDPTYLPNSPYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPS 133

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L INFLVAQVVCYP+GK+LALLP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 134 LEINFLVAQVVCYPIGKVLALLPDWKCARVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 193

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNMKL+ GY  LLVWTSQM+ YGAAGLTRRWVV+PA+ IWPQTLISVSL
Sbjct: 194 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSL 253

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R I+KT  NGW+M RY+FF+ V   SFVWYWVPGFLF GLSYFNV+LWG KTRH
Sbjct: 254 FDSLHSRKIEKTVANGWTMPRYKFFLIVLIGSFVWYWVPGFLFTGLSYFNVILWGSKTRH 313

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NFIANTIFG +SG+GALPITFDYTQ+SQA++GSVFATP++VSAN+ AS ++FFVI+LP L
Sbjct: 314 NFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPCL 373

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMPVISGSTYDNTQ KYNV++ILN D+SIN EKYK YSP+FVPFSYLLSYA
Sbjct: 374 YFTNTWYAKYMPVISGSTYDNTQHKYNVTKILNEDFSINLEKYKEYSPVFVPFSYLLSYA 433

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHCFLY+GK+I  KF+++  GG DIHMR+YS+NYKDCPDWWY+ LQ++MI
Sbjct: 434 LNFAAVIAVFVHCFLYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDCPDWWYLALQLVMI 493

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGFVAVC F++  PAWAFV+A+ IS VNFIPQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 494 GLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPL 553

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLA+YMKV PRLIFAVQIYAT+ISG+VNVG+QEW
Sbjct: 554 RPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEW 613

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           M  NI  LC+S QP+GFTC NGRT+FNASIIWS+PKYLFS GRIY+P+MWFFLIGL+ P+
Sbjct: 614 MMHNIDGLCTSDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYSPLMWFFLIGLLFPL 673

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           +V+ +Q KF   +  K  H+PVFF GPGNIPPSTPYNY+L+FA+S+ LN IRKR+  WF+
Sbjct: 674 VVYAVQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFCLNIIRKRWRAWFN 733

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMGAGVE GVA++VVIIFLCVQYPG  L+WWGNNV+K TYD++Y+KFY LKKGE F
Sbjct: 734 KYNFVMGAGVEAGVAISVVIIFLCVQYPGAKLSWWGNNVWKRTYDNDYKKFYTLKKGETF 793

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 794 GYDKWW 799

>Skud_10.5 Chr10 complement(7830..10229) [2400 bp, 799 aa] {ON}
           YJL212C (REAL)
          Length = 799

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/726 (77%), Positives = 645/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VW+G+ + L NSP+PEVRA V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPS
Sbjct: 74  VWKGDPTYLPNSPYPEVRAAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPS 133

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L INF+VAQVVC+P+G++LALLP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 134 LEINFIVAQVVCFPIGRVLALLPDWKCRRAPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 193

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNMKL+ GY  LLVWTSQM+ YGAAGLTRRWVV+PA+ IWPQTLISVSL
Sbjct: 194 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSL 253

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R I+KT  NGW+M RYRFF+ V   SF+WYWVPGFLF GLSYFNVVLWG KTRH
Sbjct: 254 FDSLHSRKIEKTVANGWTMPRYRFFLIVLIGSFLWYWVPGFLFTGLSYFNVVLWGSKTRH 313

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NFIANTIFG +SG+GALPITFDYTQISQA++GSVFATP++VSAN+ AS ++FFVI+LP L
Sbjct: 314 NFIANTIFGTQSGLGALPITFDYTQISQAMSGSVFATPFYVSANTYASVLIFFVIVLPCL 373

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMPVISGSTYDNTQ KYNV++ILN DYSIN EKYK YSP+FVPFSYLLSYA
Sbjct: 374 YFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYA 433

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHCFLY+GKEI  KF+++  GG DIHMR+Y++NYKDCPDWWY++LQ++MI
Sbjct: 434 LNFAAVIAVFVHCFLYHGKEILAKFKDRKNGGTDIHMRIYTKNYKDCPDWWYLLLQIVMI 493

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGFVAVC F++  PAWAFV+A+ IS VNFIPQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 494 GLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPL 553

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLA+YMKV PRLIFAVQIYAT+ISG+VNVG+QEW
Sbjct: 554 RPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEW 613

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           M  NI  LC++ QP+GFTC NGRT+FNASIIWS+PKYLFS GRIYNP+MWFFLIGL+ P+
Sbjct: 614 MMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSLPKYLFSTGRIYNPLMWFFLIGLLFPL 673

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           +V+ +Q KF   +  K  H+PVFF GPGNIPPSTPYNY+L+FA+S+ LN IRKR+  WF+
Sbjct: 674 VVYAVQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFCLNVIRKRWRAWFN 733

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMGAGVE GVA+AVVIIFLCVQYPGG L+WWGNNV+K TYD++Y+KFY L KGE F
Sbjct: 734 KYNFVMGAGVEAGVAIAVVIIFLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLNKGETF 793

Query: 822 GYDKWW 827
           GYD WW
Sbjct: 794 GYDNWW 799

>TDEL0C00130 Chr3 complement(9763..12141) [2379 bp, 792 aa] {ON} 
          Length = 792

 Score = 1201 bits (3106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/726 (77%), Positives = 642/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VWEG+VSLL NSP+P+VRA VP  DDP I+LNHWRTWFLTTVFV+VFAGVNQFFSLRYPS
Sbjct: 67  VWEGDVSLLPNSPYPDVRAVVPIDDDPGIILNHWRTWFLTTVFVVVFAGVNQFFSLRYPS 126

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L INFLVAQVVC+PVGK LALLP+W C R  +F+LNPGPFTKKEHAV+TIAVALTSSTAY
Sbjct: 127 LEINFLVAQVVCFPVGKALALLPDWKCKRFSFFDLNPGPFTKKEHAVITIAVALTSSTAY 186

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FY+MKL+AGY +LLVWTSQML YGAAGLTRRWVV P +CIWPQTLISVSL
Sbjct: 187 AMYILNAQVSFYHMKLNAGYQLLLVWTSQMLGYGAAGLTRRWVVDPPSCIWPQTLISVSL 246

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R +DKT VNGWS+ RY+ F  V   SFVW+WVPGFLFKGLSYFNVVLWGPKTR 
Sbjct: 247 FDSLHSRKVDKTIVNGWSLDRYKMFYFVLIGSFVWHWVPGFLFKGLSYFNVVLWGPKTRQ 306

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NF+AN +FGV SGIG LPI+FDYTQ+SQA++GSVFATP+WVSAN+ AS ++FFVI+LPIL
Sbjct: 307 NFVANALFGVSSGIGLLPISFDYTQVSQAMSGSVFATPFWVSANTYASVLIFFVIVLPIL 366

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMPVISGST+DNTQ  YNV +ILN+DYSIN EKYK YSP+FVPFSYLL+Y 
Sbjct: 367 YFTNTWYAKYMPVISGSTFDNTQSSYNVKKILNADYSINLEKYKEYSPVFVPFSYLLNYG 426

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAV+AVFVHC LY+GK+I NK R+ N+GG DIH R+Y++NYK+CPDWWY VLQ+I +
Sbjct: 427 LNFAAVVAVFVHCALYHGKDIYNKLRDSNFGGMDIHRRIYTKNYKECPDWWYGVLQIITL 486

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
           ALGFV VCAF +H P WAFV+AL I++ NF+PQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 487 ALGFVTVCAFPTHFPPWAFVIALIIAYANFLPQGILEAITNQHVGLNIITELICGYMLPL 546

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           +PMANLLFKLYGFIVMRQGL LSRDLKLALYMKV PRLIFA+QIYAT+ISGLVNVGIQEW
Sbjct: 547 KPMANLLFKLYGFIVMRQGLNLSRDLKLALYMKVSPRLIFAIQIYATIISGLVNVGIQEW 606

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           MR+NIK++C++TQ DGFTC NGRTIFNASIIWS+PKYLFSPGRIYNP+MWFFLIGL+ PI
Sbjct: 607 MRTNIKDICTTTQADGFTCANGRTIFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLLAPI 666

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           +VF++QKKF      K+ H+PVFF G  NIPPSTPYNY+L+F +S+ L  IRK +P WFS
Sbjct: 667 VVFLIQKKFPKVSFFKYLHTPVFFTGTNNIPPSTPYNYSLFFGMSFMLFLIRKNWPLWFS 726

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFV GAGVETGVA+AVVIIFLCVQ+PGG L+WWGN VYKNT D   +KFY LK+GE F
Sbjct: 727 KYNFVTGAGVETGVAIAVVIIFLCVQFPGGHLDWWGNTVYKNTGDLKSQKFYVLKEGETF 786

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 787 GYDKWW 792

>YJL212C Chr10 complement(33850..36249) [2400 bp, 799 aa] {ON}
           OPT1Proton-coupled oligopeptide transporter of the
           plasma membrane; also transports glutathione and
           phytochelatin; member of the OPT family
          Length = 799

 Score = 1199 bits (3103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/726 (77%), Positives = 645/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VW+G+ + L NSP+PEVR+ V   DDPTI LNHWRTWFLTTVFV+VFAGVNQFFSLRYPS
Sbjct: 74  VWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTVFVVVFAGVNQFFSLRYPS 133

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L INFLVAQVVCYP+G+ILALLP+W C + P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 134 LEINFLVAQVVCYPIGRILALLPDWKCSKVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 193

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNMKL+ GY  LLVWTSQM+ YGAAGLTRRWVV+PA+ IWPQTLISVSL
Sbjct: 194 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSL 253

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R ++KT  NGW+M RYRFF+ V   SF+WYWVPGFLF GLSYFNV+LWG KTRH
Sbjct: 254 FDSLHSRKVEKTVANGWTMPRYRFFLIVLIGSFIWYWVPGFLFTGLSYFNVILWGSKTRH 313

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NFIANTIFG +SG+GALPITFDYTQ+SQA++GSVFATP++VSAN+ AS ++FFVI+LP L
Sbjct: 314 NFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYASVLIFFVIVLPCL 373

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMPVISGSTYDNTQ KYNV++ILN DYSIN EKYK YSP+FVPFSYLLSYA
Sbjct: 374 YFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYA 433

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHC LY+GK+I  KF+++  GG DIHMR+YS+NYKDCPDWWY++LQ++MI
Sbjct: 434 LNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDCPDWWYLLLQIVMI 493

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGFVAVC F++  PAWAFV+A+ IS VNFIPQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 494 GLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPL 553

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLA+YMKV PRLIFAVQIYAT+ISG+VNVG+QEW
Sbjct: 554 RPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYATIISGMVNVGVQEW 613

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           M  NI  LC++ QP+GFTC NGRT+FNASIIWS+PKYLFS GRIYNP+MWFFLIGL+ P+
Sbjct: 614 MMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYNPLMWFFLIGLLFPL 673

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
            V+ +Q KF   +  K  H+PVFF GPGNIPPSTPYNY+L+FA+S+ LN IRKR+  WF+
Sbjct: 674 AVYAVQWKFPKFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFCLNLIRKRWRAWFN 733

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMGAGVE GVA++VVIIFLCVQYPGG L+WWGNNV+K TYD++Y+KFY LKKGE F
Sbjct: 734 KYNFVMGAGVEAGVAISVVIIFLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLKKGETF 793

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 794 GYDKWW 799

>KLLA0E00397g Chr5 (23256..25637) [2382 bp, 793 aa] {ON} highly
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 793

 Score = 1195 bits (3092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/726 (76%), Positives = 646/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VW+G+ + L NSP+P+VR  V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPS
Sbjct: 68  VWKGDPTYLPNSPYPDVRFAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPS 127

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           LSI+F+VAQV+CYP+GK+LA LP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 128 LSIDFIVAQVICYPIGKVLAKLPDWKCRRVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 187

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNMKL+ GY  LLVWTSQM+ YGAAGLTRRWVV+PA+ IWPQTLISVSL
Sbjct: 188 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASAIWPQTLISVSL 247

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R I++  VNGWSM RY+FFV VF ASFVWYWVPGFLF GLSYFNV+LWGPKTR 
Sbjct: 248 FDSLHSRKIERAVVNGWSMPRYKFFVIVFIASFVWYWVPGFLFTGLSYFNVILWGPKTRD 307

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NF+ANTIFGVESG+GA PI+FDYTQISQA++GSVFATP++VSAN+ AS +LFFVIILP L
Sbjct: 308 NFVANTIFGVESGLGAFPISFDYTQISQAMSGSVFATPFYVSANTYASVLLFFVIILPCL 367

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YF+NTWYAKYMPVISGSTYDNTQ KYNV++ILN DYSIN EKYK+YSP+FVPFSYLLSYA
Sbjct: 368 YFSNTWYAKYMPVISGSTYDNTQSKYNVTKILNEDYSINLEKYKNYSPIFVPFSYLLSYA 427

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHC LY+GK+I  K +++  GG DIH R+YS+NY DCPDWWY+VLQV+MI
Sbjct: 428 LNFAAVIAVFVHCILYHGKDILAKLKDRRNGGTDIHARIYSKNYADCPDWWYLVLQVVMI 487

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGFV VCAF+S  PAWAFV+A+ IS VNFIPQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 488 GLGFVTVCAFDSKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPL 547

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLA+YMKVPPRLIF +QIYAT++SG+VNVG+QEW
Sbjct: 548 RPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVPPRLIFFIQIYATILSGMVNVGVQEW 607

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           M  NI+ +CS+ Q +GFTC NGRT+FNASIIWS+PKYLFSPGRIYNP+MWFFLIGLVVP+
Sbjct: 608 MTHNIEGICSTDQSNGFTCANGRTVFNASIIWSLPKYLFSPGRIYNPLMWFFLIGLVVPL 667

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           IV+ +Q+KF   +  K+ H+PVFF GPGNIPPSTPYNY+L+F+ S+ L+ IRKR+  WF 
Sbjct: 668 IVYAIQRKFPKIQFAKYIHTPVFFTGPGNIPPSTPYNYSLFFSASFCLHIIRKRWGPWFK 727

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYN+VMGA VE+GVA+AVVIIFLCVQ+PG  LNWWGNNV+KNTYDHNY+KFY L++G+ F
Sbjct: 728 KYNYVMGAAVESGVAIAVVIIFLCVQFPGAELNWWGNNVWKNTYDHNYKKFYTLEEGQTF 787

Query: 822 GYDKWW 827
           G+ KWW
Sbjct: 788 GHTKWW 793

>Suva_6.290 Chr6 (513382..515787) [2406 bp, 801 aa] {ON} YJL212C
           (REAL)
          Length = 801

 Score = 1194 bits (3089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/726 (76%), Positives = 644/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           VW+G+ + L NSP+PEVR+ V   DDPTI LNHWRTWFLTT+FV+VFAGVNQFFSLRYPS
Sbjct: 76  VWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTIFVVVFAGVNQFFSLRYPS 135

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L INFLVAQVVC+P+G++LALLP+W C R P+F+LNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 136 LEINFLVAQVVCFPIGRMLALLPDWKCARVPFFDLNPGPFTKKEHAVVTIAVALTSSTAY 195

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNMKL+ GY  LLVWTSQM+ YGAAGLTRRWVV+PA+ IWPQTLISVSL
Sbjct: 196 AMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPASSIWPQTLISVSL 255

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R ++K+  NGW M RYRFF+ +   SF+WYWVPGFLF GLSYFNVVLWGPKTR+
Sbjct: 256 FDSLHSRDVEKSVANGWKMPRYRFFLFILIGSFIWYWVPGFLFTGLSYFNVVLWGPKTRY 315

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NFIANTIFG +SG+GALPITFDYTQISQA++GSVFATP++VSAN+ AS ++FFVI+LP L
Sbjct: 316 NFIANTIFGTQSGLGALPITFDYTQISQAMSGSVFATPFYVSANTYASVLIFFVIVLPCL 375

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAK+MPVIS STYDNTQ KYNV++ILN DYSIN EKYK YSP+FVPFSYLLSYA
Sbjct: 376 YFTNTWYAKFMPVISSSTYDNTQNKYNVTKILNEDYSINLEKYKEYSPVFVPFSYLLSYA 435

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHC LY+GK+I  KF+++  GG DIHMR+YS+NYKDCPDWWY+ LQ++MI
Sbjct: 436 LNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGVDIHMRIYSKNYKDCPDWWYLTLQIVMI 495

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGFVAVC F++  PAWAFV+A+ IS VNFIPQGILEA+TNQHVGLNIITELICGYMLP 
Sbjct: 496 GLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLNIITELICGYMLPL 555

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLA+YMKV PRLIFA+QIYAT+ISGLVNVG+QEW
Sbjct: 556 RPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAIQIYATIISGLVNVGVQEW 615

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           M  NI  LC++ QP+GFTC NGRT+FN+SIIWS+PKYLFSPGRIYNP+MWFFLIGL+ PI
Sbjct: 616 MMHNIDGLCTTDQPNGFTCANGRTVFNSSIIWSLPKYLFSPGRIYNPLMWFFLIGLLFPI 675

