Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0D06710gna 1ON61161129650.0
Kwal_26.7984na 1ON61261521070.0
AGL069Cna 1ON59459715570.0
Ecym_7258na 1ON63856615470.0
Suva_15.426singletonON5405385005e-55
Skud_14.391na 2ON5845404341e-45
Suva_14.414na 2ON5825594236e-44
TDEL0H00160singletonON5755724226e-44
YNR055C (HOL1)na 2ON5865594131e-42
Smik_14.389na 2ON5865614086e-42
ZYRO0E02288gsingletonON5455494013e-41
Kwal_33.15241na 3ON5805463935e-40
ADR337Cna 4ON5705633864e-39
KLLA0E09637gna 3ON5855533795e-38
SAKL0G12254gna 3ON5815423732e-37
SAKL0G12232gna 4ON5965593681e-36
Ecym_5082na 4ON5745453618e-36
KLTH0B02816gna 3ON5835423531e-34
ADR336Cna 3ON5685573493e-34
KLTH0E00132gsingletonON5825523389e-33
KLTH0A00440gsingletonON5825523389e-33
KLLA0D12606gsingletonON5935623282e-31
SAKL0D02508gsingletonON5794823175e-30
Ecym_2679singletonON5695232864e-26
KLLA0B06798g3.245ON6635352742e-24
TDEL0D038003.245ON6405872528e-22
ACL172C3.245ON6316172412e-20
ZYRO0A03564g3.245ON6845552342e-19
Ecym_45063.245ON6485632313e-19
Kwal_33.150205.180ON5975102215e-18
CAGL0M06281g8.570ON5424502082e-16
TPHA0E032005.180ON6265162038e-16
Kpol_1017.33.503ON6215171912e-14
TBLA0B044808.570ON6084491885e-14
Kpol_2002.865.180ON6365511868e-14
NCAS0F036203.503ON6345101869e-14
NCAS0E007503.503ON6205151832e-13
KLTH0G06754g5.284ON4801601786e-13
SAKL0G13376g5.180ON6215181789e-13
ZYRO0G15422gsingletonON5424831771e-12
TDEL0D06570singletonON5664551752e-12
KLTH0G02266g3.503ON6445111734e-12
Kwal_47.189193.503ON6405131724e-12
KAFR0J004805.284ON5004611705e-12
Kpol_1051.155.284ON5014151697e-12
SAKL0D04070g3.245ON6672051708e-12
KLLA0E03829g3.503ON6095121699e-12
SAKL0F02442g3.503ON6105261699e-12
TPHA0B037705.284ON5202071672e-11
ZYRO0G19646g3.503ON5945451672e-11
Smik_2.1613.245ON6892051663e-11
NDAI0I027703.503ON6265141663e-11
TBLA0A103505.284ON5212341635e-11
ZYRO0F02178gsingletonON5955071635e-11
Suva_4.2753.245ON6832231635e-11
Skud_2.1553.245ON6882261636e-11
KNAG0A035408.570ON5384231618e-11
Suva_4.4318.570ON5723951601e-10
Kwal_56.229493.245ON6421481591e-10
YBR043C (QDR3)3.245ON6892051592e-10
ZYRO0F08228gsingletonON6492151592e-10
KAFR0I007108.570ON5754701582e-10
Smik_6.2333.503ON6144751573e-10
AGR195W8.570ON6194381573e-10
CAGL0J00363g5.284ON4984111563e-10
KLTH0C08074g3.245ON6422051564e-10
Kwal_27.121738.570ON5672031564e-10
Smik_16.4083.503ON6225361554e-10
YPR156C (TPO3)3.503ON6225361547e-10
TDEL0A051308.570ON5994141521e-09
ZYRO0E10230gsingletonON5584431511e-09
Skud_2.3068.570ON5723881502e-09
YBR180W (DTR1)8.570ON5723981492e-09
Suva_16.4843.503ON6225341493e-09
KLTH0B03894g5.180ON6061951475e-09
Kpol_1048.458.570ON6481661465e-09
KAFR0C020303.503ON6245221449e-09
Suva_15.2365.284ON5141981431e-08
Smik_8.1175.284ON5141941431e-08
Kpol_1044.214.30ON5872161431e-08
TBLA0D029003.503ON6915141412e-08
SAKL0H09328g8.570ON5961561412e-08
ZYRO0F14652g8.570ON5661711403e-08
YGR138C (TPO2)3.503ON6144751403e-08
TPHA0D033103.503ON6134501403e-08
NDAI0D010202.242ON5925211403e-08
Skud_16.4503.503ON6225361394e-08
Skud_8.1075.284ON5221961385e-08
YHR048W (YHK8)5.284ON5141941376e-08
KLTH0E13222g8.570ON5661211377e-08
Smik_2.3208.570ON5723831377e-08
SAKL0G10758g5.284ON5332081361e-07
KLTH0G09372g2.242ON5514501361e-07
TBLA0E02520singletonON5635331361e-07
TPHA0K021604.30ON6082411342e-07
KNAG0B049005.284ON5162051332e-07
NCAS0A065805.284ON5284541332e-07
Suva_7.4253.503ON6134731332e-07
KLLA0E24113g8.570ON5753481322e-07
AFR322C3.503ON5925551323e-07
NCAS0B020108.570ON5301251313e-07
Skud_7.4483.503ON6114791314e-07
TDEL0E044805.180ON6162201314e-07
KAFR0K00100singletonON5295171304e-07
SAKL0E08756g2.242ON5654551288e-07
TBLA0E015104.30ON6712131288e-07
KLLA0F18106g4.30ON5892241289e-07
Ecym_70638.570ON6201731271e-06
ZYRO0G16302g5.284ON5474071261e-06
ZYRO0D00286gsingletonON5082511252e-06
KAFR0F043904.30ON5674971252e-06
KAFR0I014004.30ON5892521242e-06
NDAI0C056708.570ON5001731233e-06
CAGL0H06017gsingletonON5573591233e-06
Kpol_1057.25singletonON5482231224e-06
KLLA0F03311g2.242ON5424941224e-06
ZYRO0E09988gsingletonON5484561215e-06
KNAG0G028308.723ON6771911216e-06
NDAI0D016805.284ON5161831207e-06
Kpol_1018.195singletonON5482231207e-06
CAGL0I10384g3.503ON6301921208e-06
Kwal_55.195905.720ON5335251191e-05
Ecym_62298.723ON5672271181e-05
TPHA0I017608.570ON6531741182e-05
KNAG0B007303.503ON6221991182e-05
Kpol_1039.192.242ON5734661172e-05
KNAG0F03480singletonON5484591162e-05
TDEL0D057103.503ON6161931162e-05
TDEL0C045902.242ON5295601153e-05
CAGL0J09944g2.242ON5924701143e-05
ZYRO0B16808g5.720ON5295551144e-05
ZYRO0F02090gsingletonON6012181135e-05
ZYRO0A13618gsingletonON5295221135e-05
Smik_15.4558.723ON6592761135e-05
NDAI0D048404.30ON6392081136e-05
ZYRO0F04642gsingletonON5494471126e-05
TPHA0G014308.723ON6371911127e-05
Kpol_1018.193singletonON5485291118e-05
CAGL0L10912g8.723ON6511931111e-04
KLTH0D12320g8.723ON5881911101e-04
YBR008C (FLR1)na 5ON5481931092e-04
NCAS0C057804.30ON5671791072e-04
TBLA0A085304.30ON6152341072e-04
TDEL0F016704.30ON5822401072e-04
TDEL0A066708.723ON6251961073e-04
KAFR0K00150singletonON5302381073e-04
SAKL0H25498g4.30ON6022221073e-04
Skud_14.2672.242ON5623531063e-04
Skud_15.4388.723ON6592201063e-04
Kpol_413.28.723ON6671911064e-04
TPHA0F003304.30ON5841611064e-04
ZYRO0E10054gsingletonON6282081064e-04
KNAG0I030804.30ON5922301054e-04
NCAS0G029902.242ON5811431055e-04
CAGL0E03674g4.30ON5771791045e-04
Kpol_478.34.30ON5802381046e-04
Skud_15.531na 6ON539831046e-04
Smik_2.128na 5ON5471981046e-04
Suva_8.3228.723ON6521951046e-04
AER339C8.723ON5731911038e-04
TBLA0A08520singletonON6322111030.001
Suva_10.434.30ON5872261020.001
TBLA0A08510singletonON6332051020.001
CAGL0H06039gna 6ON5892241020.001
Kwal_26.89858.723ON5802201010.002
TBLA0D011608.723ON642191990.002
TBLA0E037902.241ON550239990.002
Suva_8.420na 6ON546193980.003
YLL028W (TPO1)4.30ON586228980.003
SAKL0H05412g8.723ON580191980.003
ADL258W2.242ON534155980.003
Smik_12.274.30ON587227970.004
Skud_2.121na 5ON546193970.004
ZYRO0E09966gsingletonON561583960.005
TPHA0A00130singletonON567263960.005
Kwal_23.4803singletonON541344960.006
Skud_12.384.30ON587226960.006
TBLA0B035508.723ON217171920.007
NCAS0B004908.723ON664191950.009
TBLA0C07220singletonON612486920.015
KAFR0A041208.723ON591193920.015
Kpol_1003.112.241ON581131920.015
YNL065W (AQR1)2.242ON586120910.021
TPHA0F012902.242ON562209900.027
Smik_14.2622.242ON561120900.031
TPHA0O02010singletonON562278900.031
ZYRO0B00990g4.30ON592262890.035
Kwal_23.48242.242ON553146890.035
CAGL0G03927g4.30ON567221890.038
Kwal_55.206864.30ON61388890.043
KAFR0B00180singletonON530197880.047
KLLA0A04631g8.272ON579121880.049
KLTH0E00528g5.720ON552532870.068
Suva_14.2762.242ON562155870.074
Smik_3.205singletonON192135830.081
KNAG0I019102.242ON598154860.084
YOR273C (TPO4)8.723ON659191860.094
Skud_9.482.241ON599121850.11
KAFR0J009302.242ON566161850.11
Suva_9.712.241ON561130850.12
Kpol_358.7singletonON455206840.13
KLTH0E06138g4.30ON61496840.13
Skud_3.178singletonON389159840.15
SAKL0A08228gsingletonON569125840.17
TDEL0D06500na 7ON542185830.18
NDAI0A07730singletonON555178820.23
TBLA0A08515singletonON632172830.23
TDEL0C045802.241ON557130820.25
KLTH0H09856gsingletonON54983820.25
TDEL0F039908.272ON631118820.27
SAKL0B12628gsingletonON53783820.27
KLTH0G09350g2.241ON56396810.35
KNAG0A052202.363ON576123810.37
KNAG0E01160singletonON572126800.43
YIL120W (QDR1)2.242ON563133800.45
ZYRO0E09922gsingletonON563346800.49
Suva_9.702.242ON565121790.66
NCAS0A031205.720ON54484780.69
KAFR0D05140singletonON574361780.80
ZYRO0E09900gna 7ON539200780.81
TPHA0I03320singletonON562118780.84
TBLA0A04260singletonON567115771.1
YIL121W (QDR2)2.241ON542121761.2
NCAS0C036002.242ON572138761.3
KNAG0E01170singletonON573129751.6
ZYRO0A01474g2.242ON538133751.7
Kpol_467.118.99ON74491751.9
ZYRO0C01430g8.272ON590118752.0
KAFR0J016202.242ON570126732.9
KLTH0G11154gna 8ON57292733.1
TBLA0E02500singletonON576192733.2
KAFR0A011808.517ON150871733.4
Smik_9.492.242ON542151724.1
NDAI0B037702.242ON571138724.5
CAGL0G08624g2.242ON583130715.1
Ecym_42988.272ON678121715.6
Smik_9.482.241ON591121706.5
KNAG0C046205.469ON54656707.5
TDEL0G029302.363ON62565707.8
TPHA0A017508.272ON63667708.1
Kpol_543.448.272ON643118699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0D06710g
         (611 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {...  1146   0.0  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...   816   0.0  
AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON} N...   604   0.0  
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...   600   0.0  
Suva_15.426 Chr15 complement(752324..753946) [1623 bp, 540 aa] {...   197   5e-55
Skud_14.391 Chr14 complement(696469..698223) [1755 bp, 584 aa] {...   171   1e-45
Suva_14.414 Chr14 complement(713179..714927) [1749 bp, 582 aa] {...   167   6e-44
TDEL0H00160 Chr8 complement(16735..18462) [1728 bp, 575 aa] {ON}      167   6e-44
YNR055C Chr14 complement(728426..730186) [1761 bp, 586 aa] {ON} ...   163   1e-42
Smik_14.389 Chr14 complement(685196..686956) [1761 bp, 586 aa] {...   161   6e-42
ZYRO0E02288g Chr5 complement(171852..173489) [1638 bp, 545 aa] {...   159   3e-41
Kwal_33.15241 s33 complement(1027827..1029569) [1743 bp, 580 aa]...   155   5e-40
ADR337C Chr4 complement(1301383..1303095) [1713 bp, 570 aa] {ON}...   153   4e-39
KLLA0E09637g Chr5 (853845..855602) [1758 bp, 585 aa] {ON} highly...   150   5e-38
SAKL0G12254g Chr7 (1044636..1046381) [1746 bp, 581 aa] {ON} high...   148   2e-37
SAKL0G12232g Chr7 (1042473..1044263) [1791 bp, 596 aa] {ON} high...   146   1e-36
Ecym_5082 Chr5 (178458..180182) [1725 bp, 574 aa] {ON} similar t...   143   8e-36
KLTH0B02816g Chr2 (219220..220971) [1752 bp, 583 aa] {ON} highly...   140   1e-34
ADR336C Chr4 complement(1299394..1301100) [1707 bp, 568 aa] {ON}...   139   3e-34
KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly sim...   134   9e-33
KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly s...   134   9e-33
KLLA0D12606g Chr4 complement(1068516..1070297) [1782 bp, 593 aa]...   130   2e-31
SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} simila...   126   5e-30
Ecym_2679 Chr2 complement(1313694..1315403) [1710 bp, 569 aa] {O...   114   4e-26
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...   110   2e-24
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...   101   8e-22
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    97   2e-20
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    95   2e-19
Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {O...    94   3e-19
Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138...    90   5e-18
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    85   2e-16
TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {O...    83   8e-16
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    78   2e-14
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    77   5e-14
Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON} (2010...    76   8e-14
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    76   9e-14
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               75   2e-13
KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} simila...    73   6e-13
SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]...    73   9e-13
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    73   1e-12
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    72   2e-12
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    71   4e-12
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    71   4e-12
KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.28...    70   5e-12
Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON} (29969....    70   7e-12
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    70   8e-12
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    70   9e-12
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    70   9e-12
TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON}               69   2e-11
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    69   2e-11
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    69   3e-11
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     69   3e-11
TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON} Anc_5...    67   5e-11
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    67   5e-11
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    67   5e-11
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    67   6e-11
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    67   8e-11
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    66   1e-10
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    66   1e-10
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    66   2e-10
ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} simila...    66   2e-10
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    65   2e-10
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    65   3e-10
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    65   3e-10
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    65   3e-10
KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} simila...    65   4e-10
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    65   4e-10
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    64   4e-10
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    64   7e-10
TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {O...    63   1e-09
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    63   1e-09
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    62   2e-09
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    62   2e-09
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    62   3e-09
KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {...    61   5e-09
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    61   5e-09
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    60   9e-09
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    60   1e-08
Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W ...    60   1e-08
Kpol_1044.21 s1044 (47355..49118) [1764 bp, 587 aa] {ON} (47355....    60   1e-08
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    59   2e-08
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    59   2e-08
ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]...    59   3e-08
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    59   3e-08
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    59   3e-08
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    59   3e-08
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    58   4e-08
Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W ...    58   5e-08
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    57   6e-08
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    57   7e-08
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    57   7e-08
SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} simila...    57   1e-07
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    57   1e-07
TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {O...    57   1e-07
TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {...    56   2e-07
KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON}               56   2e-07
NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON} Anc_5...    56   2e-07
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    56   2e-07
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    55   2e-07
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    55   3e-07
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     55   3e-07
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    55   4e-07
TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {O...    55   4e-07
KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON}      55   4e-07
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    54   8e-07
TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.3...    54   8e-07
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    54   9e-07
Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}...    54   1e-06
ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]...    53   1e-06
ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON...    53   2e-06
KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.3...    53   2e-06
KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {O...    52   2e-06
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    52   3e-06
CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {...    52   3e-06
Kpol_1057.25 s1057 (56904..58550) [1647 bp, 548 aa] {ON} (56904....    52   4e-06
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    52   4e-06
ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} simila...    51   5e-06
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    51   6e-06
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    51   7e-06
Kpol_1018.195 s1018 (493001..494647) [1647 bp, 548 aa] {ON} (493...    51   7e-06
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    51   8e-06
Kwal_55.19590 s55 complement(38363..39964) [1602 bp, 533 aa] {ON...    50   1e-05
Ecym_6229 Chr6 complement(427712..429415) [1704 bp, 567 aa] {ON}...    50   1e-05
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    50   2e-05
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    50   2e-05
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    50   2e-05
KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {O...    49   2e-05
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    49   2e-05
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    49   3e-05
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    49   3e-05
ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} simi...    49   4e-05
ZYRO0F02090g Chr6 complement(169045..170850) [1806 bp, 601 aa] {...    48   5e-05
ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} simi...    48   5e-05
Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {...    48   5e-05
NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa] ...    48   6e-05
ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} simila...    48   6e-05
TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.7...    48   7e-05
Kpol_1018.193 s1018 (487656..487952,487955..487999,488002..48916...    47   8e-05
CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa...    47   1e-04
KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]...    47   1e-04
YBR008C Chr2 complement(252563..254209) [1647 bp, 548 aa] {ON}  ...    47   2e-04
NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa] ...    46   2e-04
TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4...    46   2e-04
TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {O...    46   2e-04
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    46   3e-04
KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON}      46   3e-04
SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]...    46   3e-04
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    45   3e-04
Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {...    45   3e-04
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    45   4e-04
TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30 ...    45   4e-04
ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {...    45   4e-04
KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.3...    45   4e-04
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    45   5e-04
CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {...    45   5e-04
Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON} (12238..13...    45   6e-04
Skud_15.531 Chr15 (957329..958948) [1620 bp, 539 aa] {ON} YBR008...    45   6e-04
Smik_2.128 Chr2 complement(240029..241672) [1644 bp, 547 aa] {ON...    45   6e-04
Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON...    45   6e-04
AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}...    44   8e-04
TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON}             44   0.001
Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W (...    44   0.001
TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON}             44   0.001
CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {...    44   0.001
Kwal_26.8985 s26 complement(1029923..1031665) [1743 bp, 580 aa] ...    44   0.002
TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.7...    43   0.002
TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.2...    43   0.002
Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C ...    42   0.003
YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyami...    42   0.003
SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} simila...    42   0.003
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    42   0.003
Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W (...    42   0.004
Skud_2.121 Chr2 complement(233273..234913) [1641 bp, 546 aa] {ON...    42   0.004
ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} simila...    42   0.005
TPHA0A00130 Chr1 complement(10942..12645) [1704 bp, 567 aa] {ON}       42   0.005
Kwal_23.4803 s23 complement(875449..877074) [1626 bp, 541 aa] {O...    42   0.006
Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W (...    42   0.006
TBLA0B03550 Chr2 (824481..825134) [654 bp, 217 aa] {ON} Anc_8.72...    40   0.007
NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}...    41   0.009
TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON}             40   0.015
KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {O...    40   0.015
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    40   0.015
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    40   0.021
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    39   0.027
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    39   0.031
TPHA0O02010 Chr15 complement(410334..412022) [1689 bp, 562 aa] {...    39   0.031
ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON...    39   0.035
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    39   0.035
CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {...    39   0.038
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    39   0.043
KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON}       39   0.047
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.049
KLTH0E00528g Chr5 complement(54185..55843) [1659 bp, 552 aa] {ON...    38   0.068
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    38   0.074
Smik_3.205 Chr3 complement(303229..303807) [579 bp, 192 aa] {ON}...    37   0.081
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    38   0.084
YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON} ...    38   0.094
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    37   0.11 
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    37   0.11 
Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W (...    37   0.12 
Kpol_358.7 s358 complement(24674..26041) [1368 bp, 455 aa] {ON} ...    37   0.13 
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    37   0.13 
Skud_3.178 Chr3 complement(290523..291692) [1170 bp, 389 aa] {ON...    37   0.15 
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    37   0.17 
TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON}             37   0.18 
NDAI0A07730 Chr1 complement(1777435..1779102) [1668 bp, 555 aa] ...    36   0.23 
TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possi...    37   0.23 
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    36   0.25 
KLTH0H09856g Chr8 (848950..850599) [1650 bp, 549 aa] {ON} simila...    36   0.25 
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    36   0.27 
SAKL0B12628g Chr2 complement(1091243..1092856) [1614 bp, 537 aa]...    36   0.27 
KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} simila...    36   0.35 
KNAG0A05220 Chr1 complement(768621..770351) [1731 bp, 576 aa] {O...    36   0.37 
KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON}               35   0.43 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    35   0.45 
ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} simila...    35   0.49 
Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W (...    35   0.66 
NCAS0A03120 Chr1 (611490..613124) [1635 bp, 544 aa] {ON}               35   0.69 
KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON}             35   0.80 
ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} simila...    35   0.81 
TPHA0I03320 Chr9 (737136..738824) [1689 bp, 562 aa] {ON}               35   0.84 
TBLA0A04260 Chr1 (1055087..1056790) [1704 bp, 567 aa] {ON}             34   1.1  
YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multid...    34   1.2  
NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {O...    34   1.3  
KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON}               33   1.6  
ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} simila...    33   1.7  
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    33   1.9  
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    33   2.0  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    33   2.9  
KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {...    33   3.1  
TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON}               33   3.2  
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    33   3.4  
Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W (...    32   4.1  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    32   4.5  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    32   5.1  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    32   5.6  
Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W (...    32   6.5  
KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {O...    32   7.5  
TDEL0G02930 Chr7 complement(559519..561396) [1878 bp, 625 aa] {O...    32   7.8  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    32   8.1  
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    31   9.5  