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
           +V+ +Q KF   +  K  H+PVFF GPGNIPPSTPYNY+L+FA S+ L+ IRKR+  W++
Sbjct: 676 VVYAIQWKFPNFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFATSFCLHIIRKRWRAWYN 735

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMGAGVE GVA+AVVIIFLCVQYPGG L+WWGNNV+K TYD++Y+KFY LKKGE F
Sbjct: 736 KYNFVMGAGVEAGVAIAVVIIFLCVQYPGGKLSWWGNNVWKRTYDNDYKKFYTLKKGETF 795

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 796 GYDKWW 801

>ZYRO0D00330g Chr4 complement(22470..24866) [2397 bp, 798 aa] {ON}
           highly similar to uniprot|P40897 Saccharomyces
           cerevisiae YJL212C OPT1 Plasma membrane transporter that
           transports tetra- and pentapeptides and glutathione
           member of the OPT family
          Length = 798

 Score = 1172 bits (3031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/726 (76%), Positives = 645/726 (88%)

Query: 102 VWEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPS 161
           +WEG+ S + +SP+PEVRA + PTDDP+IVLNHWRTWFL TVFV+VFAGVNQFFSLRYPS
Sbjct: 73  IWEGDPSEMPDSPYPEVRAVLSPTDDPSIVLNHWRTWFLVTVFVVVFAGVNQFFSLRYPS 132

Query: 162 LSINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAY 221
           L+I+FLVAQV+CYP+GK LA LP+W C   P+FNLNPGPFTKKEHAVVTIAVALTSSTAY
Sbjct: 133 LTIDFLVAQVICYPLGKTLACLPDWKCKLVPFFNLNPGPFTKKEHAVVTIAVALTSSTAY 192

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
           AM IL AQ +FYNM +++GY +LLVW+SQML YGAAGLTRRWVV+PA+CIWPQTLISVSL
Sbjct: 193 AMYILNAQVSFYNMSVNSGYQLLLVWSSQMLGYGAAGLTRRWVVNPASCIWPQTLISVSL 252

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
           FDSLH+R+I+K+ VNGW + RY+FF+ V   SFVWYWVPGFLF GLSYFN+VLWGPKTRH
Sbjct: 253 FDSLHSRTIEKSSVNGWKVPRYKFFLFVLIGSFVWYWVPGFLFTGLSYFNIVLWGPKTRH 312

Query: 342 NFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPIL 401
           NF+ NTIFGV SGIGALPI+FDYTQISQA+TGSVFATP+WVSAN+ AS ++FFV +LPIL
Sbjct: 313 NFVLNTIFGVSSGIGALPISFDYTQISQAMTGSVFATPFWVSANTYASVLIFFVFLLPIL 372

Query: 402 YFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYA 461
           YFTNTWYAKYMPVIS ST+DNTQ+KYNV+RILN D+++N EKYKSYSPLFVPFSYLLSYA
Sbjct: 373 YFTNTWYAKYMPVISTSTFDNTQKKYNVTRILNPDFTVNLEKYKSYSPLFVPFSYLLSYA 432

Query: 462 LNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMI 521
           LNFAAVIAVFVHC LY+GK+I  K ++ N+GG DIH RLY QNYKDCPDWWY+VLQVIM+
Sbjct: 433 LNFAAVIAVFVHCGLYHGKDIYGKLKDANFGGSDIHRRLYQQNYKDCPDWWYLVLQVIML 492

Query: 522 ALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPF 581
            LGF AVC F++H PAWAFVVAL I+F NFIPQGILEA+TNQHVGLN+ITEL+CGYMLPF
Sbjct: 493 GLGFAAVCGFDTHFPAWAFVVALLIAFANFIPQGILEAITNQHVGLNVITELVCGYMLPF 552

Query: 582 RPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEW 641
           RPMANLLFKLYGFIVMRQGL LSRDLKLALYMK+PPRLIF +QIYAT++SGLVNVG+QEW
Sbjct: 553 RPMANLLFKLYGFIVMRQGLSLSRDLKLALYMKIPPRLIFCIQIYATIVSGLVNVGVQEW 612

Query: 642 MRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPI 701
           MR NIK+ CS  Q +GF C NGRT+FNASIIWSMPKYLFS GRIYNP+MWFFLIGL +P+
Sbjct: 613 MRHNIKDFCSPDQSNGFICANGRTVFNASIIWSMPKYLFSSGRIYNPLMWFFLIGLGLPL 672

Query: 702 IVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFS 761
            +F LQ        LK+ H+P+FFAGPGNIPPSTPYNY+L+FA+S+ L  IR+R+P WF 
Sbjct: 673 AIFGLQLLLPKVNFLKYIHTPIFFAGPGNIPPSTPYNYSLFFAMSFWLYIIRRRWPLWFK 732

Query: 762 KYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKF 821
           KYNFVMGAGVE GVA++V++IFLCVQYPGG+L WWGN+V+KNTYD+  +K+Y +K G+KF
Sbjct: 733 KYNFVMGAGVEAGVAISVLVIFLCVQYPGGTLKWWGNDVWKNTYDYQSKKYYTVKAGDKF 792

Query: 822 GYDKWW 827
           GYDKWW
Sbjct: 793 GYDKWW 798

>KNAG0G02310 Chr7 complement(530112..532484) [2373 bp, 790 aa] {ON} 
          Length = 790

 Score = 1132 bits (2927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/725 (72%), Positives = 622/725 (85%)

Query: 103 WEGNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSL 162
           WEG+ + ++NSP+ +VRA VP  DDPTI +NHWRTWFLTTVFVI+FAGVNQFFSLRYPSL
Sbjct: 66  WEGDPTDMKNSPYAQVRAVVPVGDDPTIEINHWRTWFLTTVFVILFAGVNQFFSLRYPSL 125

Query: 163 SINFLVAQVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYA 222
           +INFLVAQV CYP+GK+L+ LP+W C RC +F+LNPGPFTKKEHA+VTI+VALTSSTAYA
Sbjct: 126 TINFLVAQVCCYPIGKLLSWLPDWKCKRCHFFDLNPGPFTKKEHAIVTISVALTSSTAYA 185

Query: 223 MNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLF 282
           M +L AQT FY  K S GY  LLVWTSQML YGAAGLTRRW+V PAAC+WPQTLI+VSLF
Sbjct: 186 MYVLNAQTAFYKKKQSVGYQFLLVWTSQMLGYGAAGLTRRWIVYPAACVWPQTLIAVSLF 245

Query: 283 DSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHN 342
           DSLHN +IDKT VNGW ++RYRFF  V   SFVWYWVPG+LF GLS FNV+LWGPKTR+N
Sbjct: 246 DSLHNTAIDKTIVNGWRITRYRFFFFVLLGSFVWYWVPGYLFTGLSNFNVILWGPKTRNN 305

Query: 343 FIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILY 402
           FI NTIFGV+SG+G +P+TFDYTQISQALTGSVFATP++V AN+ AS  +FF+I+LP LY
Sbjct: 306 FIVNTIFGVKSGMGLMPVTFDYTQISQALTGSVFATPFYVVANTYASVFIFFMIVLPFLY 365

Query: 403 FTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYAL 462
           F N WYAKYMPVISG+TYDNT + +NV++++N D++IN EKYK YSP+ VPFSYLL+YAL
Sbjct: 366 FYNVWYAKYMPVISGTTYDNTGKSFNVTKVINPDFTINLEKYKKYSPIMVPFSYLLAYAL 425

Query: 463 NFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIA 522
           NFAAV+AVFVHC LY+GK+I   F N+ +GG+DIH R Y +NY DCPDWWY ++QV++  
Sbjct: 426 NFAAVVAVFVHCGLYHGKDIMKGFTNRFHGGRDIHTRTYLKNYNDCPDWWYGIVQVVVAG 485

Query: 523 LGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFR 582
           LGF  VC F+S LP WAF++A+ +S VNFIPQGILEA+TNQHVGLNIITELICGYMLP R
Sbjct: 486 LGFATVCGFDSGLPVWAFIIAIMLSLVNFIPQGILEAMTNQHVGLNIITELICGYMLPLR 545

Query: 583 PMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWM 642
           PM+NLLFKLYGFIVMRQGLELSRDLKL +YMKVPPRL+F +Q+YAT+ISG+V VGIQEWM
Sbjct: 546 PMSNLLFKLYGFIVMRQGLELSRDLKLGVYMKVPPRLLFFIQMYATIISGMVTVGIQEWM 605

Query: 643 RSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYNPIMWFFLIGLVVPII 702
             +I ++CS+TQ DGF C NGRT+FNASIIWS+PKYLFSP R+Y+P+MWFFLIGL+VP+ 
Sbjct: 606 YVHIDDVCSTTQKDGFICANGRTMFNASIIWSLPKYLFSPHRLYSPLMWFFLIGLLVPLG 665

Query: 703 VFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFPRWFSK 762
           V+  Q+ FK N+ LK  ++PVFF GPGNIPPSTPYNYTLYFA+ + L TIRKRFPRWF+K
Sbjct: 666 VYAAQRVFKKNQFLKHINTPVFFTGPGNIPPSTPYNYTLYFAMGYMLFTIRKRFPRWFNK 725

Query: 763 YNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNVYKNTYDHNYRKFYNLKKGEKFG 822
           YNFVMGA VETGVA+AVVIIFLCVQYP G++ WWGN V+KNTYD  Y+ +Y LKK E FG
Sbjct: 726 YNFVMGAAVETGVAIAVVIIFLCVQYPAGNIKWWGNTVWKNTYDGKYKTYYTLKKNETFG 785

Query: 823 YDKWW 827
             KWW
Sbjct: 786 PQKWW 790

>KLTH0E01496g Chr5 complement(146000..148444) [2445 bp, 814 aa] {ON}
           similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 814

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/740 (38%), Positives = 454/740 (61%), Gaps = 34/740 (4%)

Query: 105 GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSI 164
             +++  +SP+PEVRA+VP TDDP++V N  R W +  +   +  G+N  FS+  P++ +
Sbjct: 91  AGITVEDDSPYPEVRASVPSTDDPSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVL 150

Query: 165 NFLVAQVVCYPVGKILALLPEWDC--PRCPWF------NLNPGPFTKKEHAVVTIA--VA 214
              V  ++ +P+G+       WD   P  P F      +LNPGPF  KEHA++T    VA
Sbjct: 151 TTFVTSILAWPLGR------AWDMVMPDKPVFGRFGGPSLNPGPFNVKEHALITAMGNVA 204

Query: 215 LTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQ 274
             S  AYA +I+++  NFYN     G+ +L VW++Q + +  AGL+R+ +V+PA+ IWP 
Sbjct: 205 FGSGNAYATDIILSMNNFYNKDFGWGFDLLAVWSTQCIGFAMAGLSRKVLVTPASMIWPA 264

Query: 275 TLISVSLFDSLHNRSIDKTKV-NGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVV 333
            L++ +   ++H   I++  V NGW +SR +FF+ VF   FV+YW PGF+F+ LSYF  V
Sbjct: 265 NLVTCTFLTNMH---INENHVANGWKISRLKFFMIVFIVGFVYYWFPGFIFQALSYFAWV 321

Query: 334 LW-GPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVL 392
            W  PK   + I N +FG  +G+G +P+TFD+ QI+    GS    P  V A    S V+
Sbjct: 322 TWIKPK---DVIVNQVFGASTGLGLIPLTFDWNQIA-GYVGSPLVPPLGVIATILLSMVI 377

Query: 393 FFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFV 452
            F I++P ++++N WY KY+P+    +YD  Q  YNVS+I++   + N + Y+ YSPL++
Sbjct: 378 IFWIVVPAVHYSNIWYGKYLPISDSGSYDRFQNTYNVSKIVSESLTFNKDAYREYSPLYL 437

Query: 453 PFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRN-KNYGGQDIHMRLYSQNYKDCPDW 511
             ++ +SY L+FA  +A   H   ++GK+I    RN  +   +D+H +L  +NY+D P W
Sbjct: 438 SATFAISYGLSFAGTMATITHAICFHGKQIWGAIRNITSSEEEDVHAKLM-RNYRDVPQW 496

Query: 512 WYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIIT 571
           W++V+ +I   L    V A+ + +P +  ++AL I+F   +P GI+ A+TN  VGLN+IT
Sbjct: 497 WFIVVFLIFFGLSIATVRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTNIAVGLNVIT 556

Query: 572 ELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVIS 631
           E I GYM P +P+A + FK +G+I   Q +  ++D+K+  YMKV PR++F+ Q+ ATV  
Sbjct: 557 EFIIGYMTPGKPIAMMFFKTFGYITNNQAITFAQDMKIGHYMKVAPRVLFSAQLVATVWG 616

Query: 632 GLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPI 689
           GLV + + +W + NI+++C+S Q   FTC   +  FNASIIW +  P+ +FS G++Y+ +
Sbjct: 617 GLVQMCVMKWAQGNIEDICTSKQKSHFTCPGSKVFFNASIIWGVIGPQRMFSAGQMYDKL 676

Query: 690 MWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWAL 749
           M+FF++G  +P++ +++ KK+    ++++ + PVFF+G G IPP+TPYNY  Y  +    
Sbjct: 677 MYFFILGAGLPVVNWLVLKKWP-RSLVRYLNWPVFFSGTGLIPPATPYNYGAYCMVGIFF 735

Query: 750 NT-IRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPG-GSLNWWGNNVYKNTYDH 807
              I+K +  W++KYN+ + AG++  +A + +IIFL +      + +WWGNNV  NT D+
Sbjct: 736 GYFIKKNYFNWWAKYNYSLSAGLDISLAWSSLIIFLALGLTNTDAPSWWGNNVI-NTIDY 794

Query: 808 NYRKF-YNLKKGEKFGYDKW 826
           +     + L  GE FG  KW
Sbjct: 795 DGTAIQHQLTDGESFGLKKW 814

>Kwal_55.19788 s55 complement(125184..127616) [2433 bp, 810 aa] {ON}
           YJL212C (OPT1) - Oligopeptide transporter; Opt1p
           transports tetra- and pentapeptides, including the
           endogenous opioid pentapeptide leucine enkephalin.
           [contig 159] FULL
          Length = 810

 Score =  539 bits (1388), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 276/739 (37%), Positives = 446/739 (60%), Gaps = 31/739 (4%)

Query: 105 GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSI 164
             +++  +SP+PEVRA VP +DD ++V N  R W L  +   +  G+N  FS+  PS+ +
Sbjct: 86  AGITVEDDSPYPEVRAAVPSSDDTSLVQNTVRMWTLGMIMSTIGCGLNMLFSMHSPSIVL 145

Query: 165 NFLVAQVVCYPVGKILALLPEWDC--PRCPWF------NLNPGPFTKKEHAVVTIA--VA 214
              V  ++ +P+G+       WD   P  P F      + NPGPF  KEHA++T    V+
Sbjct: 146 TTFVTSILAWPLGR------GWDLIMPDKPMFGRFGGPSWNPGPFNVKEHALITAMGNVS 199

Query: 215 LTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQ 274
               +AYA +I+++  NFYN     G+ +L  W++Q + +  AGL R  +V+PA+ IWP 
Sbjct: 200 FGGGSAYATDIILSMNNFYNKDFGWGFDLLATWSTQCIGFAMAGLVRNVLVTPASMIWPA 259

Query: 275 TLISVSLFDSLHNRSIDKTKV-NGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVV 333
            L++ +   ++H   +++  V NGW++SR +FF+ +F A F++YW PGF+F+ LSYF  V
Sbjct: 260 NLVTTTFLTNMH---VNENHVANGWTISRLKFFLIIFLAGFIYYWFPGFIFQALSYFAWV 316

Query: 334 LWGPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLF 393
            W     ++ I N +FG  SG+G +P+TFD+ QI+    GS    P  V      S +L 
Sbjct: 317 TW--IKPNDVIVNQVFGASSGLGLIPLTFDWNQIA-GYVGSPLVPPLGVIVTILLSMILI 373

Query: 394 FVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVP 453
           F +++P ++++N WY KY+P+   S+YD  Q  YNVS+I++ + S +   Y+ YSPL++ 
Sbjct: 374 FWVVVPAVHYSNVWYGKYLPISDSSSYDRYQGTYNVSKIVSENLSFDKAAYEEYSPLYLS 433

Query: 454 FSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRN-KNYGGQDIHMRLYSQNYKDCPDWW 512
            ++ +SY L+FA + +  +H   ++GK I +  RN K    +D+H RL  Q Y+D P WW
Sbjct: 434 ATFAISYGLSFAGITSTIMHAICFHGKLIWDHMRNIKRAEDEDVHARLMRQ-YRDVPQWW 492

Query: 513 YVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITE 572
           Y+++ VI   +    + A+ + +P +  ++AL I+F   +P GI+ A+TN  VGLN+ITE
Sbjct: 493 YLIVFVIFFGMSVATIRAWPTEMPVFTLIIALLIAFFFLLPVGIIYALTNISVGLNVITE 552

Query: 573 LICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISG 632
            I GYM P +P+A + FK YG+I   Q +  ++D+KL  Y+K+ PR++FA Q+ AT+   
Sbjct: 553 FIIGYMTPGKPIAMMFFKTYGYITNNQAITFAQDMKLGHYLKLAPRVLFAAQLIATIWGS 612

Query: 633 LVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIM 690
           LV + + +W + NI+++C+  Q   FTC   R  FNASIIW +  P+ +FS G++YN +M
Sbjct: 613 LVQICVMKWAQGNIEDVCTRKQASHFTCPGARVFFNASIIWGVIGPQRMFSAGQMYNKLM 672

Query: 691 WFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALN 750
           +FF++G  +P++ +++ KK+ G+  +K+ + PVFF+G G IPP+TPYNY  Y  +     
Sbjct: 673 YFFILGAGLPVVNWLILKKWPGS-YIKYLNWPVFFSGTGLIPPATPYNYGAYCMVGIIFG 731

Query: 751 -TIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPG-GSLNWWGNNVYKNTYDHN 808
             I+ RF  W++KYN+ + AG++  +A + +IIFL +      +  WWGN+V   T D N
Sbjct: 732 YYIKTRFFNWWAKYNYTLSAGLDISLAWSSLIIFLALGLTNTDAPKWWGNDVMNGTMDTN 791

Query: 809 YRKFY-NLKKGEKFGYDKW 826
           Y      L++GE FG   W
Sbjct: 792 YTAVQRTLQEGEFFGLKSW 810

>SAKL0G15224g Chr7 complement(1311409..1313826) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  536 bits (1381), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 277/736 (37%), Positives = 440/736 (59%), Gaps = 27/736 (3%)

Query: 105 GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSI 164
             +++  +SP+PEVRA VP TDDP +  N  R W L  +   +   +N  FSL  PS+ +
Sbjct: 83  AGITIEDDSPYPEVRAAVPSTDDPLLPQNTVRMWTLGLIMTTIGCALNMLFSLHSPSIVL 142

Query: 165 NFLVAQVVCYPVGKI-------LALLPEWDCPRCPWFNLNPGPFTKKEHAVVTIA--VAL 215
              V  ++ +P+GK        + +  ++  P     +LNPGPF  KEHA++TI   V+ 
Sbjct: 143 TTFVTSILAWPLGKAWERFIPDVRVFGKYGGP-----SLNPGPFNLKEHALITIMGNVSF 197

Query: 216 TSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQT 275
               AYA +IL+A  NFY+     G+ +L +W++Q + +  AGL +  +V+PA+ +WP  
Sbjct: 198 GGGNAYATDILLAMNNFYHKNFGWGFNLLAIWSTQCIGFAMAGLAKDVLVTPASMVWPSN 257

Query: 276 LISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLW 335
           L++ +   +LH    +  K NGW++SR +FF  +F   FV+YW PGF+F+ LSYF  V W
Sbjct: 258 LVTCTFLTNLHVN--ENHKANGWTISRLKFFFLIFVIGFVYYWFPGFIFQALSYFAWVTW 315

Query: 336 GPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFV 395
                +N I N +FG  +G+G +P+TFD+ QI+    GS    P  V      S V  F 
Sbjct: 316 --IKPNNVIVNQVFGASTGLGIIPLTFDWNQIA-GYVGSPLIPPAGVIFTILLSMVSIFW 372

Query: 396 IILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFS 455
           +++P ++++N WY KY+P+    +YD  Q  YNVSRI+  + + +   Y  YSPL++  +
Sbjct: 373 VVVPAIHYSNVWYGKYLPISDSGSYDRFQGSYNVSRIVGDNLTFDKAAYNKYSPLYLSAT 432

Query: 456 YLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVV 515
           + +SY ++FA+  A  VH  L++GK+I N+ R      +D+H RL  Q YKD P WWY +
Sbjct: 433 FAISYGMSFASTTATVVHAALFHGKDIWNQVRRVKTEEKDVHARLM-QQYKDTPQWWYAI 491

Query: 516 LQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELIC 575
           + V+   L    +  +N+ +P +A V+AL I+    +P GI+ A+TN  VGLN+ITE I 
Sbjct: 492 VFVVFFGLSIATIRGWNTEMPVFALVIALLIAAFFLLPIGIIYALTNISVGLNVITEFII 551

Query: 576 GYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVN 635
           GYMLP +P+A + FK +G+I   Q +  ++D+KL  YMKV PR++F+ Q  AT+   LV 
Sbjct: 552 GYMLPGKPIAMMFFKTFGYITNNQAITFAQDMKLGHYMKVAPRIMFSAQFVATIWGSLVQ 611

Query: 636 VGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIMWFF 693
           + + +W + NIK++C   Q   FTC   R  FNAS+IW +  P+ +FS G++YN +M+FF
Sbjct: 612 ICVLKWAQGNIKDICEPHQKSHFTCPGSRVFFNASVIWGVIGPQRMFSSGQMYNKVMYFF 671

Query: 694 LIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALN-TI 752
           L+G ++PI+ +++ KK+  N +++  + PVFF+G G IPP+TPYNY  Y  +       +
Sbjct: 672 LLGALLPIVNWLILKKWP-NSLVRHLNWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYYV 730

Query: 753 RKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPG-GSLNWWGNNVYKNTYDHNYRK 811
           ++++  W+SKYN+ + AG++  +A + ++IFLC+      + +WWGNNV  NT D+    
Sbjct: 731 KQKWFHWWSKYNYSLSAGLDISLAWSSLMIFLCLSLTNTDAPSWWGNNVI-NTSDYEGTA 789

Query: 812 FY-NLKKGEKFGYDKW 826
               L++ + FG  KW
Sbjct: 790 IQVQLEEDQSFGLTKW 805

>SAKL0F14674g Chr6 complement(1170374..1172791) [2418 bp, 805 aa]
           {ON} similar to uniprot|P40897 Saccharomyces cerevisiae
           YJL212C OPT1 Plasma membrane transporter that transports
           tetra- and pentapeptides and glutathione member of the
           OPT family
          Length = 805

 Score =  533 bits (1374), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 275/736 (37%), Positives = 440/736 (59%), Gaps = 26/736 (3%)

Query: 105 GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSI 164
             +++  +SP+ EVRA VP TD+P I  N  R W L  +   + + +N  FS+  PS+ +
Sbjct: 82  AGITVDDDSPYAEVRAAVPSTDNPVIPQNTIRMWTLGFIMTTIGSAINMLFSMHSPSIIL 141

Query: 165 NFLVAQVVCYPVGKILA-LLPE------WDCPRCPWFNLNPGPFTKKEHAVVTIA--VAL 215
              V  ++ +P+GK  A  LP+      +  P     +LNPGPF  KEH ++T+   V+ 
Sbjct: 142 TTFVTSILAWPLGKAWARFLPDVRIFGKYGGP-----SLNPGPFNLKEHTLITVMGNVSF 196

Query: 216 TSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQT 275
               AYA +IL++  NFY      G+ +L +W++Q + +  AGL ++ +V+P+  IWP  
Sbjct: 197 GGGNAYATDILLSMNNFYGTDFGWGFGLLAIWSTQCIGFSLAGLAKKILVTPSTMIWPSN 256

Query: 276 LISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLW 335
           L++ +   +LH    +    +GW++SR RFF  VF   F++YW PGF+F+GLSYF  V W
Sbjct: 257 LVTCTFLTNLHIN--ENHSASGWTISRLRFFFLVFLIGFLYYWFPGFIFEGLSYFAWVTW 314

Query: 336 GPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFV 395
                +N + N +FG  +G+G +PITFD+ QI+   TGS    P  V      S V+ F 
Sbjct: 315 --IKPNNVVINQVFGASTGLGLIPITFDWNQIA-GYTGSPLIPPVGVLVTILLSMVIIFW 371

Query: 396 IILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFS 455
           I++PI++++N WY KY+P+    +YD  QQ YNVS+I++   + +   YK YSPL++  S
Sbjct: 372 IVVPIIHYSNVWYGKYLPISDSESYDRFQQPYNVSKIVDDSLTFDPAGYKKYSPLYLSAS 431

Query: 456 YLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVV 515
           + ++Y ++FA+  A  VH  L++GK++ ++ R+     +D+H RL  + YK+ P WWY +
Sbjct: 432 FAIAYGMSFASTTATIVHAVLFHGKDVWDQARSLKVEEEDVHARLMRE-YKETPCWWYAI 490

Query: 516 LQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELIC 575
           + ++   L  V V  +N+ +P +A ++AL I+    +P GI+ A+TN  VGLN+ TE I 
Sbjct: 491 VFLVFFGLAVVTVRVWNTEMPVYALIIALVIAAFFLLPIGIIYALTNIPVGLNVFTEFIV 550

Query: 576 GYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVN 635
           GYMLP +P+A + FK +G+I   Q +  ++D+KL  YMKV PRL+F  Q  AT+   LV 
Sbjct: 551 GYMLPGKPIAMMFFKTFGYITNNQAIIFAQDMKLGHYMKVAPRLLFTAQFLATIWGSLVQ 610

Query: 636 VGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIMWFF 693
           + + +W +  I  LCS  Q D +TC   R  FNAS+IW +  P  +FS G+IYN +++FF
Sbjct: 611 ICVLKWAQDTIPGLCSDDQKDNYTCPGSRVFFNASVIWGVIGPDKMFSSGKIYNGLLYFF 670

Query: 694 LIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALN-TI 752
           L+G ++P+I +++ +K+  N ++++ + PVFF+G   IPP+TP+NY  Y  +       +
Sbjct: 671 LLGAILPVINWLILRKWP-NSLIQYMNWPVFFSGTAMIPPATPFNYGAYCMVGIFFGYYV 729

Query: 753 RKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSL-NWWGNNVYKNTYDH-NYR 810
           R+++  W+SKYN+ + AG++ G+A + +IIFLC+     S  +WWGN+V  +T D     
Sbjct: 730 RRKWFHWWSKYNYSLSAGLDIGLAWSSLIIFLCLYLTNASFPDWWGNSVVDSTMDSWGTA 789

Query: 811 KFYNLKKGEKFGYDKW 826
               L  GE FG   W
Sbjct: 790 IQRQLSDGESFGLTSW 805

>KLLA0E00419g Chr5 (28957..31341) [2385 bp, 794 aa] {ON} similar to
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 794

 Score =  528 bits (1361), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 277/731 (37%), Positives = 435/731 (59%), Gaps = 29/731 (3%)

Query: 111 QNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQ 170
            +S +PEVRA VP +DDPT+  N  R W +  +   V +G+N  FSL  PS+ ++  V  
Sbjct: 78  DDSAYPEVRAAVPSSDDPTLPQNTVRMWVIGMLMATVGSGLNLLFSLHSPSIVLSAFVTS 137

Query: 171 VVCYPVGKILALLPEWD--CPRCPWF------NLNPGPFTKKEHAVVTIA--VALTSSTA 220
           ++ +P+GK       WD   P    F      +LNP PF  KEH ++ I   V+     A
Sbjct: 138 ILAWPIGK------AWDKVMPDVKLFGRFGGPSLNPSPFNLKEHCLIQIMANVSFGGGEA 191

Query: 221 YAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVS 280
           YA +I +A  N++      G+ I+ +  +Q + +  AGL +  +++PA+ IWP  L++ +
Sbjct: 192 YATDIFLAMNNYFEADFGWGFDIVTILATQCIGFALAGLVKDILITPASMIWPSNLVTCT 251

Query: 281 LFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTR 340
              +LH    +    NGW +SR +FF  VF   FV+YW PGF+F+ LSYF  V W     
Sbjct: 252 FLTNLHIN--ENHMANGWKISRLKFFFMVFIIGFVYYWFPGFIFQALSYFAWVTW--IRP 307

Query: 341 HNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPI 400
            N I N IFG  +G+G +P+TFD+ QI+    GS    P     +   S ++ F + +P 
Sbjct: 308 DNVIINQIFGASTGLGIIPLTFDWNQIA-GYVGSPLVPPVSTIFSILLSMIMIFWVTVPA 366

Query: 401 LYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSY 460
           ++++N W+ KY+P+    +YD  QQ YNVS+I+  + S + + YKSYSPL++P ++++SY
Sbjct: 367 IHYSNVWFGKYLPISDSGSYDRFQQSYNVSKIVTPNLSFDIDAYKSYSPLYLPATFVISY 426

Query: 461 ALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIM 520
            ++FA+  A  VH  L++GKEI   FRN     +DIH RL  +NY+D P WWY ++ ++ 
Sbjct: 427 GMSFASNTATLVHAGLFHGKEITGAFRNVKKEQEDIHNRLM-KNYRDVPHWWYGIVFLVF 485

Query: 521 IALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLP 580
             L    + A+N+ +P WA + AL I+ V  +P GI+ AVT+  VGLN++TE I GY+LP
Sbjct: 486 FGLAIAGIRAWNTEMPVWALIFALVIAGVFLVPIGIICAVTSISVGLNVLTEFIIGYILP 545

Query: 581 FRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQE 640
            +P+A + FK +G+I   Q +  ++D+KL  YMK+ PRL+F+ Q  ATV S +V V + +
Sbjct: 546 GKPIAMMFFKTFGYITNHQAVTYAQDMKLGHYMKIAPRLMFSAQFIATVWSSVVQVCVLK 605

Query: 641 WMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIMWFFLIGLV 698
           W + NI ++C + Q   FTC N R  FNA+IIW +  P+ +FS G++Y+ ++WFFLIG  
Sbjct: 606 WAQGNITDVCDAHQKSHFTCPNARVFFNAAIIWGVIGPQRMFSSGQLYSKVLWFFLIGAS 665

Query: 699 VPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLYFALSWALNT-IRKRFP 757
           +P+I +++ KK+  +  +K+ + PVFF+G G IPP+TPYNY  Y  +       I++++ 
Sbjct: 666 LPLINWLVLKKWPKSP-IKYLNWPVFFSGTGLIPPATPYNYGSYCMVGITFGYFIKRKWF 724

Query: 758 RWFSKYNFVMGAGVETGVALAVVIIFLCVQYPG-GSLNWWGNNVYKNTYDHNYRKFYN-L 815
            W++KYN+ + A ++  +A + ++IF C+      + NWWGN V  +T D+      + L
Sbjct: 725 HWWTKYNYSLSAALDISLAWSSLMIFFCLTLTNTNAPNWWGNTVI-DTIDYEGTAIQSIL 783

Query: 816 KKGEKFGYDKW 826
             GE FG  KW
Sbjct: 784 NDGESFGLTKW 794

>ABR156W Chr2 (692938..695328) [2391 bp, 796 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJL212C (OPT1)
          Length = 796

 Score =  498 bits (1282), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 284/774 (36%), Positives = 436/774 (56%), Gaps = 51/774 (6%)

Query: 72  SRGHLANEGAGAEGKXXXXXXXXXXXXXXXVWEGNVSLLQNSPFPEVRATVPPTDDPTIV 131
           S   +  EGA  EG                    +V +  +SP+PEVRA VP  DD T++
Sbjct: 45  SEKKVDKEGADTEGDSGEFT--------------DVLVEDDSPYPEVRAAVPSFDDTTML 90

Query: 132 LNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKILALLPEWDCPRC 191
            N  R W +  +   + + VN  FS+  PS++++  V  ++ +P+G+  A    W  P  
Sbjct: 91  QNTVRMWTIGLLMTTIGSAVNMLFSMHAPSMAVSTFVTSMLAWPLGRFWA---RW-VPNV 146

Query: 192 PWFN------LNPGPFTKKEHAVVTIA--VALTSSTAYAMNILIAQTNFYNMKLSAGYMI 243
             F       LNPGPF+ KEHA++T+   ++     AYA +IL++   FY       + +
Sbjct: 147 RIFGRFGGPFLNPGPFSLKEHALITVMGNISFGGGAAYATDILLSMNMFYKRDYGWLFDL 206

Query: 244 LLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKV-NGWSMSR 302
           L +W++Q + +  AGL  + +++P   IWP TL+  +   ++H   I   KV NGW +SR
Sbjct: 207 LAIWSTQCIGFSLAGLCYKILITPPLMIWPSTLVQCTFLSNIH---IHNNKVANGWKVSR 263

Query: 303 YRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLW-GPKTRHNFIANTIFGVESGIGALPIT 361
            +FF+ +F A F++YW+PG+LF+ LS F  V W  PK   N + N IFG  +G+G LPIT
Sbjct: 264 LKFFMIIFIAGFIYYWLPGYLFQALSSFAWVTWIAPK---NVVVNQIFGSSTGLGLLPIT 320

Query: 362 FDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTYD 421
           FD+ QI+    GS    P         S V  F I++PI++++NTWY  Y+P+   ++ D
Sbjct: 321 FDWNQIA-GYVGSPLVPPISAIFTILCSMVTIFWIVVPIVHYSNTWYGNYVPISDSTSMD 379