>KLTH0D06710g Chr4 complement(582430..584265) [1836 bp, 611 aa] {ON}
           weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 611

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/611 (92%), Positives = 564/611 (92%)

Query: 1   MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGI 60
           MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGI
Sbjct: 1   MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGI 60

Query: 61  ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI 120
           ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI
Sbjct: 61  ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI 120

Query: 121 SYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIV 180
           SYLV          SIIASPCAVIFGKRIVYLV           CAVSQNYESLLASRIV
Sbjct: 121 SYLVGGMMLALALGSIIASPCAVIFGKRIVYLVGIIIFFFGSIGCAVSQNYESLLASRIV 180

Query: 181 SGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLF 240
           SGLGVSTIESLPSATVAEIYFAHERAYRLGFYT             ASFVFEYLDRHWLF
Sbjct: 181 SGLGVSTIESLPSATVAEIYFAHERAYRLGFYTLLLLGGKNLVPLLASFVFEYLDRHWLF 240

Query: 241 WIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQ 300
           WIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQ
Sbjct: 241 WIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQ 300

Query: 301 GEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDK 360
           GEEDA             VTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDK
Sbjct: 301 GEEDASLSKSLSPELLKSVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDK 360

Query: 361 WIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS 420
           WIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS
Sbjct: 361 WIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS 420

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA 480
           PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA
Sbjct: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA 480

Query: 481 HDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNT 540
           HDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNT
Sbjct: 481 HDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNT 540

Query: 541 KFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHSRGST 600
           KFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHSRGST
Sbjct: 541 KFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHSRGST 600

Query: 601 GDRHMEDSYQS 611
           GDRHMEDSYQS
Sbjct: 601 GDRHMEDSYQS 611

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/615 (66%), Positives = 463/615 (75%), Gaps = 10/615 (1%)

Query: 1   MTQFLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGD-DAPSTGGVVQTTKKG 59
           M   LWIQQPK N++     +  Q + PV+GVTGTFAMMGG  D  A    G +QTTKKG
Sbjct: 1   MASLLWIQQPKLNEN-----EELQLEKPVLGVTGTFAMMGGVQDRTAAVDSGTMQTTKKG 55

Query: 60  IILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSD 119
           IILNPQPS+S RDPLNWPVWRRD AL VVGWHCFVGGGQTSILAAGS+ LA EF+RSLSD
Sbjct: 56  IILNPQPSESMRDPLNWPVWRRDIALLVVGWHCFVGGGQTSILAAGSRSLAEEFNRSLSD 115

Query: 120 ISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRI 179
           ISYLV          SIIASP AV+FGKRI+YL+           C+VS +YESLLASRI
Sbjct: 116 ISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSIGCSVSHSYESLLASRI 175

Query: 180 VSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWL 239
           VSGLGV+TIESLPSATVAEIYFAHERAYRLG YT             AS VF+ LDR+WL
Sbjct: 176 VSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLLGGKNLVPLLASLVFQSLDRYWL 235

Query: 240 FWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKF 299
           FWIVTIIVG+NF+LH+ FVPETFWDR PVP+ RSI+E+AIARA + A +VA    +    
Sbjct: 236 FWIVTIIVGINFVLHLFFVPETFWDRAPVPSRRSIQESAIARAVNAA-EVAGEARNRRSI 294

Query: 300 QGE---EDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRH 356
                 +D+              T    HR  S +R     + +A+SHL  GLG++HGRH
Sbjct: 295 ASSFDYDDSSLTHSLRSEAMQRDTEASQHRRNSNLRPNAATNALARSHLTVGLGLYHGRH 354

Query: 357 SVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGL 416
           +VD W MVMLRPFVLF YPAVLFGAFLYSLAIVWLIMVAQIINTV+ N PY FS I IGL
Sbjct: 355 TVDSWCMVMLRPFVLFAYPAVLFGAFLYSLAIVWLIMVAQIINTVFANAPYKFSPIHIGL 414

Query: 417 VYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGW 476
           VY++PF+GSI GS+CAGP+SDKMVR  AK++CG+YEPEFRL M  PAG+STALGLMGFGW
Sbjct: 415 VYIAPFIGSIFGSICAGPVSDKMVRLLAKRNCGVYEPEFRLLMTAPAGISTALGLMGFGW 474

Query: 477 SAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
           SAQ  D WIAPTIFLG+VGFGSSLASTTAITFTVDSYK YAQEALVTLNVLKNVMGFAFS
Sbjct: 475 SAQRGDPWIAPTIFLGIVGFGSSLASTTAITFTVDSYKQYAQEALVTLNVLKNVMGFAFS 534

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHS 596
           FFN +FNV+ GYK  F+VYG VE+ VCLFAIPLYHYGKR R WTD KGLLDFSYV K  +
Sbjct: 535 FFNARFNVEEGYKIAFVVYGSVEIFVCLFAIPLYHYGKRLRHWTDRKGLLDFSYVNKCAA 594

Query: 597 RGSTGDRHMEDSYQS 611
           R S  D+ + +  ++
Sbjct: 595 RSSFRDQSVTEDEKA 609

>AGL069C Chr7 complement(578235..580019) [1785 bp, 594 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1)
          Length = 594

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/597 (53%), Positives = 397/597 (66%), Gaps = 24/597 (4%)

Query: 4   FLWIQQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTG---GV--VQTTKK 58
           FL I QP++ D           + P + VTGTFAM     +     G   GV  +Q TKK
Sbjct: 3   FLGIVQPRSGD-------GESQELPTLDVTGTFAMTREAVEAMRHAGHDTGVDDLQRTKK 55

Query: 59  GIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLS 118
           GI+LNPQPSK  RDPLNWP+WRRD AL  VGWHCFVGGGQTS+LAAG   L+ E H  +S
Sbjct: 56  GIVLNPQPSKHTRDPLNWPIWRRDLALVCVGWHCFVGGGQTSMLAAGFSKLSAELHVPIS 115

Query: 119 DISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASR 178
            +S+LV          S++ASP AV+FGKR+VYL+           CA+S ++ SLL  R
Sbjct: 116 QVSFLVGPMMLALAIGSVVASPTAVLFGKRMVYLMGILIFLGGSIGCALSNSFASLLIFR 175

Query: 179 IVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW 238
           +VSG G+ST+ESLPSAT+AEIYFAHERAYRLG YT              S VFE L  HW
Sbjct: 176 MVSGFGLSTVESLPSATIAEIYFAHERAYRLGLYTLLLLGGKNLVPLLGSLVFENLTTHW 235

Query: 239 LFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPK 298
           LFWI+TII GVNF+LH+LFVPETFWDRTPVPNERS+ ET IAR       V    +  P 
Sbjct: 236 LFWILTIIAGVNFVLHLLFVPETFWDRTPVPNERSLEETIIARETQAV--VCNLSHRTPS 293

Query: 299 F-----QGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFH 353
                 Q E+D                   +    SR+R+ I  +++ QSHL TGLGIFH
Sbjct: 294 LGESTSQSEDDHIGKDPPKQLYDQ--KNDDATEAPSRIRSHI--NSMTQSHLTTGLGIFH 349

Query: 354 GRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQ 413
           GRH++DKW MV+LRPFVL  YPAVL GA +Y+ A+V+LIMV+Q+I+  Y +  Y FSS  
Sbjct: 350 GRHTMDKWRMVLLRPFVLCSYPAVLLGALMYAFAVVFLIMVSQVIDHAYKD-LYGFSSAS 408

Query: 414 IGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMG 473
           +GLVY++PFVG  LGSLCAG LSD +VR  A ++ GIYEPEFRLFM +PA +STA GL+G
Sbjct: 409 VGLVYIAPFVGGCLGSLCAGKLSDLLVRSLAMRNHGIYEPEFRLFMAIPAVISTAAGLLG 468