Query: 422 NTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGKE 481
             QQ+YNV++++N   S++ E Y SYS L++P ++ +SY ++FA+V+A   H   ++ + 
Sbjct: 380 RFQQRYNVTKVVNQRLSLDLEAYHSYSRLYLPTTFAISYGMSFASVMATISHTACFHWRT 439

Query: 482 IKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFV 541
           I N  RN N   +D+H RL  + YK  P WWY+V   + +AL    V A+++ LP WA  
Sbjct: 440 IYNGVRNINTQDRDVHARLM-ERYKAPPYWWYLVTFFVFLALSIATVRAWDTQLPVWALF 498

Query: 542 VALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGL 601
           +ALAI+    +P GI+ A+TN  VGLN+ITE I GYMLP RP+A + FK +G+I   Q +
Sbjct: 499 LALAIAGFFLLPVGIIYALTNMAVGLNVITEFIIGYMLPGRPIAMMFFKTFGYITNSQAI 558

Query: 602 ELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCN 661
             ++D+KL  Y+KV P+L+F  Q  AT+    V + +  W  +NIK LC+  QP  FTC 
Sbjct: 559 TFAQDMKLGHYLKVAPKLMFTAQFIATIWGSTVQIAVLRWSEANIKGLCTKAQPGHFTCP 618

Query: 662 NGRTIFNASIIWSM--PKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKF-----KGNE 714
                F ASIIW +  P+ +FS G++Y+ + +FF++G  +PI+ +++  K+     K   
Sbjct: 619 GATVFFTASIIWGVIGPQRMFSAGQMYSSLNYFFVLGFFLPIVNWLILSKWSKRFEKSGR 678

Query: 715 MLKFCHS----PVFFAGPGNIPPSTPYNYTLYFALSWALNTIRKRFP-RWFSKYNFVMGA 769
            LKF       PVFF+G G IPP+TPYNY  Y  +        KR+  +W+ KYN+ + A
Sbjct: 679 GLKFVAKYLSWPVFFSGTGLIPPATPYNYGSYCIVGIFFGYFIKRYYFQWWCKYNYSLSA 738

Query: 770 GVETGVALAVVIIFLCVQYP-GGSLNWWGNNVYKNTYDHNYRKF-YNLKKGEKF 821
            ++ G+A   +IIF         +  WWGN V  +T D N +   Y L++GE F
Sbjct: 739 ALDIGLAWGALIIFFSTGIAVRKAPVWWGNTVI-DTLDTNGQAIKYILQEGEYF 791

>Ecym_7185 Chr7 (379870..382272) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii ABR156W
          Length = 800

 Score =  489 bits (1258), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/725 (36%), Positives = 424/725 (58%), Gaps = 35/725 (4%)

Query: 105 GNVSLLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSI 164
            ++++  +SP+PEVRA VP  DD +++ N  R W +      V + +N  FS+  P +++
Sbjct: 66  ASLTVEGDSPYPEVRAAVPSYDDSSLLQNTVRMWAIGLFMTTVGSALNMLFSMHTPPIAL 125

Query: 165 NFLVAQVVCYPVGKILA-LLPEWDC---PRCPWFNLNPGPFTKKEHAVVTIA--VALTSS 218
              V  ++ +P+GK     +P W        P+  LNP PF  KEHA++TI   VA    
Sbjct: 126 TAFVTSLMGWPMGKAWEYFVPNWRLFGPLGGPY--LNPTPFNLKEHALITIMGNVAFGGG 183

Query: 219 TAYAMNILIAQ--TNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTL 276
            AYA +IL++    +FYN      + +L VW++Q + +  AG+  + +V PA  IWP  L
Sbjct: 184 NAYATDILLSMHIKDFYNRNYGWAFDLLAVWSTQCIGFSLAGMCHQILVKPAVMIWPSAL 243

Query: 277 ISVSLFDSLHNRSIDKTKV-NGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLW 335
           ++ +   ++H   I++  V NGW +SR +FF+ VF   FVWYW+PG+LF+ L  F   LW
Sbjct: 244 VTCTFLTNIH---INENHVANGWKISRLKFFLIVFIIGFVWYWIPGYLFQALGTFVWPLW 300

Query: 336 -GPKTRHNFIANTIFGVESGIGALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFF 394
             PK   N I N +FG ++G+G LP+TFD+ QIS   TGS    P         S V  F
Sbjct: 301 IAPK---NVIVNQLFGPQTGMGLLPLTFDWNQIS-GFTGSPLVPPVSAIITIAISVVSIF 356

Query: 395 VIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPF 454
            I+LPI++++N WY KY+P+    +YD  Q  YNVS I++   S++ ++Y++YSPL++P 
Sbjct: 357 WILLPIIHYSNIWYGKYLPMSRSKSYDRYQNTYNVSAIVDETLSLDKQEYQNYSPLYLPT 416

Query: 455 SYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNKNYGGQDIHMRLYSQNYKDCPDWWYV 514
           S+ +SY ++FA++ A  +H  L++GK+I  + R+     +D+H RL  ++YK  P WWY 
Sbjct: 417 SFAISYGMSFASITATVMHTILFHGKDIVARMRSLKTEEEDVHARLM-KSYKTVPWWWYA 475

Query: 515 VLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELI 574
            + ++ +A+    +  +++ +P WA + AL I+ V  +P GI+ A+TN  VGLN+ITE +
Sbjct: 476 CVFLVFLAMSIAVIAGWDTQMPIWALIFALGIATVFLLPVGIIYALTNISVGLNVITEFL 535

Query: 575 CGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLV 634
            GY+LP RP+A + FK +G+I   Q +  ++D+K+  Y+K+ PRL+F  Q  AT+  G V
Sbjct: 536 IGYVLPGRPIAMMFFKTFGYITNNQAITFAQDMKIGHYLKLAPRLMFTAQFLATIWGGTV 595

Query: 635 NVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIMWF 692
            V +  W   NI +LC  T+   F C +    FNASIIW +  P+ +FS G++Y+ + +F
Sbjct: 596 QVAVMRWAEGNIPDLC--TKDGSFNCPHATVFFNASIIWGVIGPQRMFSSGQLYSKLNYF 653

Query: 693 FLIGLVVPIIVFVLQKKF-----KGNEMLKFCHS----PVFFAGPGNIPPSTPYNYTLYF 743
           F+ G ++P+I +++  K+     K   + K C      PVFF+G G IPP+T YNY  Y 
Sbjct: 654 FIAGAILPVINWLILNKWPKRFEKYGRIPKICAKYLSWPVFFSGTGMIPPATAYNYGAYC 713

Query: 744 ALSWALNTIRKRF-PRWFSKYNFVMGAGVETGVALAVVIIFLCVQ-YPGGSLNWWGNNVY 801
            L        KR+   W++KYN+ + A ++ G+A + +I+F     +     +WWGNNV 
Sbjct: 714 ILGIFFGYFVKRYWFHWWTKYNYSLSAALDIGLAWSALIVFFSTSIHTVNPPSWWGNNVV 773

Query: 802 KNTYD 806
            NT D
Sbjct: 774 SNTLD 778

>SAKL0D09350g Chr4 (775699..778362) [2664 bp, 887 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 887

 Score =  338 bits (866), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 234/721 (32%), Positives = 368/721 (51%), Gaps = 47/721 (6%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V P+D+PTI +  +R +FL  V+ IV +G N+FFS R  S+SI+  V Q+
Sbjct: 151 HSPYAEVRAVVEPSDNPTIPVETFRAYFLALVWGIVGSGFNEFFSHRLVSISISTSVVQM 210

Query: 172 VCYPVGKILAL-LPEWD-CPRCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 228
             Y  G + A  LP W    +   F LN   P+T KE    T+  A+ +   Y    ++ 
Sbjct: 211 FLYLCGTLWAKHLPCWGFTVKGKRFALNIETPWTDKEQMFATLLFAICNGVFYTHYNILT 270

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q  +Y  K+S GY   L    Q + +G AG+ RR+VV PA  +WP ++ +++L ++L +R
Sbjct: 271 QKIYYGDKISFGYQFWLSICIQFIGFGFAGILRRFVVYPARTLWPTSMSTIALNNALLSR 330

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
             D +K     +SRY FF    +  F++ W P +L   L+ FN + W     +NF    I
Sbjct: 331 EKDVSK----GLSRYSFFFIATTFMFLYTWFPTYLINILNTFNWMTW--IAPNNFDLAAI 384

Query: 349 FGVESGIGALPIT-FDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            G  SG+G  PI+ FD+  I+         TP++  +   A +  F  +++  +Y+TN  
Sbjct: 385 TGGVSGLGINPISSFDWNVINFLYP---LVTPFFSYSVQFAGS-FFAALVVIAVYYTNYK 440

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +Y+P+ S S + NT   Y++ +ILNSDY ++ EKY+ YSP F     L+SY    A  
Sbjct: 441 DCQYLPIFSNSLFTNTGTPYSIKKILNSDYKVDEEKYQQYSPPFYSAGNLVSYGSFIAVY 500

Query: 468 IAVFVHCFLYNGKEIKNKFRN--------------KNYGGQDIHM--------RLYSQNY 505
             + ++ F+   K +    ++               N   Q+ H             + Y
Sbjct: 501 PMLIIYAFITESKVLLGACKDWAKGIWSLRKWQSWTNMAKQEYHALDSFNDPHSNMMKKY 560

Query: 506 KDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHV 565
           K+ PDWWY ++ +I I +  + +  + ++ P WA  ++L  +FV  IP  IL+A T   +
Sbjct: 561 KEVPDWWYFMILLISIVISIIVLEKYETNTPIWALFMSLGFNFVFLIPITILQATTGFSI 620

Query: 566 GLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQI 625
           GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q+
Sbjct: 621 GLNLLIEMIIGYALPGNPYALMIVKAFGYNIDGQADNYVSNLKMAHYCKIPPVALFRGQL 680

Query: 626 YATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPG 683
           +   +  LVN+G+  W  SNIK+ C   Q   FTC + RT +NAS++W    PK +F+  
Sbjct: 681 FMVFVQVLVNLGVLNWQISNIKDFCQPNQASKFTCPDARTYYNASVMWGAMGPKKIFN-- 738

Query: 684 RIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTL-- 741
            +Y  + W +LIG  +   VF    K  G        +P+ F G G I    PY      
Sbjct: 739 DVYPILRWCWLIGACLG--VFFGLWKVYGRRYYPTWFNPILFVG-GMINMGPPYGLMYVV 795

Query: 742 --YFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNN 799
             +F   ++   ++K   R + KYN+V  A    G+  + ++IF  VQY    LNWWGN 
Sbjct: 796 PGFFVSFFSQFYLKKYHLRLWEKYNYVCDAAFSAGLVFSSIVIFFAVQYKQKDLNWWGNT 855

Query: 800 V 800
           V
Sbjct: 856 V 856

>TPHA0C05020 Chr3 (1085361..1088051) [2691 bp, 896 aa] {ON} 
          Length = 896

 Score =  336 bits (862), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 227/731 (31%), Positives = 367/731 (50%), Gaps = 51/731 (6%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V  TDDP I +  +R++FL  +  IV +G N+FFS R  ++S+N  V Q+
Sbjct: 160 HSPYKEVRAVVEATDDPNIPVETFRSYFLALLCAIVGSGFNEFFSHRVVTISVNTSVIQM 219

Query: 172 VCYPVGKILA-LLPEWDCP---RCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILI 227
             Y  GK     +P W      R    N++  P+T KE    T+  A+ S T Y    ++
Sbjct: 220 FLYFFGKAWERYIPCWGISVKGRKYAINIDK-PWTAKEQMFATLLFAICSGTFYTHYNIL 278

Query: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287
            Q  +Y   +  GY   L  + Q L +G AG+ RR+VV     +WP  + +++L  +L +
Sbjct: 279 TQKVYYKEDVPFGYQFWLSLSVQFLGFGFAGILRRYVVYNPRALWPTVMTTLALNKALLD 338

Query: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347
              DK    G  MSRY+FF   FSA F++ W P ++   L+ FN + W   +  N     
Sbjct: 339 NKQDK----GNGMSRYKFFFITFSAMFIYNWFPTYIINILNTFNWMTW--ISPQNLKLAL 392

Query: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406
           I G  SG+G  P  +FD+  +S     S    P++ +      A  F  +++  +YFTN 
Sbjct: 393 ITGGVSGLGFNPFPSFDWNVVSNV---SPLIIPFYSNMTQFCGA-FFAALVIIAVYFTNY 448

Query: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAA 466
              +Y+P+ +   + N    Y ++ ILNSD+ I+ +KY+ YS  +     L++Y    A 
Sbjct: 449 KDCQYLPMFTNPLFTNKATVYEITNILNSDFKIDEKKYQEYSAPYYTAGNLVAYGSFIAL 508

Query: 467 VIAVFVHCFLYNGKEIKNKFR-------------------NKNYGGQDIHMRLYS---QN 504
              + V+ F+ + + +   F                    +K Y   D +   +S   +N
Sbjct: 509 YPLLIVYSFITDWELLSGAFGLWINSLWSFRSWNQWKKTFSKQYSAMDSYDDAHSNMMKN 568

Query: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564
           Y + PDWWY ++ +  I +       + ++ P WA  V++  +F   IP  ILEA T   
Sbjct: 569 YAEVPDWWYFIILICSIIVAICVCEKYQTNTPIWALFVSIGFNFAFLIPLTILEATTGFS 628

Query: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624
            GLN++ E+I GY LP  P+A +L K +G+ +  Q      +LK+  Y K+PP  +F  Q
Sbjct: 629 FGLNLLIEMIIGYALPGNPLALMLVKAFGYNIDGQADNYVSNLKMGHYSKIPPVALFRGQ 688

Query: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSP 682
           +    I   VN+G+  W  SNIK  C+ TQ   FTC + +T +NAS++W    PK +F+ 
Sbjct: 689 LIMVFIQIFVNLGVLNWSISNIKGFCTRTQSAKFTCPDAQTYYNASVVWGALGPKKIFN- 747

Query: 683 GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLY 742
             +Y  + W +LIG ++ +  F + ++F       + +  +F  G  N+ P  PY   +Y
Sbjct: 748 -EVYPILRWCWLIGALIGLF-FGIWRRFGSKYYPNWFNPVLFVGGMSNLSP--PYG-LMY 802

Query: 743 FALSWALN-----TIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWG 797
           F     +N      +++   R +SKYN+++ +G  +G+ L+ +IIF  VQ+    L+WWG
Sbjct: 803 FIPGIVVNWFSQYYMKRNHLRLWSKYNYILDSGFTSGLVLSAIIIFFAVQFKDTELSWWG 862

Query: 798 NNVYKNTYDHN 808
           NNV  N  D N
Sbjct: 863 NNVPYNGVDAN 873

>Kwal_55.19561 s55 complement(25934..28582) [2649 bp, 882 aa] {ON}
           YPR194C (OPT2) - oligopeptide transporter [contig 159]
           FULL
          Length = 882

 Score =  335 bits (860), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 233/735 (31%), Positives = 375/735 (51%), Gaps = 68/735 (9%)

Query: 109 LLQNSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLV 168
           L  +SP+ EVRATV P DDP I +  +R++FL  V+ I+ +G N+FFS R  S+S++  V
Sbjct: 142 LKYHSPYKEVRATVDPRDDPNIPVETFRSYFLALVWAIIGSGFNEFFSHRLVSISLSTSV 201

Query: 169 AQVVCYPVGKILAL------LPEWDCPRCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAY 221
            Q+   P GK           P W   R    NLN   P++ KE    T+  A+   T Y
Sbjct: 202 IQMFLLPCGKFWEKYVPKVGFPIWKGKRI---NLNIDSPWSAKEQMFSTLLFAICMGTFY 258

Query: 222 AMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSL 281
               ++    +YN  +  GY   L    Q + +G AGL R++VV PA  IWP +L +++L
Sbjct: 259 THYNILTLKVYYNDDVDFGYQFWLSMGVQFMGFGFAGLLRKYVVYPARAIWPGSLQTLAL 318

Query: 282 FDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRH 341
             +L   S  K    G  ++   FF    +  F + W+P +L   LS FN + W      
Sbjct: 319 NKALFKDSGSK---KGKGLASQTFFFLSVAFMFFYTWIPTYLMNFLSMFNWMTW--IAPD 373

Query: 342 NFIANTIFGVESGIGALPIT-FDYTQIS--QALTGSVFATPYWVSANSCASAVLFFVIIL 398
           NF    + G  SG+G  PI+ FD+  I    ALT     TP++      A  +L  +I++
Sbjct: 374 NFNLAMVTGSVSGLGFNPISSFDWNVIDFLGALT-----TPFFSYFTQLAGGILSALIVI 428

Query: 399 PILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLL 458
            I Y++N +  +Y+P+ S S + NT +++ +++ILNS++ ++ +KY+ YSP +     ++
Sbjct: 429 AI-YWSNYYDCQYLPIFSNSLFTNTGERFKITKILNSEWKLDPQKYQEYSPPYFSAGNIV 487