Query: 474 FGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGF 533
           FG+S +    WI PTIF GV+GFGSS+ STT IT+ VDSYK +AQE+LVT N+ KNV+GF
Sbjct: 469 FGFSLKNQAHWIVPTIFFGVLGFGSSMCSTTGITYAVDSYKHFAQESLVTFNIFKNVLGF 528

Query: 534 AFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSY 590
           AFSFFN  F++++GY   F+ Y  +EL++ + AI +Y +GK  R WTD K L+ FSY
Sbjct: 529 AFSFFNVNFSLQAGYDKAFLCYTVIELVLGVCAIVIYRWGKLCRSWTDRKALMQFSY 585

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/566 (53%), Positives = 381/566 (67%), Gaps = 6/566 (1%)

Query: 43  GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSIL 102
           G ++  +   ++ TKKGIILNPQPS+ K+DPLNWP+WRRD AL  VGWHCFVGGGQTS+L
Sbjct: 76  GQESGGSDDHLKKTKKGIILNPQPSECKKDPLNWPIWRRDIALVCVGWHCFVGGGQTSML 135

Query: 103 AAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXX 162
           A+G   L+ E    LS ISYLV          SI ASP AV+FGKR+VYLV         
Sbjct: 136 ASGFSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGS 195

Query: 163 XXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXX 222
             CA S ++  LL SR+VSG G+ST+ESLPSAT+AEIYFAHERAYRLG YT         
Sbjct: 196 IGCACSTSFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTLLLLGGKNL 255

Query: 223 XXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARA 282
                S VFE+L  HWLFWI+TII G NF+LH+LFVPETFWDRTPVPN+RS+ ET IAR 
Sbjct: 256 VPLLGSLVFEHLSTHWLFWILTIIAGSNFVLHLLFVPETFWDRTPVPNKRSLHETRIARQ 315

Query: 283 ADG-ARDVAISGYSAPKFQGEEDAXXXXXXXX-XXXXXVTPTQSHRYLSRVRTKIKCSNI 340
             G + +V+I+   + +    E A               +  Q     S+ R  IK  +I
Sbjct: 316 VRGLSENVSIATVRSTRLNPRESAGHVNDDGVPVGLTDESNAQEAETGSKTRAHIK--SI 373

Query: 341 AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINT 400
           ++  +  GLGI+HGRH++D W MVMLRPFVLF YPA+LFGA+LY+ A+V LI+++Q+I+ 
Sbjct: 374 SEKQMAIGLGIYHGRHTIDNWCMVMLRPFVLFSYPAILFGAWLYAYAVVSLIIISQVIDH 433

Query: 401 VYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMV 460
            Y +  Y FSS  +GLVY++PF+G  LGSL AG  SD   R  A  + GIYEPEFRLFMV
Sbjct: 434 AYKD-IYGFSSASVGLVYIAPFIGGCLGSLIAGRGSDVNTRLLAAHNHGIYEPEFRLFMV 492

Query: 461 LPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEA 520
           LPA L  A+GL+GFGWS +  D WI P+IF GV+GFGSS+ STTAIT+ VDSYK ++QEA
Sbjct: 493 LPAVLCNAIGLLGFGWSLERQDHWIIPSIFFGVLGFGSSMCSTTAITYAVDSYKEFSQEA 552

Query: 521 LVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWT 580
           LVTLN++KN++GFA SFFN KF +  GYK  F  Y  +E+ + L+AIPLY +GK  R WT
Sbjct: 553 LVTLNMVKNILGFAVSFFNVKFCLHEGYKNAFTCYALIEIFIGLWAIPLYRWGKLCRSWT 612

Query: 581 DSKGLLDFSYVKKNHSRGSTGDRHME 606
           + K LL FSY + N       D H E
Sbjct: 613 NRKNLLQFSY-RVNDDGKDEKDNHTE 637

>Suva_15.426 Chr15 complement(752324..753946) [1623 bp, 540 aa] {ON}
           YNR055C (REAL)
          Length = 540

 Score =  197 bits (500), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 136/538 (25%), Positives = 255/538 (47%), Gaps = 53/538 (9%)

Query: 58  KGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQT--SILAAGSKGLALEFHR 115
           K IIL+PQPS    DPLNW   ++   L+ +G      G      +L      L+  F  
Sbjct: 42  KNIILSPQPSDQPDDPLNWS--KKIKTLYFIGILLTSVGPAIMGPLLVPAFNELSSIFDV 99

Query: 116 SLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLL 175
            L+ ++ L           S + +  + I+GKR+++L+            A S+++ SL+
Sbjct: 100 PLTTVAQLNGGLVMSLGVSSYLCNQLSSIYGKRLLFLLTSLCQVVIAIWGACSKSFRSLI 159

Query: 176 ASRIVSGLGVS-TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYL 234
           A+RI  GL +  +  +  ++++A+++F HERA  +G ++             + +V E L
Sbjct: 160 AARIFQGLFMGMSYSAAGTSSIADVFFVHERAKYVGIWSFVLLTTNNITPIISGYVIEDL 219

Query: 235 DRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAA-----DGARDV 289
              W F  + I + V  + H   VPE+ + R     +  +    +++A      D  ++ 
Sbjct: 220 SWKWSFGFLAIYLFVCLVFHFFLVPESAFKRD---TKTEVFYQGVSKAESLSVHDQKKEY 276

Query: 290 AISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGL 349
            +S  +A +  G +D                 T+ + +   +R                 
Sbjct: 277 QVS--AASESSGLQD-----------------TKEYSFKKSLR----------------- 300

Query: 350 GIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSF 409
            ++ GR S      V+ RP+++   P V++G   + L   W+IM+  + + ++  PPY+F
Sbjct: 301 -VYRGRQSELSLFYVLFRPWLMLQNPIVIWGVLQWCLCYTWVIMIGSVASQMFTAPPYNF 359

Query: 410 SSIQIGLVY-VSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTA 468
           S    G++  V+P +G+ +G+L +G +SD ++   A+K+ G+YEPEFRLFM++P  +   
Sbjct: 360 SVSSTGVISGVAPLIGTTIGTLASGTISDYLIDFMARKNNGVYEPEFRLFMMIPYMILLL 419

Query: 469 LGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLK 528
           +G  G GW  +   +WI+  ++L ++  G +   T+ IT+TVDS    + EA   + ++K
Sbjct: 420 IGGFGTGWQVENGKSWISVAVYLAILFCGVACGVTSIITYTVDSLGDCSGEAFGLMMLVK 479

Query: 529 NVMGFAFSF-FNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGL 585
           +   +   + FNT +  + G K+ + +       V L +IP+Y +GKR R +    G+
Sbjct: 480 SAFAYGLIWKFNTWY-AERGAKSVYGIMSGATCAVILLSIPMYIFGKRGRLYVKQHGI 536

>Skud_14.391 Chr14 complement(696469..698223) [1755 bp, 584 aa] {ON}
           YNR055C (REAL)
          Length = 584

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 125/540 (23%), Positives = 228/540 (42%), Gaps = 16/540 (2%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALE 112
           ++ T  G++L PQPS S  DPLNW  WR+     ++ +        ++   A    L   
Sbjct: 35  LKKTTSGVVLIPQPSYSSNDPLNWSAWRKFAHFGLMAFITAFTAATSNDAGAAQDSLNEI 94

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYE 172
           +  S   ++             ++  +P A ++G++I Y+V            A+++   
Sbjct: 95  YGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFGALWFALAKRTS 154

Query: 173 SLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFE 232
             + S++  G+  S  E+    ++++I+F H+    L  Y              A ++  
Sbjct: 155 DTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPLIAGYISA 214

Query: 233 YLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRETAIARAADGARD 288
           + +  W+ W+  II G   ++ +L   ET++DR    TP+ + +S  E            
Sbjct: 215 FTNFRWVGWVAVIISGGLLVVIILGCEETYFDRGQYMTPLTSSQSGYEDGTTLQNSDNTV 274

Query: 289 VAISGY------SAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIK--CSNI 340
           V+   +      S P   GE+                T  ++   +   +  +K     I
Sbjct: 275 VSRKKHHLDAKLSTPGAMGEKGVSETAEFEVNNEEEATIPETRELIDGSKEPLKPYQKRI 334

Query: 341 AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINT 400
           A     T L  + G     K++ + LR   +F +P V      + +  V+L        +
Sbjct: 335 AIFTKATNLKGY-GFKQYFKYLKINLR---MFLFPPVWLSGMFWGIQDVFLTFYLTTQES 390

Query: 401 VYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMV 460
            Y  PP+++S   + ++ V   +G+++G +CAG +SD  V   A+ + GI E EFRL+  
Sbjct: 391 AYYEPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVLWMARHNRGILEAEFRLYFS 450

Query: 461 LPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEA 520
           +   +    GL+ FG        W A  + LG VGF    +   A+ + +D Y     E 
Sbjct: 451 IATAVIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCSGDIAMAYLMDCYPDMVLEG 510

Query: 521 LVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWT 580
           +V   ++ N +   F+F  + +   SG + T+I    +   +  FA+P+YHYGKR R WT
Sbjct: 511 MVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGITAFALPMYHYGKRIRIWT 570

>Suva_14.414 Chr14 complement(713179..714927) [1749 bp, 582 aa] {ON}
           YNR055C (REAL)
          Length = 582

 Score =  167 bits (423), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 129/559 (23%), Positives = 233/559 (41%), Gaps = 37/559 (6%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALE 112
           ++    G++L PQPS S  DPLNW  WR+     ++ +        ++   A    L   
Sbjct: 35  LKKNPSGVVLIPQPSYSPNDPLNWSGWRKMAHFGLMAFITAFTAATSNDAGAAQDSLNEI 94

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYE 172
           +  S + ++             ++  +P A ++G++I Y+V            A+++   
Sbjct: 95  YGISYNSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCITLGLFGALWFALAKRTS 154

Query: 173 SLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFE 232
             + S++  G+  S  E+    ++++I+F H+    L  Y              A ++  
Sbjct: 155 DTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPLIAGYISA 214

Query: 233 YLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRETAIA-RAADGA- 286
           YL+  W+ W+  II G   +  VL   ET++DR    TP+ +++S  E     + +D   
Sbjct: 215 YLNFRWVGWVAVIISGGLLVAIVLGCEETYFDRGRYMTPLTSKQSGYEDGTTLQNSDNTL 274

Query: 287 ---RDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHR----------YLSRVRT 333
              +   +    A + +G + +               P               Y  RV  
Sbjct: 275 VSQKKRHLDANLAMREKGMDVSETAEFEVNNEEEVTIPETRELIDGSKEPLKPYPKRVAI 334

Query: 334 KIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIM 393
             K +N+            +G     K++ + LR   +F +P V      + +  V+L  
Sbjct: 335 FTKATNLKG----------YGFKQYFKYLKINLR---MFLFPPVWLSGMFWGIQDVFLSF 381

Query: 394 VAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP 453
                   Y +PP+++S   + ++ V   +G+++G +CAG +SD  V   A+ + GI E 
Sbjct: 382 YLTTQEDAYYDPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVLWMARHNKGILEA 441

Query: 454 EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSY 513
           EFRL+  +   +    GL+ FG        W A  + LG VGF    +   A+ + +D Y
Sbjct: 442 EFRLYFSVATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFSWGCSGDIAMAYLMDCY 501

Query: 514 KCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYG 573
                E +V   ++ N +   F+F  + +   SG + T+I    +   +  FA+P+YHYG
Sbjct: 502 PEMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFGITAFALPMYHYG 561

Query: 574 KRARRWT-----DSKGLLD 587
           KR R WT     DS  L D
Sbjct: 562 KRIRLWTKQWYLDSVNLRD 580

>TDEL0H00160 Chr8 complement(16735..18462) [1728 bp, 575 aa] {ON} 
          Length = 575

 Score =  167 bits (422), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 132/572 (23%), Positives = 236/572 (41%), Gaps = 29/572 (5%)

Query: 32  VTGTFAMMGGPGDDAP----STGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFV 87
           + GTF +   P  ++     ST G ++T K G++L PQPS S  DPLNW  WR+     +
Sbjct: 17  IPGTFNIYSSPDSESDVKSGSTTGRLKTDKNGVVLIPQPSDSPNDPLNWSKWRKFLHFGL 76

Query: 88  VGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGK 147
           + +        ++   A    L   +  S   ++             ++  +P A ++G+
Sbjct: 77  MAFITAFTAATSNDAGATQDSLNEYYGISYDSMNVGAGVLFLGIGWATLFTAPLASLYGR 136

Query: 148 RIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAY 207
           +I YL+            A+++     + S++  G+  S  E+   +++ +IYF H+   
Sbjct: 137 KITYLICTILGLFGALWFALAKRTSDTIWSQLFVGISESCAEAQVQSSLNDIYFQHQMGS 196

Query: 208 RLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR-- 265
            L  Y              A ++    +  W+ W+  II G   +  +    ET++DR  
Sbjct: 197 ILTVYILCTSIGTFLGPLIAGYIASLTNFRWVGWVAVIISGGLLIALIFGCEETYFDRNK 256

Query: 266 --TPVPNERSI--RETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP 321
             TP+    +    + A  R++ G  + A          GE +               + 
Sbjct: 257 YITPLTYGGNPFGDDCADDRSSVGLNEKANKPIEQADVAGESEVHELSPPADQLIDGAS- 315

Query: 322 TQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGA 381
            +   Y  RV    K SN+             G     K+++  LR   +  YP V    
Sbjct: 316 EKLKPYHKRVALITKGSNLKG----------WGFKQYPKFVLFNLR---MMLYPPVWLSG 362

Query: 382 FLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR 441
             + +  V+L        + Y +PP+++S   + ++ V   +G+++G + AG +SD  V 
Sbjct: 363 LFWGIQDVFLTFYLTTEESYYYDPPWNYSDYGVAIMCVPTLIGAVIGCIYAGIVSDYFVL 422

Query: 442 HFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLA 501
             A+K+ GI E E+RL+           GL+ FG   +   +W    + LG +GF    +
Sbjct: 423 WMARKNNGILEAEYRLYFSFATAFIGPAGLLMFGIGTERALSWQVIYVGLGFIGFSWGCS 482

Query: 502 STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
              A+ + +D Y     E +V   ++ N +   F+F  + +   SG + T+I    +   
Sbjct: 483 GDIAMAYLMDCYPEMVLEGMVCTAIINNSISCIFTFVCSDWLSASGTENTYIALAVINFA 542

Query: 562 VCLFAIPLYHYGKRARRWT-----DSKGLLDF 588
           + L A+P + YGKR R WT     DS  L DF
Sbjct: 543 ITLLALPSFIYGKRIRLWTKKWYNDSVDLRDF 574

>YNR055C Chr14 complement(728426..730186) [1761 bp, 586 aa] {ON}
           HOL1Putative transporter in the major facilitator
           superfamily (DHA1 family) of multidrug resistance
           transporters; mutations in membrane-spanning domains
           permit cation and histidinol uptake
          Length = 586