Query: 459 SYALNFAAVIAVFVHCFLYNGKEI-----------------KNKFRNKNYGG------QD 495
           +Y   F A+  + +   L++   +                 K+ +RN N          D
Sbjct: 488 TYG-TFIAIYPLLIVYALFSETNVLFGAVKGWFSDIFSLFKKDTWRNWNAETNKLDEFDD 546

Query: 496 IHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQG 555
            H R+  Q YK+ PDWWY V+ ++ + +G   +  ++++ P WA ++++  +FV  IP  
Sbjct: 547 AHSRMMKQ-YKEVPDWWYFVIFLVSLIIGICFIERYHTNTPVWALLMSIGFNFVFLIPLT 605

Query: 556 ILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKV 615
            L++VT   +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+  Y KV
Sbjct: 606 TLQSVTTFSLGLNVLIEMIVGYALPGNPQALMIIKAFGYNIDGQADNYVSNLKMGHYAKV 665

Query: 616 PPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM 675
           PP  +F  Q+    +   VN+G+  W  SNIK+ C  TQ   FTC +  T +N+S++W  
Sbjct: 666 PPVALFRGQLIMVFVQIFVNLGVLNWSISNIKDFCMPTQSAKFTCPDATTYYNSSVMWGA 725

Query: 676 PKYLFSPGRIYN---PIM-WFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNI 731
                 P +I+N   PIM W +LIG  + +   V +K F+         +PV  AG G +
Sbjct: 726 ----LGPKKIFNDVYPIMRWSWLIGACIGLFFGVWRKFFR--RYYPTWLNPVLIAG-GML 778

Query: 732 PPSTPYNYTLYFALSWALNTI------RKRFPRWFSKYNFVMGAGVETGVALAVVIIFLC 785
             S PY  T  + +  A+         ++R  R +SK+N+V+ AG   G+  + ++IF  
Sbjct: 779 NVSPPYGLT--YVIPGAIANFFSQFYYKRRHVRLWSKFNYVLSAGFSAGLVFSSIVIFFA 836

Query: 786 VQYPGGSLNWWGNNV 800
           VQY    LNWWGN V
Sbjct: 837 VQYKNYDLNWWGNTV 851

>YPR194C Chr16 complement(924304..926937) [2634 bp, 877 aa] {ON}
           OPT2Oligopeptide transporter; member of the OPT family,
           with potential orthologs in S. pombe and C. albicans;
           also plays a role in formation of mature vacuoles
          Length = 877

 Score =  333 bits (855), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 231/723 (31%), Positives = 368/723 (50%), Gaps = 53/723 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V P DDPTI +  +R +FL  ++ ++ +G N+FFS R  S+S+N  + Q+
Sbjct: 143 HSPYQEVRAVVDPEDDPTIPVETFRAYFLAIIWSVIGSGFNEFFSHRVVSISLNTPIIQM 202

Query: 172 VCYPVGKILA-LLPEWDCP-RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 228
             Y  GK  A  +P W    R   + +N   P+T+KE    T+  A+     Y    ++ 
Sbjct: 203 FLYICGKAWAKTIPCWTITIRGRKYGINIDKPWTQKEQMFSTLLYAICQGAFYTHYNILT 262

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q  FY+   S GY  LL  + Q + +G AG+ R++VV PA  +WP  + ++++     N+
Sbjct: 263 QKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAI-----NK 317

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
           ++   + +   MSRY+FF   F   F++ W P ++   L+ FN + W   +  N +AN  
Sbjct: 318 ALLGKEKHESGMSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANIT 376

Query: 349 FGVESGIGALPIT-FDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            GV +G+G  PI+ FD+  IS     S    P+W         +L  +I++ + Y++N  
Sbjct: 377 GGV-TGLGINPISSFDWNVIS---FNSPLVYPFWSYLTQYLGCILAALIVIAV-YYSNYM 431

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +Y+P+ + S Y NT   + V+ +L+SD  ++ +KY+SYSP +     L+SY     A 
Sbjct: 432 SCQYLPIFTNSLYTNTGHSFKVTEVLDSDNKLDVKKYQSYSPPYYSAGNLVSYGAFICAY 491

Query: 468 IAVFVHCFLYNGKEIKNKFRN-------------------KNYGGQDIHMRLYS---QNY 505
             +    F+ + K + N F++                    +Y   D +   +S   +NY
Sbjct: 492 PLMITWSFIVHSKLLFNAFKDWALNLWAMRKLKSWVTMFKSDYRALDDYDDPHSNAMKNY 551

Query: 506 KDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHV 565
           K+ PDWWY  + +  + +G   V  + ++ P W   V L  +FV  IP  IL+A T    
Sbjct: 552 KEVPDWWYFAILIGSLVVGIAVVEHYPTNTPVWGLFVCLGFNFVFLIPTTILQATTGYSF 611

Query: 566 GLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQI 625
           GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q 
Sbjct: 612 GLNLLIEMVMGYALPGNPIAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMALFRGQC 671

Query: 626 YATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRI 685
               I   VN+G+  W  SNIK+ C+  Q   FTC +  T +NAS++W        P RI
Sbjct: 672 VIVFIQIFVNLGVLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGA----IGPKRI 727

Query: 686 YN---PIM-WFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYN--- 738
           +N   PI  W +LIG  + I   V ++   G    ++    +F  G  N+ P  PYN   
Sbjct: 728 FNYIYPIFKWCWLIGACIGIFFGVWKR--WGKFYPRYFDPMLFVGGMLNMSP--PYNLMY 783

Query: 739 YTLYFALSWALNTIRKRFP-RWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWG 797
           YT    +S+      KR     + KYN+V+ AG  TG+ L+ +IIF  VQY   + NWWG
Sbjct: 784 YTSGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWWG 843

Query: 798 NNV 800
           N V
Sbjct: 844 NTV 846

>ZYRO0G22484g Chr7 (1848658..1851123) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  328 bits (840), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 197/687 (28%), Positives = 352/687 (51%), Gaps = 26/687 (3%)

Query: 133 NHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKILA-LLPEWDCPRC 191
           N  R W ++ +  +V AG++ FF+ R+PS+SI  +VAQ++ YP G I A ++P W     
Sbjct: 129 NTLRMWLMSIILSMVIAGIDSFFAFRFPSISIGPIVAQLISYPCGIIWARIMPNWKFSIG 188

Query: 192 P--WFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTS 249
               F LNPG F+ +E A+V +      +T    N  + Q  F+ + +  G  IL     
Sbjct: 189 SKYTFELNPGNFSPQEQALVYLFCNTVIATGLLRNTQVEQIKFFKVDVGIGRFILFDMVG 248

Query: 250 QMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTV 309
            ++ +G AGL+   +V     IWP  L   +L ++LH+ +  K  ++ +   ++ FF+  
Sbjct: 249 YLIAWGMAGLSIPMLVDREELIWPSVLSPSALINALHSGT--KGSISDFKKPKFSFFMIA 306

Query: 310 FSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPITFDYTQISQ 369
           F+ SFVWYW    +F  ++         + + N +   +FGV++G+G LPI+FD+  IS 
Sbjct: 307 FAGSFVWYWFSDLIFPFIASLGAFPSWIRPK-NKVLGQVFGVKNGLGLLPISFDWPTISN 365

Query: 370 ALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNV 429
               +   TP W      AS   +  I++P LY+ N W   ++P++S   +D   Q Y V
Sbjct: 366 --INNPLTTPVWAGVMIFASFFFWAWIVIPGLYYQNHWETAHLPLMSNKIFDKNGQSYQV 423

Query: 430 SRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNK 489
             ++NS + ++ +KYK YSP+++P  +L+  AL      ++ +  F     ++ + F+  
Sbjct: 424 KNVVNSKWELDLDKYKQYSPVYLPIGFLIQLALGLGGFSSMMIFFFWKFKSDVWDPFKQ- 482

Query: 490 NYGGQDIHMRLYSQNYKDCPDWWYVVL----QVIMIALGFVAVCAFN--SHLPAWAFVVA 543
                  H    + +YK   + ++V       V+ +ALGFV V A+N  + + +  F+V+
Sbjct: 483 -------HSTKKTAHYKSAYNKFFVAAFIGSMVLGLALGFVFVEAWNRDTQIDSGGFIVS 535

Query: 544 LAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLEL 603
           + I  V ++P  ++E+ ++  + +N    ++  +    +PMA L F  +G+ + +  +  
Sbjct: 536 IIIGIVLYLPVALVESKSSFTLNMNGFFNVVGAFWYKGKPMATLYFLNFGYSIFQHAMHF 595

Query: 604 SRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNG 663
           ++  KL  YMK PPRL   V   A V + LV   +  ++  ++  +C+S   +   C + 
Sbjct: 596 TQGAKLGYYMKTPPRLTLFVLFVAGVWASLVTPSVTGYVLYHVGNVCTSNAHNNMVCRSQ 655

Query: 664 RTIFNASIIWSM-PKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSP 722
           +T FN  IIW +   +LFS G  Y  IM+FFL+G  V +IV ++Q     + +       
Sbjct: 656 QTAFNTQIIWGLFGSHLFSTGGRYQFIMYFFLVGAGVALIVILMQWWRPRSRVWSHVSPT 715

Query: 723 VFFAGPGNIPPSTPYNYTLYFALSWALN-TIRKRFPRWFSKYNFVMGAGVETGVALAVVI 781
           +  +G  ++P ST  +Y  +F      N  I ++ P+W+ KYN ++ + ++ GVA+A +I
Sbjct: 716 LLLSGAEDMPTSTGLHYGTWFMSILVFNFFIHRKRPQWWRKYNLILASALDCGVAIAAII 775

Query: 782 IFLCVQYPGGS--LNWWGNNVYKNTYD 806
           ++  V Y GGS    WW   V  ++ D
Sbjct: 776 VYFAVTYTGGSSHYKWWATEVTSSSCD 802

>Skud_16.498 Chr16 complement(866362..868995) [2634 bp, 877 aa] {ON}
           YPR194C (REAL)
          Length = 877

 Score =  328 bits (841), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 230/723 (31%), Positives = 371/723 (51%), Gaps = 53/723 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V P DDPTI +  +R +FL  ++ I+ +G N+FFS R  ++S+   + Q+
Sbjct: 143 HSPYQEVRAVVDPDDDPTIPVETFRAYFLAVIWSIIGSGFNEFFSHRVVTISLETPIIQM 202

Query: 172 VCYPVGKILA-LLPEWDCP-RCPWFNLNPG-PFTKKEHAVVTIAVALTSSTAYAMNILIA 228
             Y  GK  A  +P +    R   + +N   P+T+KE    T+  A+   T Y    ++ 
Sbjct: 203 FLYLCGKAWAKTVPCYGITVRGTKYGININRPWTQKEQMFATLLYAICQGTFYTHYNILT 262

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q  FY+   S GY  LL  + Q + +G AG+ R++VV PA  +WP  + ++++     N+
Sbjct: 263 QKLFYHSAFSFGYQFLLSLSVQFIGFGFAGILRKFVVYPARALWPTVMPTIAI-----NK 317

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
           ++   + N   MSRY+FF   F   F++ W P ++   L+ FN + W   +  N +AN  
Sbjct: 318 ALLGKEKNESGMSRYKFFFLTFFIMFIYNWFPTYIINILNTFNWMTWIKPSNIN-LANIT 376

Query: 349 FGVESGIGALPIT-FDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            GV +G+G  PI+ FD+  IS   + S    P+W        +VL  +I++ I Y++N  
Sbjct: 377 GGV-TGLGINPISSFDWNVIS---SNSPLVYPFWSYLTQYLGSVLAALIVVAI-YYSNYM 431

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +Y+P+ + S Y NT   + V+ IL+S   ++ +KY+SYSP +     L++Y     A 
Sbjct: 432 NCQYLPMFTNSLYTNTGDSFKVTNILDSSNKLDLKKYQSYSPPYYSAGNLVTYGAFICAY 491

Query: 468 IAVFVHCFLYNGKEIKNKFRN-------------------KNYGGQDIHMRLYS---QNY 505
             +    F+ + K + + F++                    +Y   D +   +S   +NY
Sbjct: 492 PLMIAWSFIVHSKILFSAFKDWALSLWALRKLKAWVIMYKSDYKALDDYDDPHSIAMRNY 551

Query: 506 KDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHV 565
           K+ P+WWY  + +  + +G   V  + ++ P W   V+L  +FV  IP  IL+A T    
Sbjct: 552 KEVPEWWYFAILIASLIVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGFSF 611

Query: 566 GLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQI 625
           GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q 
Sbjct: 612 GLNLLIEMVMGYALPGNPVAIMILKAFGYNIDGQADSYVSNLKIAHYCKIPPMALFRGQC 671

Query: 626 YATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPG 683
              +I   VN+G+  W  SNIK  C+  Q   FTC +  T +NAS++W    PK +F+  
Sbjct: 672 VIVLIQIFVNLGVLNWQISNIKNFCTPHQDAKFTCPDAVTYYNASVVWGAIGPKRIFN-- 729

Query: 684 RIYNPIMWFFLIGLVVPIIVFVLQK--KFKGNEMLKFCHSPVFFAGPGNIPPSTPYN--- 738
            IY    W +LIG  + ++  V ++  +F           P+ F G G +  S PYN   
Sbjct: 730 HIYPIFKWCWLIGACIGVLFGVWKRWGRFYPRNF-----DPMLFVG-GMLNMSPPYNLMY 783

Query: 739 YTLYFALSWALNTIRKRFP-RWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWG 797
           YT    +S+      KR     + KYN+V+ AG  TG+ L+ +IIF  VQY   S NWWG
Sbjct: 784 YTPGMIVSYISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYRDTSFNWWG 843

Query: 798 NNV 800
           N V
Sbjct: 844 NTV 846

>ZYRO0D09922g Chr4 (837954..840722) [2769 bp, 922 aa] {ON} similar
           to uniprot|Q06593 Saccharomyces cerevisiae YPR194C OPT2
           Oligopeptide transporter member of the OPT family with
           potential orthologs in S. pombe and C. albicans
          Length = 922

 Score =  328 bits (840), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 224/728 (30%), Positives = 380/728 (52%), Gaps = 47/728 (6%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+  VRA V P DD    +  +R++FL  V+ I+ +G N+FF+ R   ++I+  + Q+
Sbjct: 184 HSPYKAVRACVSPQDDYESPVETFRSYFLALVWAIIGSGFNEFFAHRLMVITISSSMVQL 243

Query: 172 VCYPVGKILA-LLPEWDCP--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 227
           + +P+G + A ++P W  P  +    +LN P P+++KE    T+  ++  S+ Y  ++++
Sbjct: 244 LLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQPWSQKEQMFSTVLFSIAVSSFYMDSVIL 303

Query: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287
               FY  K+S GY        Q L +G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 304 TLKMFYKEKVSFGYQFFTSIAVQFLGFGFAGSLRRFVIYPSHAIWPSQLQTMALNKALFS 363

Query: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347
           +   KT+  G  ++   FF    + +F + W+P +LF+ LS FN + W      NF    
Sbjct: 364 K---KTEKGGRGLTSQTFFYICVAFTFFYEWLPTYLFQILSTFNWMTW--IKPDNFNLAM 418

Query: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406
           + G   G+G  PI +FD+  I+     S   TP +  AN  A  ++  + +L I Y++N 
Sbjct: 419 VTGSMGGVGINPIASFDWNVINYY---SALVTPLFSYANQMAGGLIAAICVLAI-YYSNQ 474

Query: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAA 466
           +  +Y+P+ S + + NT  +Y+V+ I+NS   ++  KY++YSP +     L  Y +  A+
Sbjct: 475 FDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVDVNKYQNYSPPYYSAGNLFCYGVFIAS 534

Query: 467 VIAVFVHCFLYNGKEIKNKFRN---KNYGGQDIHMRLYS-------------------QN 504
              +F + FL   K +   F++     +     H  LYS                   + 
Sbjct: 535 YPLLFAYSFLTQWKVLLRAFKDWASAIWSLTKKHTWLYSWRESSHALEEFHDPHSRMMRR 594

Query: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564
           Y + PDWWY ++ ++ I +G  A+  ++++ P W+  +A+ ++ V  IP  ILEA T   
Sbjct: 595 YNEVPDWWYYIVLILSIVIGIAALEGYHTNTPIWSLFMAVGLNAVFLIPITILEATTALQ 654

Query: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624
           +GLN++ E+I GY LP  P A +L K +G+ +  Q      +LKL  Y K+PP  +F  Q
Sbjct: 655 LGLNVLIEIIMGYALPGNPQALMLIKAFGYNIDGQADSYVGNLKLGHYSKIPPMALFRGQ 714

Query: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSP 682
           ++  +I  LV++G+  W  SNIK+ C   Q   FTC +  T +NAS++W    PK +F  
Sbjct: 715 MFMVLIQTLVSLGVLNWSISNIKDYCQPNQESKFTCPDAITYYNASVLWGAIGPKRIFE- 773