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 136/559 (24%), Positives = 235/559 (42%), Gaps = 52/559 (9%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSK--GLA 110
           ++ T  G++L PQPS S  DPLNW  WR+   L   G   F+    T+  AA S   G A
Sbjct: 35  LKKTSSGVVLIPQPSYSPNDPLNWSSWRK---LAHFGLMAFI----TAFTAATSNDAGAA 87

Query: 111 LEFHRSLSDISYLVXXXXXXXXXXSI-----IASPCAVIFGKRIVYLVXXXXXXXXXXXC 165
            +    +  ISY             I       +P A ++G++I Y+V            
Sbjct: 88  QDSLNEIYGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFGALWF 147

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           A+++     + S++  G+  S  E+    ++++I+F H+    L  Y             
Sbjct: 148 ALAKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPL 207

Query: 226 XASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRE----- 276
            A ++  + +  W+ W+  II G   +  +    ET++DR    TP+ + +S  E     
Sbjct: 208 IAGYISAFTNFRWVGWVAVIISGGLLITIIFGCEETYFDRGQYMTPLTSCQSGYEDGTTL 267

Query: 277 -----TAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP--------TQ 323
                TA++R      D  +S   A   +G + +               P        ++
Sbjct: 268 QNSDNTAVSRRKR-HLDAKLSTPGAMGEKGVDLSETAEFEVNNEEEVTIPETRELIDGSK 326

Query: 324 SHR--YLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGA 381
            H   Y  RV    K +N+            +G     K++ + LR   +F +P V    
Sbjct: 327 EHLKPYPKRVAILTKATNLKG----------YGFKQYFKYLKINLR---MFLFPPVWLSG 373

Query: 382 FLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR 441
             + +  V+L        + Y  PP+++S   + ++ V   +G+++G +CAG +SD  V 
Sbjct: 374 MFWGIQDVFLTFYLTTQESAYYEPPWNYSDFGVAIMNVPTLIGAVIGCICAGIVSDYFVL 433

Query: 442 HFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLA 501
             A+ + GI E EFRL+  +   +    GL+ FG        W A  + LG VGF    +
Sbjct: 434 WMARHNRGILEAEFRLYFSIATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWGCS 493

Query: 502 STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
              A+ + +D Y     E +V   ++ N +   F+F  + +   SG + T+I    +   
Sbjct: 494 GDIAMAYLMDCYPDMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVINFG 553

Query: 562 VCLFAIPLYHYGKRARRWT 580
           +  FA+P+Y+YGKR R WT
Sbjct: 554 ITAFALPMYYYGKRIRLWT 572

>Smik_14.389 Chr14 complement(685196..686956) [1761 bp, 586 aa] {ON}
           YNR055C (REAL)
          Length = 586

 Score =  161 bits (408), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 136/561 (24%), Positives = 235/561 (41%), Gaps = 56/561 (9%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSK--GLA 110
           ++    G+IL PQPS S  DPLNW   R+   L   G   F+    T+  AA S   G A
Sbjct: 35  LKKNTSGVILIPQPSYSPNDPLNWSSCRK---LAHFGLMAFI----TAFTAATSNDAGAA 87

Query: 111 LEFHRSLSDISYLVXXXXXXXXXXSI-----IASPCAVIFGKRIVYLVXXXXXXXXXXXC 165
            +    +  ISY             I       +P A ++G++I Y+V            
Sbjct: 88  QDSLNEIYGISYDSMNTGAGVLFLGIGWSTLFLAPFANLYGRKITYIVCTTLGLFGALWF 147

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           AV++     + S++  G+  S  E+    ++++I+F H+    L  Y             
Sbjct: 148 AVAKRTSDTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYIMCTSIGTFLGPL 207

Query: 226 XASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRE----- 276
            A ++  + +  W+ W+  II G   +  +    ET++DR    TP+   +S  E     
Sbjct: 208 VAGYISAFTNFRWVGWVAVIISGGLLIAIIFGCEETYFDRGQYMTPLTGCQSGYEDGTTL 267

Query: 277 -----TAIAR------------AADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXV 319
                T I+R             A G +   ++  +  +   EE+A              
Sbjct: 268 QNSDNTVISRRKRHLDAKLSTPGAIGEKSREVAETAEFEVNNEEEATIPETRELIDGSK- 326

Query: 320 TPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLF 379
            P +S  Y  R+    K +N+            +G     K++ + LR   +F +P V  
Sbjct: 327 EPLKS--YPKRIAIFTKATNLKG----------YGFKQYFKYLKINLR---MFLFPPVWL 371

Query: 380 GAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKM 439
               + +  V+L        + Y +PP+++S  ++ ++ V   +G+++G +CAG +SD  
Sbjct: 372 SGMFWGIQDVFLTFYLTTQESAYYDPPWNYSDFKVAIMNVPTVIGAVIGCICAGIVSDYF 431

Query: 440 VRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSS 499
           V   A+ + GI E EFRL+  +   +    GL+ FG        W A  + LG VGF   
Sbjct: 432 VLWMARHNRGILEAEFRLYFSIATAIIGPAGLLMFGIGTARQWPWQAIYVGLGFVGFAWG 491

Query: 500 LASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVE 559
            +   A+ + +D Y     E +V   ++ N +   F+F  + +   SG + T+I    + 
Sbjct: 492 CSGDIAMAYLMDCYPDMVLEGMVCTAIINNTISCIFTFTCSDWLAASGTENTYIALAVIN 551

Query: 560 LIVCLFAIPLYHYGKRARRWT 580
             +  FA+P+Y+YGKR R WT
Sbjct: 552 FGITAFALPMYYYGKRVRLWT 572

>ZYRO0E02288g Chr5 complement(171852..173489) [1638 bp, 545 aa] {ON}
           similar to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and some similarities with YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 545

 Score =  159 bits (401), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 138/549 (25%), Positives = 236/549 (42%), Gaps = 41/549 (7%)

Query: 47  PSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGS 106
           P    +V+  ++ ++L P+PSK   DPLNW   R+  A   V       G  ++ + +  
Sbjct: 12  PGDARLVEGEEREVVLLPKPSKDPEDPLNWSRPRKWLATACVIVVTIGIGIPSAAIYSVL 71

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
             +A E + SL+D++              ++  P A+ +GKR VYL              
Sbjct: 72  PNIAEERNLSLADLNQGTGYLFLFYGLGCLVFQPLALQYGKRPVYLFSMLATSLICVWPP 131

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            +++    +AS+I+ GL  S +ESLP  ++++++F HER+  L  Y              
Sbjct: 132 YTRSNGEWIASKILQGLFGSCVESLPEISMSDLFFEHERSLGLSLYALTLMGVSYSAPLV 191

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGA 286
           A F+       W+ W  +I+  V F++    + ET + R  V +E S+            
Sbjct: 192 AGFISAGQGWQWVMWWCSILAAVCFVILFFAMEETSYTRR-VQDEASLD----------- 239

Query: 287 RDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIA----- 341
                     P+  GEE                   +    L ++R+     +++     
Sbjct: 240 ----------PEIDGEEVHESNVENGEVENDKAEKAKDD--LVKIRSDYSAHSLSEGSIS 287

Query: 342 --QSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIIN 399
             Q+  +  + +  G  S       M  PF +  +P +L+  FLY  ++VW  ++     
Sbjct: 288 WPQTSYMQKISLTRGFKSKFMLHYYMFMPFRMAQFPVILWAGFLYGSSLVWFNVLNATEA 347

Query: 400 TVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFM 459
            V    PY+FSS   GL YVSP V + +    AG  SDK+  +FA+K  G   PE RL++
Sbjct: 348 MVLAGKPYNFSSSMCGLAYVSPLVCTFIVFPIAGFCSDKLKVYFARKRNGFSIPEDRLWL 407

Query: 460 VLP-AGLSTALGLM-GFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYA 517
           +   A L  A  L+ G G   Q H  W    + LG++G        ++  + VD+Y+   
Sbjct: 408 LFVYAILGCAASLLWGIGAYYQIH--WFPLVLALGILGGCGVFGPVSSAAYVVDTYRELD 465

Query: 518 QEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFI--VYGCV----ELIVCLFAIPLYH 571
            EA+V + +++N+M FA S+  T +    GYK  FI   + C+      +V +F  P + 
Sbjct: 466 AEAMVVVILIRNLMSFACSYGITHWVENLGYKRCFIGVAFCCLATNSSFLVMIFTGPWWR 525

Query: 572 YGKRARRWT 580
             +R   W+
Sbjct: 526 KKQRHAYWS 534

>Kwal_33.15241 s33 complement(1027827..1029569) [1743 bp, 580 aa]
           {ON} YNR055C (HOL1) - Putative ion transporter similar
           to the major facilitator superfamily of transporters
           [contig 94] FULL
          Length = 580

 Score =  155 bits (393), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 124/546 (22%), Positives = 228/546 (41%), Gaps = 32/546 (5%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALE 112
           ++ TKK ++L PQPS+S  DPLNW V R+     ++ +        ++   A    L  E
Sbjct: 35  LRKTKKDVVLIPQPSESPNDPLNWSVMRKTLHFALMAFITAFTAATSNDAGAAQYNLNEE 94

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYE 172
           +  S   ++             ++  +P A ++G++I YL+              S    
Sbjct: 95  YGISYDSMNTGAGVLFLGIGWGTLFLAPLANLYGRKITYLICISLGLIGAVWFGFSTRTR 154

Query: 173 SLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFE 232
             + S++  G+  S  E+    ++++I+F H+    L  Y              A ++  
Sbjct: 155 DTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSVGTFLGPLIAGYISS 214

Query: 233 YLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPV---PNERSIRETAIAR---- 281
           +   HW+ WI  II G   ++ +    ET++DR    TPV   PN  S R T  ++    
Sbjct: 215 FTSYHWIGWIAAIISGGLLIVILFGCEETYFDRNKYVTPVSRRPNSES-RGTFDSQCCTP 273

Query: 282 --AADGARDVAISGYSAPKFQGEE---DAXXXXXXXXXXXXXVTPTQSHR--YLSRVRTK 334
             ++    D  I      K   +    D              V   +  +  Y  R+   
Sbjct: 274 LMSSSNNNDEEIDSNKELKKVNQNSTCDIVPSCVASIHDYNLVDGAEERKKPYHKRIAII 333

Query: 335 IKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMV 394
            K SN+       G G+        ++I + +R   +F +P V      + +  V L   
Sbjct: 334 TKASNL------RGWGV----KQYFQYIALNMR---MFLFPPVWLSGLFWGIQDVLLTFY 380

Query: 395 AQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPE 454
               +T +  PP+++S   + ++ V   +G+++G +CAG +SD  +   A+++ GI E E
Sbjct: 381 LTTEDTYFYEPPWNYSDRGVAIMNVPTLIGAVIGCVCAGIVSDYFILWMARRNNGILEAE 440

Query: 455 FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYK 514
           +RL+     G+    GL+ FG  A     W    + LG +GF    +   A+ + +D Y 
Sbjct: 441 YRLYFSFATGIIGPAGLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYP 500

Query: 515 CYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGK 574
               E +V   ++ N +   F+F  + +   SG + T+I    +   +   AIP++ +GK
Sbjct: 501 DMVLEGMVCTAIINNTISCIFTFVCSYWLEASGTENTYIALAVINFAITTLAIPMFIWGK 560

Query: 575 RARRWT 580
           + R+ T
Sbjct: 561 KIRKAT 566

>ADR337C Chr4 complement(1301383..1303095) [1713 bp, 570 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1); Tandem gene duplication in this genome
          Length = 570

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 123/563 (21%), Positives = 236/563 (41%), Gaps = 33/563 (5%)

Query: 32  VTGTFAMM-GGP--GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVV 88
           V GTF +   GP  GD        ++  + G++L PQPS S  DPLNW  WR+     ++
Sbjct: 13  VPGTFNIYSNGPVEGDSLARQALGIKKDRNGVVLVPQPSDSPNDPLNWSYWRKIMHFALM 72

Query: 89  GWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKR 148
            +        ++   A ++ L   +  +   ++             +++ SP   +FG++
Sbjct: 73  AFITAFTAATSNDAGATTESLHSIYGITYDSMNVGAAVLFLGVGWSALLFSPLPSLFGRK 132

Query: 149 IVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYR 208
           + Y++            A++     ++ S++  G+  S  E+    ++++I+F H+    
Sbjct: 133 LTYMICITLGLFGAMWFALATKTGHVIWSQLFVGMSESCAEAHVQLSLSDIFFQHQLGSV 192

Query: 209 LGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR--- 265
           L  Y              A ++    +  W+ W   II     +  V    ET++DR   
Sbjct: 193 LTVYIMATSVGTFLGPLIAGYIASLTNFRWVGWCAVIISAFLLLWIVFGCEETYFDRRLY 252

Query: 266 -TPVP-------NERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXX 317
            TP+        +E   + +A A    GA   +++      +    +             
Sbjct: 253 QTPLTVVAGHSTDEEDNKCSACAGTTTGAEKRSLA------YASNTELNERVVMLNTQLI 306

Query: 318 XVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAV 377
             +     RY  R+R   + +N        G G+        K++ + LR   +F +P V
Sbjct: 307 DGSEEPPKRYFRRIRLITRATNF------RGWGV----KQYFKYLGLNLR---MFLFPPV 353

Query: 378 LFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD 437
                 +    V+L       +T + + P+++S+ ++ ++ V   +G+++G + AG +SD
Sbjct: 354 WLSGLYWGTQDVFLSFYLTTQDTNFYDEPWNYSTYRVAIMNVPTLLGAVVGCMYAGVISD 413

Query: 438 KMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFG 497
             V   A+++ GI E EFRL+    AG++  LGL+ FG+ A     W    I L  +GF 
Sbjct: 414 VFVLWLARRNNGILEAEFRLYFAAVAGIAGTLGLILFGYGAARALPWQTVYIGLAFIGFT 473

Query: 498 SSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGC 557
                  A+ + +D Y     E +    V+ N +   F+   +      G K+T++  G 
Sbjct: 474 WGSFGDIAMAYLMDCYPEMVLEGMACTAVINNTLSCIFTLTCSYLLDTYGNKSTYLALGL 533

Query: 558 VELIVCLFAIPLYHYGKRARRWT 580
           + L + L A+P++ YGK+ R W+
Sbjct: 534 LNLGITLLAVPMFLYGKQIRTWS 556

>KLLA0E09637g Chr5 (853845..855602) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 585

 Score =  150 bits (379), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 120/553 (21%), Positives = 220/553 (39%), Gaps = 35/553 (6%)

Query: 50  GGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGL 109
           G  ++    G+IL PQPS S  DPLNW V R+     ++ +        ++   A    L
Sbjct: 32  GSRLKKDSNGVILIPQPSDSPNDPLNWSVIRKLAHFALMAFITAFTAATSNDAGAAQDSL 91

Query: 110 ALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQ 169
              +  S   ++             ++  +P A ++G++I YL+            A++ 
Sbjct: 92  NEIYGISYDAMNTGAGVLFLGIGWATLFLAPFANLYGRKITYLICITLGLLGALWFALAS 151