Query: 683 GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLY 742
             +Y  + W +LIG ++ I + +   K           +P+   G G +  + PYN T  
Sbjct: 774 -GVYPILKWCWLIGAIIGIGLGLW--KLLIPRFYPLWFNPLLVVG-GMLNMAPPYNLTYM 829

Query: 743 ----FALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGN 798
                A  ++   +RK   R + KYN+V+ AG +TG+ ++ +IIF  VQY    ++WWGN
Sbjct: 830 TPGAIANFFSQFYMRKYHLRIWQKYNYVLVAGFQTGLVISSIIIFFSVQYKEKPISWWGN 889

Query: 799 NVYKNTYD 806
           +V  N  D
Sbjct: 890 DVINNGLD 897

>KLLA0D15378g Chr4 complement(1303787..1306396) [2610 bp, 869 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 869

 Score =  326 bits (836), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 231/721 (32%), Positives = 374/721 (51%), Gaps = 51/721 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+PEVR    P DD TI +  +R +FL   + I+ AGVN+FF  R P +S+   V Q+
Sbjct: 135 HSPYPEVRTVTSPIDDETIPIETFRAYFLGFFWTILGAGVNEFFVHRKPKISLTAPVMQI 194

Query: 172 VCYPVGKILA-LLPEWDCPRCPW-FNLNPGPFTKKEHAVVTIAVALTSSTAY-AMNILIA 228
           + YP GK+   ++P           N NPGP++ KE    TI   + +S  Y + NI + 
Sbjct: 195 LLYPCGKLFERVMPNHTFKLGKISVNFNPGPWSFKEQMFSTIIFNVATSYTYVSHNIYVQ 254

Query: 229 QTN-FYNMK-LSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLH 286
           +   FYN K L  GY +LL+  SQ+L +G AG+ R++V+    CIWP    +++L  +L 
Sbjct: 255 RLEIFYNNKWLDFGYEVLLMLCSQLLGFGYAGILRKFVIYNEKCIWPTLFPTLALNGALL 314

Query: 287 NRSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLW-GPKTRHNFIA 345
            +   K  +NGW M+RY+FF+T F   F++ W+P +LF+GLS F+ + W  PK   NF  
Sbjct: 315 -KPDSKENINGWRMTRYKFFLTFFVIMFIYNWIPTYLFEGLSTFSWLTWCSPK---NFDL 370

Query: 346 NTIFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFT 404
             + G + G+G  P+ TFD+  I      ++   P++   N      + F  IL I Y++
Sbjct: 371 AVVTGSQYGLGLNPVPTFDWNIIDYNYALTI---PFFSQLNQYIGTFIGFFAILGI-YYS 426

Query: 405 NTWYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNF 464
           N  +  ++P+ S   + N  + Y V  IL+ +  +   KY+ YSP +     LL Y   F
Sbjct: 427 NYKWTAFLPLNSNDIFTNRGESYVVQDILDENSMLVESKYQEYSPPYYSAGNLLVYGGIF 486

Query: 465 A----AVIAVF-------VHCFLYNGKEIKNKFRN-----KNYGGQDIHMRLYSQNYKDC 508
           A    A + VF       + CF    ++IKN FRN       Y G D       + YKD 
Sbjct: 487 AQYPFAFLYVFFTEWASILQCFKQMYRQIKN-FRNVSIKSSTYDGFDDPQTRLMKKYKDV 545

Query: 509 PDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLN 568
           PDWW++V+ V+ + LG + +  + +  P W     L I+FV  IP   + ++T  ++ + 
Sbjct: 546 PDWWFLVVLVVALVLGILCIKLYPTQTPVWGLFFILGINFVFLIPICFIFSMTGFNMTMG 605

Query: 569 IITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYAT 628
           +ITE+I GY LP   +A +  K  G+ +  Q      D KLA Y K+P R +F  Q+   
Sbjct: 606 VITEIIIGYALPGNGLALMTLKSLGYTIDNQAESYIADQKLAHYAKIPQRAVFKGQLVGV 665

Query: 629 VISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGRIYN- 687
           +I   V++G+  W   N+K++C+S   + FTC      +++S+ W     +  P R++N 
Sbjct: 666 LIQCFVSLGVISWQIVNVKDICTSKAENKFTCPKEVNFYSSSVFWG----VIGPKRVFNG 721

Query: 688 --PIMWF-FLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYT---- 740
             PI+ + FLIG ++ ++   ++  F      +  H  +   G   +    PYN +    
Sbjct: 722 LYPILKYTFLIGFLLCLLCCAIKYFFP--RQTRLFHPTILIGG---MQQFAPYNLSYVTA 776

Query: 741 -LYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWGNN 799
            LYF+  +    I++ + +W+ KYN+V+ A   + VA + +IIF  V+Y    ++WWGNN
Sbjct: 777 GLYFSFGFMF-YIKRYYTKWWEKYNYVLAAAFSSAVAFSAIIIFFSVKYKPKPIDWWGNN 835

Query: 800 V 800
           +
Sbjct: 836 I 836

>ZYRO0C18568g Chr3 (1457201..1459666) [2466 bp, 821 aa] {ON} similar
           to uniprot|O59822 Schizosaccharomyces pombe SPCC1840
           SPCC965.02 protein and weakly similar to YJL212C
           uniprot|P40897 Saccharomyces cerevisiae YJL212C OPT1
           Plasma membrane transporter that transports tetra- and
           pentapeptides and glutathione member of the OPT family
          Length = 821

 Score =  324 bits (831), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 192/683 (28%), Positives = 344/683 (50%), Gaps = 18/683 (2%)

Query: 133 NHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVGKI-LALLPEWDCPRC 191
           N  R W +  +  +V   ++ FF+ R+PS++I+ +V Q++ YP G +   ++P W     
Sbjct: 129 NTLRMWLMGIILSMVIGAIDTFFAFRFPSIAISPIVGQLISYPFGILWYRIMPNWKFSIG 188

Query: 192 PW--FNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTS 249
               F LNPG F+ +E A+V +       T    N  + QT F+N+ +  G  IL     
Sbjct: 189 SRYTFELNPGKFSPQEQALVYLFCNTVYGTGVLKNTQVEQTRFFNVDVGIGRFILFNIVG 248

Query: 250 QMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTV 309
            +L +G AGL    +V     IWP  L   +L ++ H+ +  K K +     ++ FF+  
Sbjct: 249 YLLAWGMAGLAIPILVDREELIWPSVLGPSALINAFHSDT--KGKFSDLKKPKFSFFMIA 306

Query: 310 FSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPITFDYTQISQ 369
           F+ SFVWYW    +   ++         + + N +   +FGV++G+G LPI+FD+  +S 
Sbjct: 307 FAGSFVWYWFSDLILPFIANLGAFPSWIRPK-NKVLGQVFGVKNGLGLLPISFDWPTVSN 365

Query: 370 ALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNV 429
               +   TP W      AS   +  +++P LY+ + W   +MP++S   +D   + Y V
Sbjct: 366 --ISNPLTTPVWAGVMIFASFFFWAWVVIPGLYYQDHWQTAHMPLMSNKIFDKNGESYQV 423

Query: 430 SRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRNK 489
            +++N  + ++FEKYK YSP+++P  +L+  AL      +V    F     ++ + F   
Sbjct: 424 KKVVNKKWELDFEKYKKYSPVYLPIGFLIQLALGLGGFSSVMTFFFWKFKSDVWDPFMQH 483

Query: 490 NYGGQDIHMRLYSQNYKDCPDWWYVVLQVIMIALGFVAVCAFN--SHLPAWAFVVALAIS 547
           +      +   Y++ +       Y+   V+ + LGFV V A++  + + +  FVV++ I 
Sbjct: 484 STKKTAHYKPAYTKPFVAA----YIASMVLGLGLGFVFVEAWDRDTQIDSGGFVVSIIIG 539

Query: 548 FVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDL 607
            V F+P  ++E+ ++  + +N I  +I  +    +PMA L F  +GF + + G+  ++  
Sbjct: 540 IVLFLPVALVESRSSFLLNMNGILNVIGAFWYKGKPMATLYFLNFGFSLFQHGMHFTQGA 599

Query: 608 KLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIF 667
           KL  YMK PPRL   V + + + + L+   +  ++  ++  +C+    +  TC + +T F
Sbjct: 600 KLGYYMKTPPRLTILVLLVSGIWTSLIIPSVTGYVLYHVGNVCTPNAHNNMTCKSQQTAF 659

Query: 668 NASIIWSM-PKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFA 726
           N  I+W +   +LFS G  Y  IM+FFL+G  V +IV ++Q +   +         +  +
Sbjct: 660 NTQIVWGLFGSHLFSNGGRYQFIMYFFLVGAGVSLIVILMQWRRPNSRFWSKVSPTLLLS 719

Query: 727 GPGNIPPSTPYNYTLYFALSWALNT-IRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLC 785
           G  ++P ST  +Y  +F L    N  I K+ P W+ KYN ++   ++ GVA+A +I++  
Sbjct: 720 GAEDMPTSTGLHYGTWFFLVLVFNGFIHKKRPHWWRKYNLILATALDCGVAIAAIIVYFA 779

Query: 786 VQYPGGS--LNWWGNNVYKNTYD 806
           V Y GGS    WW   V  ++ D
Sbjct: 780 VSYTGGSSHYKWWATEVTSSSCD 802

>Suva_16.526 Chr16 complement(906594..909227) [2634 bp, 877 aa] {ON}
            YPR194C (REAL)
          Length = 877

 Score =  325 bits (832), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 228/724 (31%), Positives = 370/724 (51%), Gaps = 55/724 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V P+DDPT+ +  +R +FL  V+ IV +G N+FFS R  ++++   V Q+
Sbjct: 143 HSPYQEVRAVVDPSDDPTVPVETFRAYFLAIVWSIVGSGFNEFFSHRVVTITLGTPVIQM 202

Query: 172 VCYPVGKILA-LLPEWD-CPRCPWFNLNPG-PFTKKEHAVVTIAVALTSSTAYAMNILIA 228
             Y  GK  A  +P W    +   + +N   P+T+KE    T+   +     Y    ++ 
Sbjct: 203 FLYICGKAWAKTVPCWGFTVKGTKYGININTPWTQKEQMFATLLYGICQGAFYTHYNILT 262

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q  FY+   S GY  LL    Q + +G AG+ RR+VV P+  +WP  + ++++  +L   
Sbjct: 263 QKIFYHSSFSFGYQFLLSLAVQFIGFGFAGILRRFVVYPSRALWPTVMPTIAINKAL--- 319

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
            + K K     MSRY FF   F   F++ W P ++   L+ FN + W   +  N +AN I
Sbjct: 320 -LGKEKYES-GMSRYNFFFLTFFIMFIYNWFPTYILNILNTFNWMTWIKPSNIN-LAN-I 375

Query: 349 FGVESGIGALPIT-FDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            G  +GIG  PI+ FD+  +S     S    P+W        ++L  +I++ + Y++N  
Sbjct: 376 TGSVTGIGINPISSFDWNVLS---FNSPLVFPFWSYLTQYLGSILAALIVVAV-YYSNYM 431

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +++P+ + S Y NT + + V++IL+S+  ++ +KY+SYSP F     L+SY     A 
Sbjct: 432 NCQFLPMFTNSLYTNTGESFKVTKILDSENKLDLKKYQSYSPPFYTAGNLVSYGSFICAY 491

Query: 468 IAVFVHCFLYNGKEIKNKFRN-------------------KNYGGQDIHMRLYS---QNY 505
             +    F+ + K + N F++                     Y   D     +S   ++Y
Sbjct: 492 PLMITWSFIVHSKLLLNAFKDWALNLWSLRKPKSWTAMFKSEYAALDEFDDPHSNAMKSY 551

Query: 506 KDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQHV 565
           K+ PDWWY  + +  + +G   V  + ++ P W   V+L  +FV  IP  IL+A T    
Sbjct: 552 KEVPDWWYFAILLASLVVGIAVVEHYPTNTPVWGLFVSLGFNFVFLIPTTILQATTGFSF 611

Query: 566 GLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQI 625
           GLN++ E++ GY LP  P+A ++ K +G+ +  Q      +LK+A Y K+PP  +F  Q 
Sbjct: 612 GLNLLIEMVMGYALPGNPVAIMILKAFGYNIDGQADNYVSNLKIAHYCKIPPMAVFRGQC 671

Query: 626 YATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSPG 683
              +I   VN+G+  W  SNIK+ C+  Q   FTC +  T +NAS++W    PK +F+  
Sbjct: 672 VIVLIQIFVNLGVLNWQISNIKDFCTPHQNAKFTCPDAVTYYNASVVWGAIGPKRIFN-- 729

Query: 684 RIYNPIMWFFLIGLVVPIIVFVLQK--KFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTL 741
            IY    W +LIG  + I+  V ++  +F   +       P+ F G G I    PYN  +
Sbjct: 730 HIYPIFKWCWLIGACIGIVFGVWKRWGRFYPRDF-----DPMLFVG-GMINMGPPYN-LM 782

Query: 742 YFALSWALNTIRKRFPR-----WFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWW 796
           YF     ++ I + + +      + KYN+V+ AG  TG+ L+ +IIF  VQY   + NWW
Sbjct: 783 YFTPGMIVSFISQYYMKRHHLNLWEKYNYVLSAGFSTGLVLSAIIIFFAVQYKDTAFNWW 842

Query: 797 GNNV 800
           GN V
Sbjct: 843 GNTV 846

>Kpol_455.13 s455 (24582..27260) [2679 bp, 892 aa] {ON}
           (24582..27260) [2679 nt, 893 aa]
          Length = 892

 Score =  321 bits (823), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 228/724 (31%), Positives = 374/724 (51%), Gaps = 54/724 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVRA V PTDDPTI +  +R++     + IV +G N+FFS R  ++SIN  V Q+
Sbjct: 157 HSPYKEVRAVVDPTDDPTIPVETFRSYLFALFWAIVGSGFNEFFSHRQVTISINTSVVQM 216

Query: 172 VCYPVGKILA-LLPEWDCP---RCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILI 227
             YP G + A  +P W      R    N++  P+++KE    T+  ++ S T Y    ++
Sbjct: 217 FLYPSGLLWAKYVPCWGISIKGRKYAINIDK-PWSQKEQMFSTLLFSICSGTFYTHYNIL 275

Query: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287
            Q  +Y+  +S GY  LL  + Q L +G AG+ R++VV P   +WP +  +++L  +L +
Sbjct: 276 TQKVYYHDNVSFGYQFLLSLSIQFLGFGFAGILRKFVVYPTKALWPTSFPTIALNKALLS 335

Query: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347
           R  + T  NG  M+RY+FF   F A F++ W P ++    + FN + W   + +NF    
Sbjct: 336 RKEENT--NG--MTRYKFFFLTFFAMFIYNWFPTYIINIFNTFNWMTW--ISPNNFNLAM 389

Query: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406
           I G  SGIG  PI +FD+   S     +    P++ +      AV F  +++  +Y+TN 
Sbjct: 390 ITGGVSGIGFNPIASFDWNVASYI---NPLRIPFFSNMTQYCGAV-FAALVVIAVYWTNY 445

Query: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAA 466
              +Y+P+ S + Y N   +Y V+ +L+SD+ ++  KY+ YS  +     L++Y    A 
Sbjct: 446 MDCQYLPLFSNTLYTNRATRYQVTEVLDSDWKLDNAKYQEYSAPYYSAGNLVAYGSFIAT 505

Query: 467 VIAVFVHCFLYNGK--------------EIKNKFRNKNYGGQ---------DIHMRLYSQ 503
              + V+  L   K               +  K    N   Q         D H R+  +
Sbjct: 506 YPMLIVYSMLTETKLLWSAMKQWTLSLWSLTKKHTWTNLLTQESCALDEFDDPHSRM-MK 564

Query: 504 NYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQ 563
           NYK+ PDWWY V+ +  I +G   + A++++ P W+  V++  +    IP  +L+A    
Sbjct: 565 NYKEVPDWWYFVVLLAAIGVGIAVIEAYHTNTPVWSLFVSIGFNVAFLIPLTMLQATAGF 624

Query: 564 HVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAV 623
            +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +F  
Sbjct: 625 SLGLNLLIEMIVGYALPGNPFALMIIKAFGYNIDGQADNYVSNLKMAHYTKIPPIALFRG 684

Query: 624 QIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFS 681
           Q+    +   VN+G+  W  SNIK  C+  Q   FTC +  T +NAS++W    PK +F+
Sbjct: 685 QMIMVFLQIFVNLGVLNWQISNIKGFCTHDQKAKFTCPDATTYYNASVVWGALGPKKIFN 744

Query: 682 PGRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTL 741
              +Y  + W +LIG  + +  F + K+F   +      +P+ F G G I  + PY   +
Sbjct: 745 --DVYPILRWCWLIGACIGLF-FGVWKRF--GKFYPTWFNPILFVG-GMINMAPPYG-LM 797