Query: 170 NYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASF 229
           + +  + S++  G+  S  E+    ++ +IYF H+    L  Y              A +
Sbjct: 152 STKDTIWSQLFVGISESCAEAQVQLSLTDIYFQHQLGSVLTVYILATSIGTFLGPLIAGY 211

Query: 230 VFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSI----------- 274
           +       W+ W   II G   +  V    ET++DR    TP+ +++             
Sbjct: 212 IASLTSFRWVGWCAVIISGGLLVWIVFGCEETYFDRKQYRTPLTSQKGYSGVEDGSSYQN 271

Query: 275 -------RETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRY 327
                  +   I + AD   + +     + +                     +  +   Y
Sbjct: 272 SSNLLEKKTMLIEQFADSKNNDSKMNEDSNEVTNRYADYPEAYENVEELIDGSKEKMKPY 331

Query: 328 LSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLA 387
             R++   K  N+            +G     K+I   LR   +F +P V      + + 
Sbjct: 332 YKRIQLITKSGNLRG----------YGFKQYFKYIGFNLR---MFLFPPVWLSGMFWGIQ 378

Query: 388 IVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKS 447
            V+L       +TV+   P+++S   + ++ V   +G+++G   AG +SD  V   A+K+
Sbjct: 379 DVFLSFYLTTEDTVFYEAPWNYSDYGVAIMNVPTLIGAVIGCFYAGVISDYFVLWMARKN 438

Query: 448 CGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAIT 507
            GI E E+RL+      +    GL+ FG     +  W    + LG +GFG   +   A++
Sbjct: 439 NGILEAEYRLYFAAATAIICPAGLLMFGIGTDRNLPWQVIYVGLGFIGFGWGCSGDIAMS 498

Query: 508 FTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAI 567
           + +D Y     E +V   ++ N +   F+F  + +   SG + T+I    +   V L A+
Sbjct: 499 YLMDCYPEMVLEGMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFAVTLLAL 558

Query: 568 PLYHYGKRARRWT 580
           P+Y YGKR R WT
Sbjct: 559 PMYIYGKRIRMWT 571

>SAKL0G12254g Chr7 (1044636..1046381) [1746 bp, 581 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 581

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/542 (21%), Positives = 225/542 (41%), Gaps = 17/542 (3%)

Query: 50  GGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGL 109
           G  ++    G++L PQPS S  DPLNW  +R+     ++ +        ++   A    L
Sbjct: 32  GARLKKDNNGVVLIPQPSDSPNDPLNWSRFRKLAHFALMSFITAFTAATSNDAGAAQDSL 91

Query: 110 ALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQ 169
              +  +   ++             ++  +P + ++G++I Y+V            A+++
Sbjct: 92  NEIYGITFDSMNTGAGVLFLGIGWATLFLAPLSNLYGRKITYVVCITLGLLGAMWFALAK 151

Query: 170 NYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASF 229
                + S++  G+  S  E+    ++++IYF H+    L  Y              A +
Sbjct: 152 RTSDTIWSQLFVGISESCAEAQVQLSLSDIYFQHQLGSVLTVYILATSIGTFLGPLIAGY 211

Query: 230 VFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRETAIARAADG 285
           +       W+ W   II G   M  +    ET++DR    TP+ ++++ +          
Sbjct: 212 IASLTTFRWVGWCAVIISGALLMFILFGCEETYFDRGMYITPLTSQKTSQGCEDGTTLQN 271

Query: 286 ARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ----SHRYL---SRVRTKIKCS 338
           + D  +  Y++ + Q   D+                      SH+ L   S+ + K    
Sbjct: 272 SEDRLV--YASGEKQKNPDSKDVETSAVTSFGVSEELNRTIISHKELIDGSKEKLKPYRE 329

Query: 339 NIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQII 398
            ++   + T L    G     +++ + LR   +F +P V      + +  V+L       
Sbjct: 330 RVSLITIATNLN-GCGAKQYFRYLGINLR---MFLFPPVWLSGLFWGIQDVFLSFYLTTE 385

Query: 399 NTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLF 458
              Y +PP+++S   + ++ V   +G+++G + AG +SD  V   A+K+ GI E E+RL+
Sbjct: 386 EDNYYDPPWNYSDYGVAIMNVPTLIGAVVGCIYAGTVSDYFVLWMARKNNGILEAEYRLY 445

Query: 459 MVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQ 518
               + +    GL+ FG  +     W    + LG +GF    +   A+ + +D Y     
Sbjct: 446 FSFASAIIGPAGLLMFGIGSARALPWQVIYVGLGFIGFSWGCSGDIAMGYLMDCYPDMVL 505

Query: 519 EALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           E +V   ++ N     F+F  + +   SG + T+I    +   +   A+P++ YGKR R+
Sbjct: 506 EGMVCTAIINNTTSCIFTFVCSYWIEASGTENTYIALAVINFGIASLALPMFIYGKRIRK 565

Query: 579 WT 580
           WT
Sbjct: 566 WT 567

>SAKL0G12232g Chr7 (1042473..1044263) [1791 bp, 596 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 596

 Score =  146 bits (368), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 120/559 (21%), Positives = 228/559 (40%), Gaps = 36/559 (6%)

Query: 50  GGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGL 109
           G  ++    G+IL PQPS S  DPLNW  +R+     ++ +        ++   A    L
Sbjct: 32  GARLKKDHNGVILIPQPSDSPNDPLNWSRFRKLAHFALMSFITAFTAATSNDAGAAQDSL 91

Query: 110 ALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQ 169
              +  +   ++             ++  +P + ++G++I Y+V            A+++
Sbjct: 92  NEIYGITYDSMNTGAGVLFLGIGWATLFLAPFSNLYGRKITYVVCITLGLLGAMWFALAK 151

Query: 170 NYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASF 229
                + S++  G+  S  E+    ++++IYF H+    L  Y              A +
Sbjct: 152 RTSDTIWSQLFVGISESCAEAQVQLSLSDIYFQHQLGSVLTVYILATSIGTFLGPLIAGY 211

Query: 230 VFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRE----TAIAR 281
           +       W+ W   II G   M  +    ET++DR    TP+ +++S+R     T +  
Sbjct: 212 IASLTTFRWVGWCAVIISGALLMFILFGCEETYFDRKRYVTPLTSQKSLRNFEDGTTLQD 271

Query: 282 AADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPT-QSHRYLSRVRTKIKCSNI 340
           + +     +     A  F    D                 T Q H        + K S  
Sbjct: 272 SDNHIYFDSEKSTKAADFDFCPDGTNLVSREKAENKVTDSTIQVHD-----NDEPKASFT 326

Query: 341 AQSHLVTG----LGIFHGRHSVD---------------KWIMVMLRPFVLFCYPAVLFGA 381
            +  L+ G    L  +H R S+                K++ + LR   +F +P V    
Sbjct: 327 VKQDLIDGSKENLKPYHKRISIVTKATNLRGWGFRQYFKYLGINLR---MFLFPPVWLSG 383

Query: 382 FLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR 441
             + +  V+L       +T++ + P+++S   + ++ V   +G+++G + AG +SD  V 
Sbjct: 384 LFWGIQDVFLSFYLTTEDTLFYDEPWNYSDYGVAIMNVPTLIGAVVGCIYAGTVSDYFVL 443

Query: 442 HFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLA 501
             A+K+ GI E E+RL+    + +    GL+ FG  +     W    + LG +GF    +
Sbjct: 444 WMARKNNGILEAEYRLYFSFASAIIGPAGLLMFGIGSARALPWQVIYVGLGFIGFSWGCS 503

Query: 502 STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
              A+ + +D Y     E +V   ++ N     F+F  + +   SG + T+I    +   
Sbjct: 504 GDIAMGYLMDCYPDMVLEGMVCTAIINNTTSCIFTFVCSYWIEASGTENTYIALAVINFG 563

Query: 562 VCLFAIPLYHYGKRARRWT 580
           +   A+P++ YGKR R+WT
Sbjct: 564 IASLALPMFIYGKRIRKWT 582

>Ecym_5082 Chr5 (178458..180182) [1725 bp, 574 aa] {ON} similar to
           Ashbya gossypii ADR337C
          Length = 574

 Score =  143 bits (361), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 115/545 (21%), Positives = 225/545 (41%), Gaps = 23/545 (4%)

Query: 44  DDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILA 103
           DD   +   ++  + G++L PQPS S  DPLNW   R+     ++ +        ++   
Sbjct: 28  DDYNQSFNDIKRDRSGVVLIPQPSDSPNDPLNWSKCRKILHFALMSFITAFTAATSNGTG 87

Query: 104 AGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXX 163
           A +  L   ++ +   ++             ++I +P   ++G+R+ Y +          
Sbjct: 88  AAADSLHDYYNITYDSLNAGAGVLFFGIGWATLIFAPLPSLYGRRLTYFICIFLGLCGAL 147

Query: 164 XCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXX 223
             A +     ++ S++  G+  S  E+    ++ +I+F H+    L  Y           
Sbjct: 148 WFARTSKTRDVIWSQLFVGISESCAEAHVQLSLTDIFFQHQLGSVLTVYIMSISVGTFLG 207

Query: 224 XXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRETA- 278
                ++    +  WL W   I+ G   +       ET++DR    TP      I ++  
Sbjct: 208 PLIGRYIATLANFRWLGWCAAIMSGALLVWIYFGCEETYFDRHLYMTPYSKHSIINKSVD 267

Query: 279 -IARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKC 337
            +  + D   D   +        G+  +              +     +Y  R++   K 
Sbjct: 268 ELPTSVDEGEDATSNKDGPITATGQTISTEKCITFDKELINGSKEPLKKYHKRIKLITKA 327

Query: 338 SNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQI 397
           +N+       G G+        +++   LR   +F +P V      + +  V+L      
Sbjct: 328 TNLK------GWGV----KQYFRYLGTNLR---MFLFPPVWLSGLFWGIQDVFLSFYLTT 374

Query: 398 INTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL 457
            +T + + P+++S+  + L+ V    G+++G + AG +SD  V   A+++ GI E E+RL
Sbjct: 375 QDTYFYDEPWNYSAYSVALMNVPTLAGAVIGCMYAGVISDVFVLWMARRNRGILEAEYRL 434

Query: 458 FMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIF--LGVVGFGSSLASTTAITFTVDSYKC 515
           +    A    + GLM FG  A+  +A   P I+  LG +GF    +   A+ + +D Y  
Sbjct: 435 YFSGAAAALGSSGLMMFGIGAE--NALPPPVIYVGLGFIGFAWGCSGDIAMAYLMDCYPE 492

Query: 516 YAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKR 575
              E +   +V+ N +   F+F  +++    G K T+I+ G + L +   A+P+  +GKR
Sbjct: 493 MVLEGMACTSVINNTLSCVFTFCCSQWLESFGTKNTYIILGLINLAITFLAVPMLIFGKR 552

Query: 576 ARRWT 580
            R WT
Sbjct: 553 IRAWT 557

>KLTH0B02816g Chr2 (219220..220971) [1752 bp, 583 aa] {ON} highly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C
          Length = 583

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 110/542 (20%), Positives = 225/542 (41%), Gaps = 21/542 (3%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALE 112
           ++ T + ++L PQPS+S  DPLNW   R+     ++ +        ++   A    L   
Sbjct: 35  LRKTTEDVVLIPQPSESPNDPLNWSKARKFLHFALMSFITAFTAATSNDAGAAQDSLNEF 94

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYE 172
           +  S   ++             ++  +P A ++G++I Y++              ++   
Sbjct: 95  YGISYDSMNTGAGVLFLGIGWSTLFLAPLANLYGRKITYIICTALGLAGAIWFGFARRTS 154

Query: 173 SLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFE 232
             + S++  G+  S  E+    ++++I+F H+    L  Y              A ++  
Sbjct: 155 DTIWSQLFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSAGTFLGPLIAGYISA 214

Query: 233 YLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR----TPVPNERSIRETAIARAADGARD 288
                W+ WI  II G   ++ V    ET++DR    TPV  +  +R      +   A+ 
Sbjct: 215 LTSFRWVGWIAAIISGALLIIIVFGCEETYFDRNRYVTPVSRKAHLRSGGNYDSQCSAQP 274

Query: 289 VAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPT-----QSHRYLSRVRTKIK-----CS 338
           +  S  +  ++  + D              V P+     +  + +     K+K      +
Sbjct: 275 LLASQDNCDEYGFKHDPKNVPNQKTEKTTEVEPSFNASIEDFKLIDGSEEKLKPYYKRVA 334

Query: 339 NIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQII 398
            I +S  + G G+         ++ + +R   +F +P V      + +  V+L       
Sbjct: 335 IITKSTNLRGWGV----KQYFNYLGINMR---MFLFPPVWLSGLFWGIQDVFLTFYLTTE 387

Query: 399 NTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLF 458
           +T +   P+++S   + ++ V   +G+I+G + AG +SD  V   A+++ GI E E+RL+
Sbjct: 388 DTYFPEAPWNYSDYGVAIMNVPTLIGAIIGCIYAGIVSDYFVLWMARRNHGILEAEYRLY 447

Query: 459 MVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQ 518
                 +    GL+ FG  A     W    + LG +GF    +   A+ + +D Y     
Sbjct: 448 FSFATAIIGPAGLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPDMIL 507

Query: 519 EALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           E +V   ++ N +   F+F  + +   SG + T+I    +   + + A+P++ +GK+ R+
Sbjct: 508 EGMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFGITMLAVPMFIWGKKIRQ 567

Query: 579 WT 580
            T
Sbjct: 568 AT 569

>ADR336C Chr4 complement(1299394..1301100) [1707 bp, 568 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YNR055C
           (HOL1); Tandem gene duplication in this genome
          Length = 568

 Score =  139 bits (349), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 124/557 (22%), Positives = 232/557 (41%), Gaps = 25/557 (4%)

Query: 32  VTGTFAMMGG-PGDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGW 90
           + GTF +    PGD A      ++    G++L PQPS S  DPLNW VWR+     ++ +
Sbjct: 15  IPGTFNIYASFPGDKA-ERWSRLKKDSCGVLLTPQPSDSPNDPLNWSVWRKYVHFGLMSF 73

Query: 91  HCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIV 150
                   ++  +A    L   +  + + ++             +++ +P + ++G++I 
Sbjct: 74  ITAFTAATSNNASAAQDSLNELYGITFAAMNTGAGVLFLCIGWGTLVFAPLSSLYGRKIT 133

Query: 151 YLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLG 210
           Y++            A + N    + S+ + G+  +  E+    ++++I+F H+    L 
Sbjct: 134 YMICIGFGLLGAIWFASTSNTNDAIWSQALVGVSEACAEAQVQLSLSDIFFQHQLGSVLT 193

Query: 211 FYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPN 270
            Y              A ++    +  W+ W+  I+ G   +  + F  ET++DR     
Sbjct: 194 VYILCTSIGTFLGPLIAGYISSLTNFRWVGWVGAIVSGGLLLAFLFFCEETYFDRKAYIT 253