Query: 742 YFALSWALNTI-----RKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWW 796
           YF     ++ +     +K   R + KYN+++ AG  +G+ L+ +IIF  VQY G + +WW
Sbjct: 798 YFTPGIIVSYLSQYHFKKYHLRLWEKYNYILDAGFTSGLVLSAIIIFFAVQYEGTNFSWW 857

Query: 797 GNNV 800
           GNNV
Sbjct: 858 GNNV 861

>Ecym_2739 Chr2 complement(1430077..1432680) [2604 bp, 867 aa] {ON}
           similar to Ashbya gossypii ADL399C /ACL205C /AGL027W
          Length = 867

 Score =  318 bits (815), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 232/750 (30%), Positives = 380/750 (50%), Gaps = 57/750 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+ EVR+ V PTDDP+I +  +R +F+ T + +V +G N+FF  R   +SI     Q+
Sbjct: 133 HSPYTEVRSMVSPTDDPSIPIETFRAYFIATFWSVVGSGFNEFFRHRQVPISIETAAVQL 192

Query: 172 VCYPVGKILA-LLPEWD-CPRCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILIA 228
           +  P+GK+ A  +P W    R   F +N P P+++KE    T+  ++T  + Y+   ++ 
Sbjct: 193 LICPIGKLWANKVPLWGFTVRGRRFAINVPEPWSEKEQMFATLLYSITLGSFYSSFNILT 252

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
              +YN  +S  + +LL  + Q + +G AG+ RR+VV PA  +WP  L S+++  +L +R
Sbjct: 253 MKKYYNDDVSYLFQLLLSISLQFMGFGFAGVLRRFVVYPAKAVWPSCLPSIAVNKALLSR 312

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
              K K  G S+    FF       F + W+P  L   L+ FN + W      N  A T 
Sbjct: 313 ---KDKSGGLSIQ--NFFYISLGVLFAYNWIPTVLAGFLANFNWMTWLAPNNFNLAAIT- 366

Query: 349 FGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            G  +G+   P+ +FD   I+     +   TP++  ++    AV+  ++++  LY++N  
Sbjct: 367 -GGSTGLAYNPLPSFDLNAIAYF---TPLVTPFFAYSHIYIGAVIASLVVIA-LYYSNYM 421

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
            ++Y+PV S S Y N   KYN+S IL  DY ++  KY++YSP +     L+SY       
Sbjct: 422 ESQYLPVFSQSLYTNKATKYNISEIL-VDYKVDEAKYQTYSPPYYSAGVLVSYGSFLCFY 480

Query: 468 IAVFVHCFLYNGKEIKNKFRN-------------------KNY----GGQDIHMRLYSQN 504
             VF    +   + +   FR+                    +Y       D H RL  +N
Sbjct: 481 TMVFGFAIIDEFRVLYEAFRDWFFALLSLRHKKSWIDMWASDYHVLSEFDDAHSRL-MRN 539

Query: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564
           YK+ PDWW+ V+ V+ IA   + +  FNS  P W   +++ ++F+  IP   L A T   
Sbjct: 540 YKEVPDWWFFVVLVVAIAFAIIVIECFNSQTPLWLLFLSIGLNFIFLIPLTTLHARTTFT 599

Query: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624
            GLN++ E+I GY+LP  P A +L K +G+ +  Q      ++K+A Y K+ P  +F  Q
Sbjct: 600 AGLNLLVEMIVGYILPGNPYALMLIKAFGYNIDGQADNYISNMKVAHYCKISPVALFRGQ 659

Query: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSP 682
           +    I   VN+ +  W  SNI   C   QP  F+C + RT +NAS++W    P+ +F+ 
Sbjct: 660 LVMVFIQIFVNLFVVNWQFSNISGFCDEHQPAKFSCPDIRTYYNASVMWGAMGPQKIFT- 718

Query: 683 GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNYTLY 742
            ++Y  + W + IG V+ +    L KK+   +      +P+     G +  S PYN  +Y
Sbjct: 719 -KVYPQLKWCWAIGAVIGVGC-ALWKKY--GKFYPRSFNPILII-IGMLSFSPPYN-MVY 772

Query: 743 FALSWALNTIR----KRFP-RWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNWWG 797
           F   + +N I     KR+  R + KYN+V+   ++ G+  + ++IF  +QY    LNWWG
Sbjct: 773 FTPGFIVNFISQFYMKRYRLRIWEKYNYVLEGALKCGLVFSSLVIFAAIQYNDYQLNWWG 832

Query: 798 NNVYKNT-YDHNYRKFYNLKKGEK--FGYD 824
           N+V + + Y+  Y    N+   EK  FG D
Sbjct: 833 NSVPETSVYERTYISKLNVSLTEKGYFGPD 862

>ZYRO0D13332g Chr4 complement(1121064..1123733) [2670 bp, 889 aa]
           {ON} similar to uniprot|Q06593 Saccharomyces cerevisiae
           YPR194C OPT2 Oligopeptide transporter member of the OPT
           family with potential orthologs in S. pombe and C.
           albicans
          Length = 889

 Score =  317 bits (811), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 212/731 (29%), Positives = 365/731 (49%), Gaps = 53/731 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+  VRA V P DDP   +  +R++ L  ++ I+ +G N+FF+ R  +++IN  + Q+
Sbjct: 151 HSPYRSVRACVDPRDDPDAPIETFRSYTLALIWAIIGSGFNEFFAHRLLTITINSAMVQM 210

Query: 172 VCYPVGKILA-LLPEWDCP--RCPWFNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 227
           + +P+G + A  +P W  P  +    ++N P P+ +KE    TI  A+ S+T Y    ++
Sbjct: 211 LLFPMGNLWAKFMPYWSFPIWKGKRIHINYPQPWNQKEQMFSTILFAICSTTFYTHYNIL 270

Query: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287
            Q  +Y+  +S GY   L    Q L  G AG  RR+V+ P+  IWP  L +++L  +L +
Sbjct: 271 TQKMYYHEAVSFGYQFFLSIGVQYLGLGFAGSLRRFVIYPSKAIWPSQLQTMALNKALFS 330

Query: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347
           R  +K   N   ++R  FF       F + W+P +LF+ LS FN + W      NF    
Sbjct: 331 RREEK---NSKGLTRQTFFFICTGFIFFYQWIPTYLFQALSTFNWMTW--IKPDNFDLAM 385

Query: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406
           + G   G+G  PI +FD+  I+         TP +        A++  + +L  +Y++N 
Sbjct: 386 VTGSVGGVGFNPIASFDWNVINNYF---CLVTPLFSYMCQMIGALIAAICVLA-MYYSNQ 441

Query: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAA 466
           +  +++P+ S + + NT   + ++ ILN  Y ++ +KY++YSP +     +  Y    A+
Sbjct: 442 YDCQFLPMFSNALFTNTGDSFEINAILNKKYEVDVKKYQNYSPPYYSAGNIFCYGAFIAS 501

Query: 467 VIAVFVHCFLYNGKEIKNKFRN------------------KNYGG-----QDIHMRLYSQ 503
              +F + F+   K +   F+                   K+         D H R+  +
Sbjct: 502 YPLLFAYYFISEWKIMYGAFKEWALAIWALTKKHTWLQAWKDDAHALEEFHDPHSRM-MR 560

Query: 504 NYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQ 563
            YK+ PDWWY ++ +  + +G   +  ++++ P W+  +++ ++    IP  ILEA +  
Sbjct: 561 RYKEVPDWWYYMVLICAVGVGIGTIEGYHTNTPVWSLFMSIGLNAAFLIPITILEATSAL 620

Query: 564 HVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAV 623
            +GLN++ E+I GY LP  P A ++ K +G+ +  Q      +LKL  Y K+PP+ +F  
Sbjct: 621 QMGLNVLIEVIMGYALPGNPHALMIIKAFGYNIDGQADSFVGNLKLGHYAKIPPKALFRG 680

Query: 624 QIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPG 683
           Q+   ++   V +G+  W  SNIK+ C   Q   FTC +  T +N+S++W        P 
Sbjct: 681 QMLMILVQTFVCLGVLNWSMSNIKDYCKPHQASKFTCPDAVTYYNSSVLWGA----IGPK 736

Query: 684 RIYN---PIM-WFFLIGLVVPIIVFVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYNY 739
           RI+    PIM W +LIG ++  + F L K         + +  +   G  N+ P  PYN 
Sbjct: 737 RIFEGVYPIMKWCWLIGALIG-VGFGLYKLLLPRFYPTWFNPVIVIGGMLNMAP--PYNL 793

Query: 740 TLY----FALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNW 795
           T       A  ++   +R+   R + KYN+V+ AG   G+ ++ +IIF  VQY    +NW
Sbjct: 794 TYMTPGAIANFFSQFYMRRYRVRLWEKYNYVLSAGFSAGLVVSSIIIFFSVQYKNKPINW 853

Query: 796 WGNNVYKNTYD 806
           WGN+V     D
Sbjct: 854 WGNDVINAGLD 864

>ADL399C Chr4 complement(3872..6529) [2658 bp, 885 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 885

 Score =  298 bits (764), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 215/745 (28%), Positives = 371/745 (49%), Gaps = 56/745 (7%)

Query: 113 SPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVV 172
           SP+ EVRA   P DDPTI +  +R +FL T++V++ +G N FF+ R P++S+     Q++
Sbjct: 148 SPYVEVRAVASPVDDPTIPVETFRAYFLATLWVVIGSGFNMFFAQRQPAISLGVFAVQML 207

Query: 173 CYPVGKI-LALLPEWDCP---RCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIA 228
            YP   + + ++P W      R    N+    +++KE   VT+  ++T+   Y+   ++ 
Sbjct: 208 VYPCAVLWVRVMPCWGFKVFGRRIALNIE-SQWSEKEQMFVTLLYSITNGAFYSEYNIVT 266

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q   Y   +S  Y  LL ++ Q L +G AG+ RR+VV P+  +WP ++ +++L  +L   
Sbjct: 267 QQIHYKSPMSYAYQFLLSFSLQFLGFGLAGIMRRYVVYPSIALWPSSMTTIALNKAL--- 323

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
            +     NG  + R + F    +A FV+ W P +LF+ LS FN + W      NF   T+
Sbjct: 324 -LSSDHSNG--IGRKKMFYITATAIFVYNWFPTYLFEALSTFNWMTW--IKPDNFSLATV 378

Query: 349 FGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            G  +G+G  PI TFD+T I    T S++  P+ V+  +    +L  ++ L + Y+ N  
Sbjct: 379 TGGINGVGLNPISTFDWTNIG---TSSLY-LPFRVTLTTYLGGLLAALVTLGV-YYMNYR 433

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +++P+ + S Y+N    Y V  IL  D  ++ +K++ Y   +     +++Y       
Sbjct: 434 ECQFLPIFTQSLYNNRATSYRVEEILTEDRKLDEQKFQKYGFPYYTAGNIVAYGCFMCVY 493

Query: 468 IAVFVHCFLYNG--------------------KEIKNKFRNKNY---GGQDIHMRLYSQN 504
            A+ V   L  G                       +  F N  +      D H R+  + 
Sbjct: 494 TALVVTSILQQGAFYGRVYKTWILDLWSLRKPSSWRAVFSNDKHVLDDFHDSHSRM-MRK 552

Query: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564
           YK+ P+WWY+ + ++ I +G + V  F ++ P W   +A+A++FV  +P  +L+A     
Sbjct: 553 YKEVPEWWYMTIFIVSIVIGIIVVKVFKTNTPVWGLFLAVALNFVLLLPITLLQATRGVT 612

Query: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624
           +GLN++ ++I G  LP  P A +  K +G+ +  Q      ++KLA Y K+PP  +F  Q
Sbjct: 613 IGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQADNYLGNMKLAHYAKIPPVPLFRGQ 672

Query: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFSP 682
           +   +I   VN+G+  W   NI+  C   Q   FTC   RT FNAS++W    PK +F  
Sbjct: 673 LLMVLIQIFVNLGVINWQLHNIENYCDPKQRFKFTCPGIRTYFNASVMWGAIGPKRIFE- 731

Query: 683 GRIYNPIMWFFLIGLVVPIIVFVLQKKFKGNEMLKFCH--SPVFFAGPGNIPPSTPYN-- 738
             +Y  + W +LIG  V +   + +K     + + +    SPV F   G +    PYN  
Sbjct: 732 -HVYPIMKWCWLIGACVGLFFGLWKKLSIMYKKIPYPDRFSPVIFI-IGMLSFGPPYNLQ 789

Query: 739 YT---LYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLNW 795
           YT   LY     ++  +++   R + +YN+V+ AG+  G+  + +++F  VQ+ G  ++W
Sbjct: 790 YTTSGLYVGFI-SMCYMKRYHLRVWERYNYVVAAGISCGLVFSAIVMFFTVQWKGVEISW 848

Query: 796 WGNNVYKNTYDHNYRKFYNLKKGEK 820
           WGN V     D+      N+ + E+
Sbjct: 849 WGNTVSYAGLDYARVPLLNVTETER 873

>ACL205C Chr3 complement(1169..3841) [2673 bp, 890 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR194C
           (OPT2)
          Length = 890

 Score =  293 bits (751), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 212/754 (28%), Positives = 367/754 (48%), Gaps = 64/754 (8%)

Query: 113 SPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVV 172
           SP+ EVRA   P DDPTI +  +R +FL T +V+V + +  FFS R PS++++    Q++
Sbjct: 141 SPYVEVRAVASPVDDPTIPVETFRAYFLATFWVVVGSALTMFFSERQPSIALSISAVQML 200

Query: 173 CYPVGKILA-LLPEWDC---PRCPWFNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIA 228
            YP G + A L+P W      R    N++  P+T+KE   VT+   +T+ + YA   ++ 
Sbjct: 201 VYPCGLLWARLMPCWGFNVYGRRIALNID-SPWTEKEQMFVTLLYGITTGSFYANYNILT 259

Query: 229 QTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNR 288
           Q   Y   +   Y +LL    Q L +G AG+ R++VV PA  +WP  + +++L     N+
Sbjct: 260 QHIHYRSPMPYAYQLLLSIPLQFLGFGLAGIMRKYVVYPATAMWPSIMTTIAL-----NK 314

Query: 289 SIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTI 348
           ++   + +G    R + F   F+  FV+ W P +LF+ LS FN + W      NF   T+
Sbjct: 315 AMMSDEHSG-GFGRKKMFYLTFAIIFVYNWFPTYLFEALSTFNWITW--IKPDNFNLATV 371

Query: 349 FGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNTW 407
            G  +G+G  P+ T D+T I        F  P+ V+       +L  +I L + Y+ N  
Sbjct: 372 TGGINGVGLNPLSTLDWTNIGVG----GFYLPFRVTLTMYMGGLLAALITLGV-YYMNYS 426

Query: 408 YAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFAAV 467
             +++P+ + S Y+N  + Y V  IL  D  ++ +K++ Y   +     +++Y       
Sbjct: 427 ECQFLPIFTQSLYNNKAKVYQVEEILTEDRLLDEQKFQKYGFPYYTAGNMVAYGCFMCVY 486

Query: 468 IAVFVHCFLYNG--------------------KEIKNKFRNKNY---GGQDIHMRLYSQN 504
            A+ V   L  G                      ++  F N+ +      D H R+  + 
Sbjct: 487 TALVVSSILQQGAFYMRVYKAWILDLWSLRTRSGLREAFSNEKHVLDEFHDPHCRM-MRK 545

Query: 505 YKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQH 564
           YK+ P+WWY+ + V+ I +G + V  F ++ P W   +A+ ++F+  +P  +L+A     
Sbjct: 546 YKEVPEWWYMSIFVVSIVIGVIVVTTFKTNTPVWGLFLAVGLNFILLLPITLLQATRGVT 605

Query: 565 VGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQ 624
           +GLN++ ++I G  LP  P A +  K +G+ +  Q      ++K+A Y K+PP  +F  Q
Sbjct: 606 IGLNLLLQMISGLALPGNPYALMFIKAFGYNIDGQTDNYLSNMKMAHYAKIPPIPLFRGQ 665

Query: 625 IYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSMPKYLFSPGR 684
           +   +I   VN+G+  W   N++  C   Q   FTC   RT FNAS++W        P R
Sbjct: 666 LLMVLIQVFVNLGVINWQLHNVENYCDPKQRFKFTCPGVRTYFNASVMWGA----IGPRR 721

Query: 685 IYN---PIM-WFFLIGLVVPIIVFVLQKKFKGNEMLKFCH--SPVF-------FAGPGNI 731
           I+    PIM W +LIG  V +   + ++     + + +    SPV        F  P N+
Sbjct: 722 IFEHVYPIMKWCWLIGACVGLFFGIWKRLSIMYDKIPYPRRFSPVIFIIGMLSFGPPYNL 781

Query: 732 PPSTPYNYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGG 791
             ST   Y  + ++ +    +++   R + +YN+V+ A +  GV  + +++F  VQ+   
Sbjct: 782 QYSTSGLYVGFISMFY----LKRYHLRIWERYNYVIAAAITCGVVFSAILMFFSVQWKDI 837

Query: 792 SLNWWGNNVYKNTYDHNYRKFYNLKKGEKFGYDK 825
            LNWWGN++     D+      N+ +  +   D+
Sbjct: 838 ELNWWGNSISYAGLDYARVPLLNVTETREDTLDQ 871

>Smik_16.458 Chr16
           complement(787205..789133,789181..789306,789322..789348,
           789352..789837) [2568 bp, 855 aa] {ON} YPR194C (REAL)
          Length = 855

 Score =  287 bits (734), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 201/634 (31%), Positives = 321/634 (50%), Gaps = 46/634 (7%)

Query: 196 LNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLVWTSQMLVYG 255
           L P   T+K+    T+  A+     Y    ++ Q  FY+   S GY  LL  + Q + +G
Sbjct: 208 LCPTGLTQKKQMFSTLLYAICQGAFYTHYNILTQKLFYHSAFSFGYQFLLSLSVQFIGFG 267

Query: 256 AAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKVNGWSMSRYRFFVTVFSASFV 315
            AG+ R++VV PA  +WP  + ++++     N+++   + +   MSRY+FF   F   FV
Sbjct: 268 FAGILRKFVVYPARALWPTVMPTIAI-----NKALLGKEEHESGMSRYKFFFLTFFVMFV 322

Query: 316 WYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGIGALPIT-FDYTQISQALTGS 374
           + W P F+   L+ FN + W   T  N +AN   GV +G+G  PI+ FD+  IS     S
Sbjct: 323 YNWFPTFIINILNTFNWMTWIKPTSIN-LANITGGV-TGLGINPISSFDWNVIS---FNS 377

Query: 375 VFATPYWVSANSCASAVLFFVIILPILYFTNTWYAKYMPVISGSTYDNTQQKYNVSRILN 434
               P+W         +L  +I++ + Y++N    +Y+P+ + S Y NT   + V++IL+
Sbjct: 378 PLVYPFWSYLTQYLGCILAALIVIAV-YYSNYMICQYLPIFTNSLYTNTGNSFKVTKILD 436

Query: 435 SDYSINFEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCFLYNGKEIKNKFRN------ 488
           SD  ++ +KY+SYSP +     L++Y     A   +    F+ + K + N F++      
Sbjct: 437 SDNKLDVKKYQSYSPPYYTAGNLVTYGAFICAYPLMITWSFIVHSKLLFNAFKDWTLNLW 496

Query: 489 -------------KNYGGQDIHMRLYS---QNYKDCPDWWYVVLQVIMIALGFVAVCAFN 532
                         NY   D +   +S   +NY++ PDWWY  + +  + +G   V  + 
Sbjct: 497 ALRKLTTWAIMFKNNYRLLDDYDDPHSNAMKNYREVPDWWYFAILIASLIVGIAVVEHYP 556

Query: 533 SHLPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELICGYMLPFRPMANLLFKLY 592
           ++ P W   V+L  +FV  IP  IL+A T    GLN++ E++ GY LP  P+A ++ K +
Sbjct: 557 TNTPVWGLFVSLGFNFVFLIPTTILQATTGYSFGLNLLIEMVMGYALPGNPVAIMILKAF 616

Query: 593 GFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYATVISGLVNVGIQEWMRSNIKELCSS 652
           G+ +  Q      +LK+A Y K+PP  +F  Q    +I   VN+G+  W  SNIK+ C+ 
Sbjct: 617 GYNIDGQADNYVSNLKIAHYCKIPPMALFRGQCIIVLIQIFVNLGVLNWQISNIKDFCTP 676

Query: 653 TQPDGFTCNNGRTIFNASIIWSM--PKYLFSPGRIYNPIMWFFLIGLVVPIIVFVLQKKF 710
            Q   FTC +  T +NAS++W    PK +F+   IY  I W +LIG  + I+  V ++  
Sbjct: 677 HQNAKFTCPDAVTYYNASVVWGAIGPKRIFN--YIYPIIKWCWLIGACIGILFGVWKR-- 732

Query: 711 KGNEMLKFCHSPVFFAGPGNIPPSTPYN---YTLYFALSWALNTIRKRFP-RWFSKYNFV 766
            G    K+    +F  G  N+ P  PYN   YT    +S+      KR     + KYN+V
Sbjct: 733 WGKFYPKYFDPMLFVGGMLNMSP--PYNLMYYTSGMIVSYISQYYMKRHHLNLWEKYNYV 790

Query: 767 MGAGVETGVALAVVIIFLCVQYPGGSLNWWGNNV 800
           + AG  TG+ L+ +IIF  VQY   + NWWGN V
Sbjct: 791 LSAGFSTGLVLSAIIIFFAVQYKDTAFNWWGNTV 824

>AGL027W Chr7 (657958..660591) [2634 bp, 877 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPR194C (OPT2)
          Length = 877

 Score =  277 bits (709), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 207/746 (27%), Positives = 361/746 (48%), Gaps = 57/746 (7%)

Query: 112 NSPFPEVRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQV 171
           +SP+PEVRA V P DDPTI +  +R +FLTT   I+  G+  FF  RYP +  + + AQ 
Sbjct: 141 HSPYPEVRAVVGPGDDPTIPVETFRCYFLTTTITIIGCGLTTFFQSRYPLIEFSSMAAQF 200

Query: 172 VCYPVGKILA-LLPEWDCPRCPW--FNLN-PGPFTKKEHAVVTIAVALTSSTAYAMNILI 227
           + + +G + +  +P    P  P   F LN    ++KKE    T+  ++T+   Y+   ++
Sbjct: 201 LFFILGTLWSKFMPAVRIPIFPGYGFQLNLQTSWSKKEQMFATLLYSITTGVFYSYFNIL 260

Query: 228 AQTNFYNMKLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHN 287
            Q  FYN   S G+ I+L  + Q + +G AGL R +VV PA  +WP ++ +++L ++L  
Sbjct: 261 TQDMFYNDPTSLGFQIILSLSLQFMGFGLAGLLRPFVVFPARALWPLSMPTIALNNALLA 320

Query: 288 RSIDKTKVNGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANT 347
           + + K    G S+ +  F+  +    F++ W P      LS  N + W      N  A  
Sbjct: 321 QDVGK----GTSIRKVFFYFGI--GMFIYNWFPTVFADVLSNLNWLTWIKPNNFNLAA-- 372

Query: 348 IFGVESGIGALPI-TFDYTQISQALTGSVFATPYWVSANSCASAVLFFVIILPILYFTNT 406
           I G   GI   P+ T D+  I    T    A P++        ++L  VII+ + Y+TN 
Sbjct: 373 ITGGRYGIATNPLPTLDWNYI----THWALALPFYTVFLQYLGSLLSVVIIIAV-YYTNY 427

Query: 407 WYAKYMPVISGSTYDNTQQKYNVSRILNSDYSINFEKYKSYS------------------ 448
              +Y+P+     Y N  + ++ S++L +D+ ++++KY+ YS                  
Sbjct: 428 MECQYLPIFGQPLYSNEGKFFDASKVL-TDFKLDWQKYQQYSLPYYSAGNIVGYGSFISL 486

Query: 449 -PLFVPFSYLLSYALNFAAVIAVFVHCFLYNGKEI-KNKFRNKN---YGGQDIHMRLYSQ 503
             L   +S +  Y +   A   + V  +     +  +N  +N +    G  D H R   +
Sbjct: 487 YTLLAAYSIITEYEILGGACKRLGVGLWSLTKLDTWRNLHKNDSSILEGYDDAHCR-EMR 545

Query: 504 NYKDCPDWWYVVLQVIMIALGFVAVCAFNSHLPAWAFVVALAISFVNFIPQGILEAVTNQ 563
            Y + P+WW+  + +I + L  + V  + ++ P W   +A+ ++    +P   L++ T  
Sbjct: 546 KYPEVPEWWFFAIFLISLVLAIILVTTYKTNTPVWGIFLAVGLNVAFLLPLTTLQSTTGA 605

Query: 564 HVGLNIITELICGYMLPFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAV 623
            +GLN++ ++I GY+LP  P A ++ K +G+ +  Q      +LK+A Y K+PP  +F  
Sbjct: 606 SLGLNLLVQMITGYLLPGNPYALMIIKAFGYNIDGQADNYLSNLKMAHYCKIPPVPLFRG 665

Query: 624 QIYATVISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTIFNASIIWSM--PKYLFS 681
           Q+   ++  +V++ +  W   N+ + C+     GF C   RT +NASI+W +  PK +FS
Sbjct: 666 QLSMVLLQVIVSLAVINWQIHNVPDFCNPKNRSGFICQGPRTYYNASIVWGIIGPKKVFS 725

Query: 682 PGRIYNPIMWFFLIGLVVPIIV---FVLQKKFKGNEMLKFCHSPVFFAGPGNIPPSTPYN 738
              +Y  + W +LIG ++ ++      L +K+K      F  +PV F   G I    PYN
Sbjct: 726 --YLYPMMKWCWLIGALLGVLFGGWCRLSRKYKLYYPRSF--NPVVFVT-GMISLMPPYN 780

Query: 739 YTLYFALSWALNT----IRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCVQYPGGSLN 794
             +Y +  +        +R+   R + KYN+V+ A    GV  + + IF  +QYP   L+
Sbjct: 781 LRVYTSKLYVAFIGQYWLRRYHLRIWEKYNYVVAAAFNCGVIFSAITIFFAIQYPEIRLD 840

Query: 795 WWGNNVYKNTYDHNYRKFYNLKKGEK 820
           W  N +     D       ++K  E+
Sbjct: 841 WILNTINDVGIDATPTPLKDVKLTER 866

>ZYRO0D17974g Chr4 complement(1492455..1494785) [2331 bp, 776 aa]
           {ON} weakly similar to uniprot|Q06593 Saccharomyces
           cerevisiae YPR194C OPT2 Oligopeptide transporter member
           of the OPT family
          Length = 776

 Score =  174 bits (441), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 183/724 (25%), Positives = 333/724 (45%), Gaps = 63/724 (8%)

Query: 118 VRATVPPTDDPTIVLNHWRTWFLTTVFVIVFAGVNQFFSLRYPSLSINFLVAQVVCYPVG 177
           V+  V   DDP      +R   L+ +F++  A ++   S R  S + +    Q+  Y VG
Sbjct: 61  VKGVVTLEDDPQEPCFTFRMVILSIIFILPGAFLDTMNSYRTTSAAYSIFFVQICSYWVG 120

Query: 178 KILA-LLPEWDCPRCPW-FNLNPGPFTKKEHAVVTIAVALTSSTAYAMNILIAQTNFYNM 235
           K LA +LP        + F+LNPGP++ KE+ ++T+A A  ++       +     +Y  
Sbjct: 121 KWLAKILPSKQIGIGKYKFSLNPGPWSIKENVLITLAAASGATGNQGTTPVSLAEVYYKT 180

Query: 236 KLSAGYMILLVWTSQMLVYGAAGLTRRWVVSPAACIWPQTLISVSLFDSLHNRSIDKTKV 295
           K++    I  +W      Y  + + R +++     +WP+ L+  +LF+S+  +  D    
Sbjct: 181 KVNPAVAIFFMWCINFSGYAMSYIARNFLIYDPQFVWPRALMQTNLFNSM--KKADLPNH 238

Query: 296 NGWSMSRYRFFVTVFSASFVWYWVPGFLFKGLSYFNVVLWGPKTRHNFIANTIFGVESGI 355
              S  + + F  +     VW + P ++F  LS  + + W     +N+ AN I G   G+
Sbjct: 239 QRQSSRKMKVFFMLIIGMTVWEFFPEYVFPMLSSLSFLCW--VAPNNYTANFIGGGMGGM 296

Query: 356 GALPITFDYTQISQALTGSVFATPYWVSANSCASAVLFFV---IILPILYFTN-TWYAK- 410
           G L  + D+  I    T SV  +PYW +   C     FF    +++P   + N + Y K 
Sbjct: 297 GFLNHSLDWANI----TSSVMLSPYWTT---CVQFAAFFFSCWVLIPAAKWGNMSSYKKG 349

Query: 411 ----YMPVISGSTYDNTQQK-YNVSRILNSDYSINFEKYKSYSPLFVPFSYLLSYALNFA 465
                +   +G+ Y ++    Y+     N   S N + Y+ + P+++      +   ++A
Sbjct: 350 LMSNKLLTRNGTVYPSSSLIIYDEGASKNGKVSFNEKAYQLHGPIYIGAQKAWNMFFDYA 409

Query: 466 AVIAVFVHCFLYNGKEI-KN--KFRNKNYGGQDIHMRLYSQ-------NYKDCPDWWYVV 515
           A  +      L+  K+I KN  K + + +  ++I++ LY+        NY++ P WW+ +
Sbjct: 410 AFTSAISWMLLFGRKDIAKNFKKLKQRLFHNKNINL-LYNDRLNKIQSNYEEVPVWWFAL 468

Query: 516 LQVIMIALGFVAVCAFNSH-LPAWAFVVALAISFVNFIPQGILEAVTNQHVGLNIITELI 574
           L +I + + FV + A N+  +P W + VA+ +SF+  IP   L A++N  + +    EL+
Sbjct: 469 LFLITLVV-FVTIFATNTMFIPWWTYFVAVGVSFIIIIPLAYLYAISNFQLAIGTFDELL 527

Query: 575 CGYML------PFRPMANLLFKLYGFIVMRQGLELSRDLKLALYMKVPPRLIFAVQIYAT 628
            G M+           A+    L G +  R    L +D K+  YM +PP+ +F  Q+   
Sbjct: 528 YGVMVQNLSTHKHPASASTYGALSGDLWYRAQYML-QDQKIGHYMHIPPKAVFLSQVLGQ 586

Query: 629 VISGLVNVGIQEWMRSNIKELCSSTQPDGFTCNNGRTI--FNASIIWSM---PKYLFSPG 683
           +I   +N G   W+     +    T  D      G+++  +N + +  +   P   FS G
Sbjct: 587 LIGVPMNYGTVRWVLDTKMDYLRGTAKDPLHQWTGQSLTSYNTNAVLYVLLGPTRFFSSG 646

Query: 684 RIYNPIMWF-FLIGLVVPIIVFVL-----QKKFKGNEMLKFCHSPVFFAGPGNIPPSTPY 737
             +N I+ F  L+G   P +++ L     ++KF    +  FC +   F   GN+  ST Y
Sbjct: 647 --HNKIIPFGLLVGFFAPFLIYALYKLFPRRKFNLWNVTIFCSTMSTFY--GNL--STGY 700

Query: 738 NYTLYFALSWALNTIRKRFPRWFSKYNFVMGAGVETGVALAVVIIFLCV--QYPGGSLNW 795
             T +   ++++  +    P+++  YN++  A  +TG  LAV++IF+      P    NW
Sbjct: 701 A-TQFVVGTFSMYYLYNHKPKFWRNYNYLTAAAFDTGYNLAVLLIFIIFSSHKPIKMPNW 759

Query: 796 WGNN 799
           WGNN
Sbjct: 760 WGNN 763

>ZYRO0G16236g Chr7 complement(1332425..1333948) [1524 bp, 507 aa]
           {ON} similar to uniprot|P38778 Saccharomyces cerevisiae
           YHR050W SMF2 Divalent metal ion transporter
          Length = 507

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 147 VFAGVNQFFSLRYPSLSINFLVA--QVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKK 204
           V AG    + L +  L  NF+ A  Q +C  +G +  L    +C R     LN   +   
Sbjct: 60  VAAGSAHKYKLLFSVLVANFMAAFWQCLCARLGAVTGLDLAQNCKRHLTPQLNVALYILA 119

Query: 205 EHAVVTIAVALTSSTAYAMNILI 227
           E A++   +A    TA ++NIL+
Sbjct: 120 EIAIIATDLAEVVGTAISLNILL 142

>KLTH0G06798g Chr7 (544397..545965) [1569 bp, 522 aa] {ON} similar
           to uniprot|P38778 Saccharomyces cerevisiae YHR050W SMF2
           Divalent metal ion transporter
          Length = 522

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 147 VFAGVNQFFSLRYPSLSINFLVA--QVVCYPVGKILALLPEWDCPRCPWFNLNPGPFTKK 204
           V AG    + + +  L  N L A  Q +C  +G +  L    +C R    NLN   +   
Sbjct: 65  VAAGSAHRYKMLFSVLVANLLAAFWQCLCAKLGAVTGLDLAQNCRRHLPPNLNLALYILA 124

Query: 205 EHAVVTIAVALTSSTAYAMNILIAQTNFYNMKLSAGYMILLV 246
           E A++   +A    TA ++NIL      +N+ L+ G ++ +V
Sbjct: 125 EVAIIATDLAEVVGTAISLNIL------FNVPLAFGVVLTVV 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,516,753
Number of extensions: 3796179
Number of successful extensions: 11582
Number of sequences better than 10.0: 41
Number of HSP's gapped: 11604
Number of HSP's successfully gapped: 41
Length of query: 827
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 709
Effective length of database: 39,950,811
Effective search space: 28325124999
Effective search space used: 28325124999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 70 (31.6 bits)