Query: 271 ERSIRETAIARAADGARDVAI--SGYSAPKFQG-----EEDAXXXXXXXXXXXXXVTPTQ 323
             +  +++I R    +  +    +  +  K  G     +E+                P  
Sbjct: 254 PLTWTDSSILRRNSSSSSMLTVNANINEDKASGGGKDSDEEHCRLERTSLLDGAAEDPKP 313

Query: 324 SHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFL 383
            HR   R+    K SN+             G     K+I + +R   +F +P V      
Sbjct: 314 YHR---RIALITKASNLKG----------WGFKQYLKYIGINMR---MFLFPPVWLSGLF 357

Query: 384 YSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHF 443
           + +  V+L          Y   P++FS+ Q+ L+ V   VG+++G + AG +SD  V   
Sbjct: 358 WGIQDVFLSFYLTTEEDYYPEQPWNFSNYQVALMNVPTLVGAVVGCMYAGVISDYFVLWM 417

Query: 444 AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLAST 503
           A+++ GI E E+RL+   P      LGL+ FG   +   +       L ++GF    +  
Sbjct: 418 ARRNGGIMEAEYRLYFSAPTAFLGTLGLLLFGIGTEQQLSLSVVYGGLVLIGFSWGCSGD 477

Query: 504 TAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVC 563
            A++F +D Y     E +V  +V+ N +   F+FF + F    G + ++I    V   V 
Sbjct: 478 IAMSFLMDCYPEMVLEGMVCTSVINNTLSCIFTFFCSPFIEAVGTQNSYIFLAVVNFSVT 537

Query: 564 LFAIPLYHYGKRARRWT 580
           L A P+  YGK+ R+ T
Sbjct: 538 LLAWPMLVYGKKVRKLT 554

>KLTH0E00132g Chr5 (3262..5010) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score =  134 bits (338), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 136/552 (24%), Positives = 232/552 (42%), Gaps = 36/552 (6%)

Query: 54  QTTKKG-----IILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKG 108
           +T K G     I+LNP PS    DPLNW   R+ TA+  V  +       T+ + +    
Sbjct: 21  ETRKSGEREGKIVLNPTPSDDPDDPLNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPN 80

Query: 109 LALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVS 168
           +    + +LS+++              +I  P A+ FGKR +YL               +
Sbjct: 81  IEANTNITLSELNNGTGYMFLFLGLGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYT 140

Query: 169 QNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXAS 228
           ++    +AS+I+ G   S++ESLP  ++++++F HER++ L  Y              A 
Sbjct: 141 KSNGEWVASKILQGFVGSSMESLPEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAG 200

Query: 229 FVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIA--RAADGA 286
           F+ E     W+ W   I   V F+L    + ET +DR    +  +     +A  +   GA
Sbjct: 201 FISEGQGWEWVMWWCAIFGAVCFVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGA 260

Query: 287 R----DVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNI-- 340
                D  I+  S     GE++                  Q+  Y   +    + SN+  
Sbjct: 261 VFTNIDEVIASNSEGNNAGEKNETKTNDIG-------ASLQTEEYPENINIVNQVSNVEV 313

Query: 341 -----------AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIV 389
                           +  L +F GR         +  PF++  +P VL+  FLY  ++V
Sbjct: 314 VDSNSYAPNYEGTKTYLQKLSLFGGRRKKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLV 373

Query: 390 WLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKM-VRHFAKKSC 448
           W  ++      + G  PY FSS  IG+ Y+SP + S++    +G  SD + VR    +  
Sbjct: 374 WFNVLNATAALILGGSPYDFSSSTIGVAYLSPTIFSVILFFISGLCSDWLKVRVALWRGT 433

Query: 449 GIYEPEFRLF-MVLPAGLSTALGLM-GFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAI 506
           G+ +PE RL+ +V+   L  A  ++ G G   + H  W      +G++G        ++ 
Sbjct: 434 GLSKPEDRLWILVIYCVLGCAASILWGVGAYYEIH--WFGLVFGMGLLGGCGIFGIASSA 491

Query: 507 TFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA 566
           T+ VD+YK    EA+V + +++N M F  S+  T +    GYK  FI    +        
Sbjct: 492 TYVVDTYKELDTEAMVVVIIIRNCMSFGVSYGITDWVTDLGYKKCFISVAFLCFAANFTF 551

Query: 567 IPLYHYGKRARR 578
           + + ++G R R 
Sbjct: 552 LAMVYFGPRLRN 563

>KLTH0A00440g Chr1 (37100..38848) [1749 bp, 582 aa] {ON} weakly
           similar to uniprot|P53389 Saccharomyces cerevisiae
           YNR055C HOL1 Putative ion transporter similar to the
           major facilitator superfamily of transporters; mutations
           in membrane-spanning domains permit nonselective cation
           uptake
          Length = 582

 Score =  134 bits (338), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 136/552 (24%), Positives = 232/552 (42%), Gaps = 36/552 (6%)

Query: 54  QTTKKG-----IILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKG 108
           +T K G     I+LNP PS    DPLNW   R+ TA+  V  +       T+ + +    
Sbjct: 21  ETRKSGEREGKIVLNPTPSDDPDDPLNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPN 80

Query: 109 LALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVS 168
           +    + +LS+++              +I  P A+ FGKR +YL               +
Sbjct: 81  IEANTNITLSELNNGTGYMFLFLGLGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYT 140

Query: 169 QNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXAS 228
           ++    +AS+I+ G   S++ESLP  ++++++F HER++ L  Y              A 
Sbjct: 141 KSNGEWVASKILQGFVGSSMESLPEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAG 200

Query: 229 FVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIA--RAADGA 286
           F+ E     W+ W   I   V F+L    + ET +DR    +  +     +A  +   GA
Sbjct: 201 FISEGQGWEWVMWWCAIFGAVCFVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGA 260

Query: 287 R----DVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNI-- 340
                D  I+  S     GE++                  Q+  Y   +    + SN+  
Sbjct: 261 VFTNIDEVIASNSEGNNAGEKNETKTNDIG-------ASLQTEEYPENINIVNQVSNVEV 313

Query: 341 -----------AQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIV 389
                           +  L +F GR         +  PF++  +P VL+  FLY  ++V
Sbjct: 314 VDSNSYAPNYEGTKTYLQKLSLFGGRRKKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLV 373

Query: 390 WLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKM-VRHFAKKSC 448
           W  ++      + G  PY FSS  IG+ Y+SP + S++    +G  SD + VR    +  
Sbjct: 374 WFNVLNATAALILGGSPYDFSSSTIGVAYLSPTIFSVILFFISGLCSDWLKVRVALWRGT 433

Query: 449 GIYEPEFRLF-MVLPAGLSTALGLM-GFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAI 506
           G+ +PE RL+ +V+   L  A  ++ G G   + H  W      +G++G        ++ 
Sbjct: 434 GLSKPEDRLWILVIYCVLGCAASILWGVGAYYEIH--WFGLVFGMGLLGGCGIFGIASSA 491

Query: 507 TFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA 566
           T+ VD+YK    EA+V + +++N M F  S+  T +    GYK  FI    +        
Sbjct: 492 TYVVDTYKELDTEAMVVVIIIRNCMSFGVSYGITDWVTDLGYKKCFISVAFLCFAANFTF 551

Query: 567 IPLYHYGKRARR 578
           + + ++G R R 
Sbjct: 552 LAMVYFGPRLRN 563

>KLLA0D12606g Chr4 complement(1068516..1070297) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|P53389 Saccharomyces
           cerevisiae YNR055C HOL1 Putative ion transporter similar
           to the major facilitator superfamily of transporters;
           mutations in membrane-spanning domains permit
           nonselective cation uptake
          Length = 593

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 136/562 (24%), Positives = 224/562 (39%), Gaps = 27/562 (4%)

Query: 42  PGDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSI 101
           PG+     G         I+L P PS    DPLNW + R+  AL     +    G  T+ 
Sbjct: 19  PGNVHLVDGHDKSDKNAKIVLVPTPSDDPDDPLNWEMKRKLLALSCSLVYTLGVGVPTAA 78

Query: 102 LAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXX 161
           + +    ++++   SLS ++               +  P A+ +GKR VY+         
Sbjct: 79  IYSVLNDVSIQTGISLSQLNNATGYLFLFLGIGCFVFQPLALQYGKRPVYVFTMLATALI 138

Query: 162 XXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXX 221
                 +++    + S++V G   + IESLP  TV++++F H+R+  L  Y         
Sbjct: 139 CVWPPYTKSKGEWIGSKVVQGFFGAAIESLPEITVSDLFFEHQRSSGLATYGVTLLFASY 198

Query: 222 XXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIAR 281
                A F+ +     W+ W   I   V  +    F+ ET +DR    + R+ +   + R
Sbjct: 199 IAPCIAGFISDGQSWEWVMWWCAIFAAVCTVFLFFFMEETNYDRKLKIDSRTGQPITMDR 258

Query: 282 AADGARDVAISGYSAPK-----FQGEEDAXXXXXXXXXXXXXVT---PTQSHRYLSRVRT 333
             DG   V  + +SA          E +              VT   P   H  LS   +
Sbjct: 259 H-DGT--VVSNVFSATANIDTLLNKENNHINVDETSSDSVGGVTGDVPDVLHSVLSAENS 315

Query: 334 KIKCSNIAQSHLVTGLGIFHGRHSVDKWIMV---------------MLRPFVLFCYPAVL 378
            I  + +++  +V G  +   + +   W  +                + PF LF  P +L
Sbjct: 316 NIM-NQLSRVEVVDGATVQQRKSTKTFWSKLSMTSGAKEKFLLHHYFMAPFYLFGLPGIL 374

Query: 379 FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDK 438
           +  F Y  +++W  ++      +   PPY+FSS   GL Y SP + S +     G  SD 
Sbjct: 375 WAGFFYGQSLIWFNVLNATEVLILAAPPYNFSSTACGLAYFSPLIFSFIVFFLVGTFSDW 434

Query: 439 MVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGS 498
           +    A+   G+  PE RL+ V+          + +G  A     W      LG++G  S
Sbjct: 435 LKVRIARYRGGLSLPEDRLYTVIIYCFIGVAACILWGVGAYYEIHWFGLVFGLGMLGGCS 494

Query: 499 SLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCV 558
               T + T+ +D YK    EA+V + +++NVM FA SF  TK+    G K  FI    +
Sbjct: 495 MFGITISTTYAIDCYKELDTEAMVVVIIIRNVMSFAVSFGITKWIENLGLKNAFISAAFI 554

Query: 559 ELIVCLFAIPLYHYGKRARRWT 580
            L   L  + +  +G   R  T
Sbjct: 555 LLACNLTFVGMVIWGPGLRNRT 576

>SAKL0D02508g Chr4 (197981..199720) [1740 bp, 579 aa] {ON} similar
           to gnl|GLV|KLLA0D12606g Kluyveromyces lactis
           KLLA0D12606g and weakly similar to YNR055C
           uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
           Putative ion transporter similar to the major
           facilitator superfamily of transporters; mutations in
           membrane- spanning domains permit nonselective cation
           uptake
          Length = 579

 Score =  126 bits (317), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 118/482 (24%), Positives = 198/482 (41%), Gaps = 27/482 (5%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSAT 195
           ++  P A+ +GKR VYL               ++     +AS+I+ GL  +TIESLP  +
Sbjct: 104 LVFQPLALQYGKRPVYLFSMLATTMICVWPPYTKTNGEWIASKILQGLFGATIESLPEIS 163

Query: 196 VAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHV 255
           +++++F HER+  L  Y              A F+ +     W+ W  +I   V F+L  
Sbjct: 164 MSDLFFEHERSLGLSLYGLTLLAASYLAPVLAGFISQGQGWEWVMWWCSIFGAVCFVLLF 223

Query: 256 LFVPETFWDRT---------PVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
             + ET ++R          P+  +      +   +     D A+   S+   + E    
Sbjct: 224 FLMEETNYERKVKIDSTTNKPITMDSHQGVVSGIFSNTNQIDAAMDSSSSQVEKNEIQLD 283

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLV----TGLGIFHGRHSVDKWI 362
                             H   S V      S + Q          L +F+G        
Sbjct: 284 IADKNQLTSVASAENANIHNQTSNVEVVDLDSYVPQKTTTRTFREKLSLFNGAKKKFLLH 343

Query: 363 MVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPF 422
              + PF +  +P VL+  FLY  ++VW  ++      +    PY FSS   G+ Y+SP 
Sbjct: 344 HYAIAPFYMARFPVVLWAGFLYGSSLVWFNVLNATAALILSGTPYEFSSSMCGVAYLSPT 403

Query: 423 VGSILGSLCAGPLSDKM-VRHFAKKSCGIYEPEFRL-----FMVLPAGLSTALGLMGFGW 476
           + S+L    AG  SD + VR    +  G+  PE RL     + VL  G S    L G G 
Sbjct: 404 IFSLLFFYLAGFCSDWLKVRIAVWRGNGLSLPEDRLWVLCVYCVLGCGASI---LWGVGA 460

Query: 477 SAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
             + H  W    + +G++G        ++ T+ VDSYK    EA+V + +++N M F  S
Sbjct: 461 YYEIH--WFGLIVGMGMLGGCGIFGIASSTTYVVDSYKELDAEAMVVVILIRNCMSFGVS 518

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHS 596
           +  T + +  GYK  FI    + L+  L  + + + G    +W + +  + +S V++   
Sbjct: 519 YGITDWVMNLGYKKCFISVAFISLLCNLTFLVMVYTGP---KWRNKQKAMYWSLVERYRK 575

Query: 597 RG 598
            G
Sbjct: 576 LG 577

>Ecym_2679 Chr2 complement(1313694..1315403) [1710 bp, 569 aa] {ON}
           similar to XP_002551481 Lachancea thermotolerans
          Length = 569

 Score =  114 bits (286), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 119/523 (22%), Positives = 212/523 (40%), Gaps = 4/523 (0%)

Query: 42  PGDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSI 101
           PGD       V    K  ++LNP PS    DPLNW   R+  A+  V  +       T+ 
Sbjct: 12  PGDSYLVQRSVEDEDKNKVVLNPTPSDDPDDPLNWEFRRKWLAVVCVLAYTLGVVVPTAA 71

Query: 102 LAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXX 161
           + +    +      SL  +++             ++  P A+ +GKR VYL         
Sbjct: 72  IYSVLTSIEQSTDISLEKLNHGTGYMFLFLGLGGLVFQPLALQYGKRPVYLFSMLSTAAI 131

Query: 162 XXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXX 221
               +  +  +  + S+I+ G   S IESLP  T+++++F HER+  L  Y         
Sbjct: 132 CLWPSFIKTNDMWIVSKILQGFVGSPIESLPEITMSDLFFEHERSLGLSLYALMLLVGSY 191

Query: 222 XXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIAR 281
                + FV +     W+ W   ++    F+    F+ ET ++R    N ++ R    A 
Sbjct: 192 LAPAVSGFVSDSESWRWVMWGCAVLDVFCFIFLFFFMEETNYNRVLKINGKTNRLIIPAI 251

Query: 282 AADGAR---DVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCS 338
             + +     +  +G S      EE                        +  V +  +  
Sbjct: 252 HQNNSNVVIQLCTAGRSDGSLSSEEQKEPIAATNLEQPNGFAVFNQASDVVVVSSDYEPK 311

Query: 339 NIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQII 398
             ++S   + L +  G+          + PF++  +P VL+  FLY  +++   ++    
Sbjct: 312 YTSKS-FYSKLSLISGKKPKFLLHQYFIMPFLMCRFPIVLWAGFLYGTSLISFNVMNATG 370

Query: 399 NTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLF 458
             +    PY+F +   GL Y+SP + S++    +G  SD++    A    G    E RL+
Sbjct: 371 ALILTGVPYNFETNIFGLAYISPTIFSLILFYISGYFSDQLKIRIAVWRGGKSLAEDRLW 430

Query: 459 MVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQ 518
           +++P  L      + +G  A+    W    I +G++G        T+ T+ VD YK  A 
Sbjct: 431 VLIPYVLLGFFACILWGVGAEHKIHWSGLVIAMGILGGCGIFGIVTSTTYIVDCYKELAT 490

Query: 519 EALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
           EA+V + +++N+M F  S+  T +    GYK  FI    + L+
Sbjct: 491 EAMVVVILIRNLMSFGISYGITSWVQNMGYKKCFIALAFISLV 533

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/535 (19%), Positives = 211/535 (39%), Gaps = 47/535 (8%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V ++ ++G++ N       +D   +P   +   + ++ +   +G   TSI+      L  
Sbjct: 80  VPRSERRGLLANLAIIPEYKDSREYPRHLKSFIVLIIAYGAVMGPMGTSIIFPAIGPLVA 139

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           +F  S   +   V           I  S  + I G+R VY++            A+S N 
Sbjct: 140 DFDTSTIMVDVSVGIYLLSLGIFPIWWSSLSEIEGRRTVYVLSFTLLTAFTIGSALSPNI 199

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            + +  R++ G   ++++S+ + T+++++   ER   LG+Y               + + 
Sbjct: 200 SAFIVFRMLQGASSASVQSVGAGTISDLFIPEERGKNLGYYYLGTLMAPLLSPIIGALLV 259

Query: 232 EYLDRHWLFWIVTIIVGVNFMLHVLFVPETF-------------------WDRTPVPNER 272
                    W + I+  VN +L  L +PET                     + + + N  
Sbjct: 260 NRWSWRSTQWFMVILAVVNVLLFTLLLPETLRRQDTSAAIAIMLAERKQKLNTSDIENNN 319

Query: 273 SIRETAIARAADGAR--DVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRY--- 327
                A A   D  +  D      +A +++ +E+              +       Y   
Sbjct: 320 GTTIDAEAELPDQNQVDDARFLEEAASQYESQEELKKIRSHTSTICTNIPENNDAVYDTH 379

Query: 328 ---LSRVRT-------KIKCSNI--AQSHLVTGL-GIFHGRHSV-DKW-------IMVML 366
              LS++RT       +I+ +++   Q+ L   +  I   +H+  D+W       ++  L
Sbjct: 380 VPQLSKIRTHDTKIEERIRQNDLLRVQTQLQNEVEKIESSKHTTSDRWKEELYVYLVKPL 439

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
           +      YP V       +++   L +V   I   Y  PPY+F  + IGL+Y+   V  I
Sbjct: 440 KSLHFLAYPPVTLAIIFSAISFAILYVVNMTIEYCYTRPPYNFKPLYIGLLYIPNSVTYI 499

Query: 427 LGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAWI 485
           + S+  G   D +++ + K+  GI  PE R+ + V+ A ++  +GL+ FGW     + W+
Sbjct: 500 IASIYGGRWVDNLLKKY-KEMHGIISPEARIGWNVVVAVVTFPIGLLVFGWCLDKKEHWV 558

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNT 540
            P +   + GF S +     +++ VDS        +   N+++ ++     F  T
Sbjct: 559 TPLVGTAIFGFASMMTIGATVSYLVDSLPGRGATGVALNNLIRMILAATSVFITT 613

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score =  101 bits (252), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 122/587 (20%), Positives = 226/587 (38%), Gaps = 59/587 (10%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V +  ++G++ +       +DP ++P   +   + ++ +   +G   TSI+      +  
Sbjct: 59  VPRKERRGLLAHLSIIPEFKDPRDYPASIKKLIVLIIAFSSLMGPMATSIVFPAINPITE 118

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
               +   ++  V           +  S  + + G+R VY+V            A+S N 
Sbjct: 119 SLDTTTFMVNISVGVYSLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGFCIGAALSPNI 178

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            S +  R++ G   ++++S+ + TV+++Y   +R   LG Y              AS + 
Sbjct: 179 SSFIILRVLCGAASASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPIIASGLV 238

Query: 232 EYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD--------------RTPVPNERSIRET 277
                    W + I+ G + +L V F+PET                 R    N+    E 
Sbjct: 239 TRWSWRSTQWFMVILAGFDVLLLVFFLPETLRKQDSKAAIAAILLERRNHNANKNPGIEA 298

Query: 278 AIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP---------------T 322
            +   AD + D   S  S+    GEED               T                +
Sbjct: 299 TVDLVADHSNDNE-SKESSNDGDGEEDLRRMLTDASSRHNYPTADHNIDVGAPQISRIQS 357

Query: 323 QSHRYLSRVR------------TKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPF- 369
           Q  R+ SR+R             ++  +   +S L   +G    R  +++  +  +RP  
Sbjct: 358 QDPRWESRMRDYDLARMRTNLENELAKTETQKSRLTDSVGRSKKRIIMNQCYIHFIRPMK 417

Query: 370 -VLFC-YPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSIL 427
            V F  YP VL      +++   L  V   I   Y   PY+F  + +GL+Y+   V  I+
Sbjct: 418 SVYFLKYPPVLMAIIFSAISFSVLYFVNMTIEYDYSRSPYNFKPLFVGLLYIPNSVTYII 477

Query: 428 GSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLST-ALGLMGFGWSAQAHDAWIA 486
            ++  G   D +++ + K   GI  PE R+   L   ++   + L+ FGW       W+ 
Sbjct: 478 AAIYGGKWVDSLLKRY-KVKYGILAPEARISWNLVTAVAIFPVSLLIFGWCLDKKCHWVT 536

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK- 545
           P I   + GF S +     +++ VDS        +   N+++ ++  A + F T+  +K 
Sbjct: 537 PLIGTALFGFASMMTIGATVSYLVDSLPGRGATGVALNNLVRQILA-AVAVFVTEPMLKG 595

Query: 546 --SGYKTT---FIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLD 587
             +G+  T   FI+ G   +++      L  YG   R   D + L D
Sbjct: 596 MGTGWAFTMLAFIIIGSSSVLLI-----LKRYGDHWRENYDLQKLYD 637

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 136/617 (22%), Positives = 231/617 (37%), Gaps = 54/617 (8%)

Query: 8   QQPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTT-------KKGI 60
           Q  ++N  +GS G           V   +A   G  + AP+  G+  ++       ++G+
Sbjct: 22  QPSRSNSHAGSPGYEK--------VQPLYAAENGSTETAPTATGLFDSSHVVPVSQRRGL 73

Query: 61  ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI 120
           +         RD   +P   +   L +V + C +G   TSI+      +  +F  S   +
Sbjct: 74  LSRLALVPEFRDARLYPPRVKKLILVIVAFACILGPMGTSIIYPAIGTIMQDFGTSRFLV 133

Query: 121 SYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIV 180
           S  V           I  S  A   G+R VY++            A S+N E+ +  RI+
Sbjct: 134 SVSVGTYLAALGIFPIWWSSLADKNGRRTVYVLSFALLVVFSVGTAFSRNIETFIILRIL 193

Query: 181 SGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLF 240
            G   ++++S+ + T+A++Y   ER   LG+Y              +S +          
Sbjct: 194 CGAASASVQSVGAGTIADLYVPEERGRNLGYYYLGPLMAPLLSPIVSSLLVNRWSWRSTQ 253

Query: 241 WIVTIIVGVNFMLHVLFVPETFWDRTPVPNE---RSIRE-------TAIARAADGA---- 286
           W + I+  + F+L V  +PET   RT    E   R +RE       +A A  AD A    
Sbjct: 254 WFMVILAALTFLLLVFALPETL--RTQDNKELVARILRECRKQGSASAPATPADSALPPS 311

Query: 287 -----RDVAISGYSAPKFQGE-EDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNI 340
                 D+A    +A     +  D                P+ S  + S  R + +    
Sbjct: 312 LHSTHADLASLDSAAADLASQLTDTVALYDAQRNFVDLGAPSLSRIHSSNPRVEGRILQQ 371

Query: 341 AQSHLVTGLGIF--------HGR--HSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVW 390
            +  L TGL           H R    +  +++  LR      YP VL  A LY+ A   
Sbjct: 372 DRERLRTGLERAISQQAPRPHQRLARELHFYLLRPLRSLYFLRYPPVLL-AVLYNGACFA 430

Query: 391 LIMVAQI-INTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCG 449
            + V  + I   Y   PY+   + +GL+Y+      I  ++  G   D ++R + ++  G
Sbjct: 431 AVYVVNLTIEYCYSRDPYNMRPLYLGLLYIPNAATYIFSAIYGGRWVDALLRRYTRRH-G 489

Query: 450 IYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITF 508
           +  PE RL + V  A     L L+  GW       W  P I     G  + L       +
Sbjct: 490 VGVPEARLSWNVALAAALLPLSLLAIGWPLHCKAPWPVPLIGTAFFGLAAMLIIGAITAY 549

Query: 509 TVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIP 568
            VDS        +   N+++ ++     F       + G   T  ++    L+VC   +P
Sbjct: 550 LVDSLPARGATGVALNNLIRMLLAAVCVFVLDAMLHRMGPGWTMTLFAA--LLVC-SGLP 606

Query: 569 LYHYGKRARRWTDSKGL 585
           LY   +++  W +   L
Sbjct: 607 LYILKRKSSYWREHYDL 623

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 114/555 (20%), Positives = 210/555 (37%), Gaps = 64/555 (11%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +D  ++P   +   +FV+ +   +G   TSI+      +  ++  +   ++  V      
Sbjct: 112 KDARDYPPHIKKFIVFVIAFSSMMGPMATSIVYPAIDPIKEDYKTTSIMVNVSVGVYQIS 171

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  S  + + G+R VY++             +S N    +  R++SG   ++++S
Sbjct: 172 LGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNVGTGLSPNINDFIILRVLSGGAAASVQS 231

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + + TVA++Y   ER   +G Y               + +          W + I+ GVN
Sbjct: 232 VGAGTVADLYVPEERGTNIGIYYMGPLMAPLVSPIIGAALVSGFPWKSTQWFMVILSGVN 291

Query: 251 FMLHVLFVPETFWD--------------RTPVP-----------------NE--RSIRET 277
            +L VLF+PET                 R   P                 NE   SI + 
Sbjct: 292 VILLVLFLPETLRKQDSGAAITAILQARRKGSPGVNANQTEDKSGYQTQYNEDTHSISDP 351

Query: 278 AIA-----RAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVR 332
           +IA       AD  R ++ +  S  +F    D                P Q  + L    
Sbjct: 352 SIATHEHGNDADLERVLSRTSNSMTRFNSNND-LDPIAPQLSKIHSYDPRQ-EQMLREYE 409

Query: 333 TKIKCSNIAQ--SHLVTGLGIFHGRHSVDK---------------WIMVMLRPFVLFCYP 375
            K   +N+ +  S + T       R   DK               +++  L+      YP
Sbjct: 410 AKRVENNLEEELSRMETAKSNHTARSDGDKIEQTRFQKYRHLAYLYLIRPLKSLYFLEYP 469

Query: 376 AVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPL 435
            VL      +++   L  V   +   Y  PPY+FS + IGL+Y+   V  +L S+  G  
Sbjct: 470 PVLLAITFSAISFAVLYFVNMTLEYGYSRPPYNFSPMLIGLMYIPNSVTYLLASVFGGMW 529

Query: 436 SDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVV 494
           +D ++  + K   G   PE R+ + ++ A ++  + L+ FGW     + W  P +   + 
Sbjct: 530 TDNLLLKY-KAKHGEMVPEARISWNIVTAVIAFPISLLIFGWCLDKGEHWETPLVGTALF 588

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF--NVKSGYKTT- 551
           G+ + +     +++ VDS        +   N+++ V+  A  F       N+  G+  T 
Sbjct: 589 GYANMMTIGATVSYLVDSLPGKGATGVALNNLVRQVLAAAAVFVTDPMLDNMTIGWSFTM 648

Query: 552 --FIVYGCVELIVCL 564
             FI+ G   ++V L
Sbjct: 649 LAFIIIGATSVLVVL 663

>Ecym_4506 Chr4 complement(1013521..1015467) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ACL172C
          Length = 648

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 109/563 (19%), Positives = 218/563 (38%), Gaps = 40/563 (7%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V  + ++G++         +D   +P   +   +F V + C +G   T+I+      +  
Sbjct: 77  VSHSKRRGLLSKVTLIPEYKDARKYPKTTKGFIVFFVAFACSMGPMGTNIIYPVLVPIEK 136

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           EF+ +   +S  +           +  S  +   G+R VY+V            A+S++ 
Sbjct: 137 EFNTTPFMVSLSMGIYLAFLGLLPLWWSSFSERKGRRSVYVVSFTLTLVFTIGAALSKDI 196

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            + +  R++ G   ++++S+ + T+A++Y   ER   LG++               S + 
Sbjct: 197 TTFIVLRMLCGASSASVQSVGAGTIADLYIPEERGRSLGYFYLGPLLCPLIAPIVGSILV 256

Query: 232 EYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAI 291
            +       W + I+ G N +L V F+PET   +        I +  + R A+ +     
Sbjct: 257 NFWSWRSTQWFLVILAGANIVLIVCFLPETLRTQDNKAIIAKILQEKLKRNANTSELGGS 316

Query: 292 SGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSH--------RYLSRVRTKIKCSNIAQ- 342
           +   + + +G  +A             V    +H        R        + CS+  + 
Sbjct: 317 TCDDSSQTEGRRNAIAPNVDLPHSSQDVERIMTHISDSIHIHRDPGVPELSLICSHDPRV 376

Query: 343 -SHLVTGLGIFHGRHSVDKWI---------------------MVMLRPFV---LFCYPAV 377
             +++ G  +   R +V+K +                     + +L+P        YP V
Sbjct: 377 VGNVLEG-DLQRARSNVEKHLDKLADEGSNVGILKRMGKLGYLYLLQPLNSLHFLRYPPV 435

Query: 378 LFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD 437
                  ++    L  V   I+  Y NPPY+F  + IGL+Y+   +  I+ S+  G L D
Sbjct: 436 FLAIIYSAITFATLYFVNMTISYSYSNPPYNFKPLYIGLLYIPLSLAYIITSIYGGRLID 495

Query: 438 KMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGF 496
           ++++ + +K  G   PE RL + ++ A ++  + L   GW       W  P I   + GF
Sbjct: 496 ELLKRYKEKH-GFLAPESRLSWNMVFAAIAFPISLSICGWCLDKKVHWALPLIGTALFGF 554

Query: 497 GSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYG 556
            S +     +T+ VDS       A+   N+++ ++     F       K G      +  
Sbjct: 555 ASMVTIGAIVTYLVDSLPGKGATAIALNNLVRMLLAAVAVFVTEPMLNKIGPGWALTI-- 612

Query: 557 CVELIVCLFAIPLYHYGKRARRW 579
            +E+I+ +  + L     R+  W
Sbjct: 613 -LEIIISVGGLSLIILKSRSDYW 634

>Kwal_33.15020 s33 (919334..921127) [1794 bp, 597 aa] {ON} YGR138C
           (TPO2) -  [contig 96] FULL
          Length = 597

 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/510 (18%), Positives = 187/510 (36%), Gaps = 66/510 (12%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            DP NWP  ++     ++G  CF     ++I+       A  F  S+  +   V      
Sbjct: 110 EDPRNWPTRQKWNYTILLGIICFDVAMMSAIITGDMDSPAAYFGVSMEVMCLCVSLMVWG 169

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  +P +  FG+  VYL+           C  ++N  +LLA R + GL  S    
Sbjct: 170 FGIGPMFFAPLSEEFGRNPVYLITLLIAVVFIVPCGAAKNIGTLLAFRFLDGLAFSAPMC 229

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           L   ++++++   ER   +  ++              S +  Y    W++W + I+ G  
Sbjct: 230 LIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVYCSWRWVYWFMVILSGCL 289

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXX 310
           + +  +F+PET              +T + + A   R+                      
Sbjct: 290 YAVMAVFMPETH------------HQTLLKKRAKKLRE---------------------- 315

Query: 311 XXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFV 370
                   +T   S+R LS ++ +     + ++ L   +            ++  L  F+
Sbjct: 316 --------ITGDPSYRALSEIKVRSINEIVKETALRPAI------------LLTELIVFL 355

Query: 371 LFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSL 430
           +  Y +V++G       ++++   A  +    G     F  ++  ++++   VG I  ++
Sbjct: 356 ITMYMSVIYG-------LLYMFFFAYPMVYTEGK---HFGPVKTSIMFIPIGVGVICSTV 405

Query: 431 CAGPLSDKMVRHFAK--KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPT 488
            A  L++  ++   +      I   E RL  ++        GL  + WS+    +W  P 
Sbjct: 406 IAPFLNNDYLKRAQRYLDRGEIPPAELRLIPMMIGCWFVPAGLFSYAWSSFPRLSWAGPC 465

Query: 489 IFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGY 548
                 G G ++    A  + VDSY+ YA   L     ++++ G A   F  +   +  Y
Sbjct: 466 FSGFACGLGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFTIQMYHRLNY 525

Query: 549 KTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           +    +   + L  C      Y YG R R+
Sbjct: 526 EWASTLMAFISLACCAIPYLFYFYGARIRQ 555

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 109/450 (24%), Positives = 183/450 (40%), Gaps = 64/450 (14%)

Query: 146 GKRIVYLVXXXXXXXXXXXCA-VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++I+Y++            A V +   SL+  RI+     S++ SL + TVA++    +
Sbjct: 143 GRKILYIISISLMVIINILLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKD 202

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRH---WLFWIVTIIVGVNFMLHVLFVPET 261
           R   + ++              A  +   LD +   WLF  + I+ G+  ++ +L +PET
Sbjct: 203 RGKAMAYFMLGPNLGPILAPIIAGLIL--LDNNNWRWLFGFLCIVSGLGLIMVILLLPET 260

Query: 262 FWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP 321
                              R   G  D     +S    Q E D                 
Sbjct: 261 L------------------RCIVGNGDRQWENWS----QNENDMS--------------- 283

Query: 322 TQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHG------RHSVDKWIMVMLRPFVLFC-- 373
           TQ   + S +      S+I   + +T   IF G      + SV  ++ +M  P V+    
Sbjct: 284 TQPVDFSSPISRWSFVSDIGFLNPITQDSIFKGLYPHPPKFSVWTYLRIMTFPPVILTSI 343

Query: 374 YPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAG 433
             A+LF  + YS+++     ++  + T      YS+S+++IG  YV P V  +LGS   G
Sbjct: 344 ANALLFCTY-YSISVT----LSHFLAT-----EYSYSNLKIGACYVCPGVCMLLGSQIGG 393

Query: 434 PLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG 492
            LSD M + + K++     P EFRL + +   L    G +G+GW  Q H    A  +F G
Sbjct: 394 HLSDSMRKSWKKENYNTEYPLEFRLILTVCGVLLAIGGSIGYGWCIQFHYHISAVLVFAG 453

Query: 493 VVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTF 552
           ++ FG +  + T +T+  +        A+   +  +N+     S    K   K G    F
Sbjct: 454 LMAFGLTWCNNTIMTYLSELLSLRVSSAIAVSSFFRNIAAAISSALIAKLCQKMGIGFCF 513

Query: 553 IVYGCVELIVCLFAIPLYHYGKRARRWTDS 582
           +  G + L V LF+I L     R +   DS
Sbjct: 514 LGLGLINL-VSLFSI-LVLINNRNKWVKDS 541

>TPHA0E03200 Chr5 complement(677352..679232) [1881 bp, 626 aa] {ON}
           Anc_5.180
          Length = 626

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 100/516 (19%), Positives = 186/516 (36%), Gaps = 70/516 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
              + DP  W    +     ++G  CFV    ++++       A  F  S   I   V  
Sbjct: 138 DDDRDDPRTWDARIKWNITVLLGIICFVVAMMSAVVTGDINAPAAHFGVSEEVIILTVSL 197

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    ++ +P +   G+  +Y             CAV+QN  +LLA R + GL  S
Sbjct: 198 MVWGFGLGPLVFAPLSEELGRNWIYCTTLFVAVIFIIPCAVAQNIGTLLAFRFLDGLAFS 257

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
               +   ++++I+   ER   +  ++              S +  Y    W++  + I+
Sbjct: 258 APMCIIGGSLSDIWRTEERGIAMSIFSAAPFLGPVMGPIVGSLLTVYCGWRWVYIFMIIL 317

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
            G  + +  +F+PET              +T + R A   R          K  G+    
Sbjct: 318 SGCLYAVLFVFLPETH------------HQTILKRRAKKLR----------KLTGD---- 351

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                           QS+R +S ++ +     IA   L+  L              ++L
Sbjct: 352 ----------------QSYRAVSEIKVR-TLKEIANDSLLRPL--------------ILL 380

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
              ++F     ++ A LY L  ++      + +   G     +S I+  ++++   VG +
Sbjct: 381 SELIVFL--VTMYMAILYGLLYMFFFAYPVVYSEGKG-----WSDIKTSIMFIPIGVGVL 433

Query: 427 LGSLCAGPL----SDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHD 482
           +G+    PL     ++  + F  K   I   E RL  ++       +GL  + W++  H 
Sbjct: 434 IGT-AVSPLFNMDYNRRAQRFIDKG-EIPPAELRLIPMMYGCAFVPIGLFCYAWTSFPHV 491

Query: 483 AWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
           +W  P       G G  L    A  + VDSY+ YA   L     ++++ G +   F  + 
Sbjct: 492 SWAGPCFSGFACGLGFVLLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGSVPLFTIQM 551

Query: 543 NVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
             + GY+    +   + L  C      Y YG   R+
Sbjct: 552 YHRLGYEWASTLMAFIGLACCAIPFLFYRYGATIRK 587

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 109/517 (21%), Positives = 191/517 (36%), Gaps = 78/517 (15%)

Query: 67  SKSKRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL- 123
           +    +P NWP+W R   T +  +   C   G   S    G  GL  E     S+++ L 
Sbjct: 162 TNDPDNPHNWPLWLRWVYTVILSILVICVAYG---SACITGGLGLVSEKFHVGSEVAILS 218

Query: 124 VXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGL 183
           V           ++ SP + +FG+R+ Y V           CAVS+N ++L+  R   G+
Sbjct: 219 VSLMVLGFSFGPLLWSPVSDLFGRRVAYFVSMGLYVIFNIPCAVSKNVQTLMICRFFCGV 278

Query: 184 GVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWI 242
             S+   L   ++A+++ +  R   + F+                F+     R   +FW+
Sbjct: 279 WSSSGLCLVGGSIADMFPSETRGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWV 338

Query: 243 VTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGE 302
                GV +++ V  +PETF    PV  +R        RAA   ++        PK   E
Sbjct: 339 NMAFAGVMWLV-VALIPETF---APVILKR--------RAAKLRKETG-----NPKIMTE 381

Query: 303 EDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWI 362
           ++A                             I    + +S  V  L           + 
Sbjct: 382 QEA---------------------------QGISVKELMKSCCVRPL-----------YF 403

Query: 363 MVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPF 422
            V     VL C+   L  A LY+    + ++  ++         Y +    +GL+++   
Sbjct: 404 AVTEPVLVLVCFYVCLIYALLYAFFFAFPVIFGEL---------YGYRDNLVGLMFIPIL 454

Query: 423 VGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHD 482
           +G+ +         +K +    ++      PE RL   +      A+ L   G +A+ H 
Sbjct: 455 IGASMALATTFYCENKYLAITKRRKP---TPEDRLLGAMIGAPFAAIALWMLGATAERHV 511

Query: 483 AWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
            W+ P       GFG  L   +   + +D Y  +A  AL T   L++  G AF  F  + 
Sbjct: 512 IWVGPASSGLAFGFGMVLIYYSLNNYIIDCYAQFASSALATKVFLRSAGGAAFPLFTNQM 571

Query: 543 --NVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
             N+   + +  + +    ++   FA   Y+YGK  R
Sbjct: 572 YHNLGLHWASWLLAFISTAMVAIPFA--FYYYGKTLR 606

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 98/449 (21%), Positives = 172/449 (38%), Gaps = 58/449 (12%)

Query: 146 GKRIVYLVXXXXXXXXXXXCA-VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++ +Y++            A +  N  +L   R++  +G S   SL + TVA+I     
Sbjct: 198 GRKFLYIISLFIFTVANILLASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPKH 257

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFW 263
           R   +  +              A  +    ++  WLF    I  GV  M+ ++ +PET  
Sbjct: 258 RGKSVALFMLGPNMGPIIAPIIAGLILMNSNQWRWLFGFSAICTGVALMIVIVILPETL- 316

Query: 264 DRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ 323
                   R I      + +   R  +    S  KF+G+ +                   
Sbjct: 317 --------RCIVGNNDPKWSRSQRGTSQYNESKEKFEGDRE------------------- 349

Query: 324 SHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRP--------FVLFCYP 375
                  +R +I+  N  + +L + LGI       +++  +  +P          LF YP
Sbjct: 350 ------EIR-EIESLNDPRWNLCSNLGIQKPVSDDEQFKQLYPKPPKPTLKQYGKLFIYP 402

Query: 376 AVLFG----AFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC 431
            +       AFL+S    + +  A  +        Y++  +QIG  Y  P +  ILGS  
Sbjct: 403 PITLVSTSIAFLFSSYYGFSVTFAHFLKE-----DYNYGMLQIGGAYSCPGICMILGSQS 457

Query: 432 AGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIF 490
            G LSD + + + KK+ G   P E RL +     + + +G +G+GWS + H       +F
Sbjct: 458 GGWLSDNLRKRWLKKNEGQNFPIERRLVLQFIGIVLSIIGSIGYGWSIKKHYHIAIVLMF 517

Query: 491 LGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKT 550
            G + FG +  + T +T+  +         +   +  +NV     +  + K   K G + 
Sbjct: 518 SGFLAFGLTWCNNTTMTYLTELIPRRVSGVIAVCSFFRNVGAAVSAAISMKLVDKIGVEW 577

Query: 551 TFIVYGCVELIVCLFAIPLYHYGKRARRW 579
           TF  +G   LI     I L + G   R+W
Sbjct: 578 TFTYFGVCNLIPLFILIVLIYMG---RKW 603

>Kpol_2002.86 s2002 (201096..203006) [1911 bp, 636 aa] {ON}
           (201096..203006) [1911 nt, 637 aa]
          Length = 636

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 105/551 (19%), Positives = 196/551 (35%), Gaps = 68/551 (12%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
              + DP  W   ++     ++G  CF     ++I+       A  F+ S+  I   V  
Sbjct: 139 DDDRDDPRTWTTRQKWNITILLGIICFDVAMMSAIVTGDINSPAKHFNVSIEVICLTVSL 198

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    +I +P +  FG+  +Y             CAV +N  +LLA R + GL  S
Sbjct: 199 MVWGFGIGPMIFAPLSEEFGRNAIYHTTLLVAVIFIIPCAVPRNIGTLLAFRFLDGLAFS 258

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
               L   ++++I+   ER   +  ++              S +       W++  + I 
Sbjct: 259 APMCLIGGSLSDIWRVKERGVAMAIFSAAPFLGPVMGPIVGSLLSVKCGWRWVYIFMIIF 318

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
            G  + +  +F+PET        + ++I +    +      D                  
Sbjct: 319 SGCLYAVAFVFLPET--------HHQTILKKRAKKLRKLTGDA----------------- 353

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                            S+R +S ++ +   S +A+  L+               ++  L
Sbjct: 354 -----------------SYRAISEIKIR-SLSEVAKDSLLRPF-----------ILLTEL 384

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
             F++  Y +V++G  LY     + ++ ++     +G+   S   I IG   V   VG+ 
Sbjct: 385 IVFLVTLYMSVIYG-LLYMFFFAYPLVYSE--GKGWGDIKTSIMFIPIG---VGVLVGTA 438

Query: 427 LGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
           L  +     + +  R+  +    I   E RL  ++       +GL  + W++  H +W  
Sbjct: 439 LSPVFNNDYNRRAQRYIDRGE--IPPAELRLIPMMAGCWFVPIGLFCYAWTSFPHVSWAG 496

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKS 546
           P       G G  L    A  + VDSY+ YA   L     ++++ G A   F  +   + 
Sbjct: 497 PCFSGFACGLGFILLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGACPLFTIQMYHRL 556

Query: 547 GYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVK------KNHSRGST 600
           GY+    +   + L  C      Y YG R R+ +           K      +N S G  
Sbjct: 557 GYEWASTLMAFIGLACCGIPFLFYIYGARIRKRSKYAYSPSIDTTKTTQTDEENGSIGKE 616

Query: 601 GDRHMEDSYQS 611
           G+ + E+   S
Sbjct: 617 GEAYKEEELNS 627

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 101/510 (19%), Positives = 185/510 (36%), Gaps = 72/510 (14%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP+W R T   ++          ++ +  G   +  +FH SL              
Sbjct: 180 NPHNWPLWIRWTYTILLSTLVICVAYGSACVTGGFGTIEKKFHVSLEAAILSCSLMVIGF 239

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               ++ SP + ++G+R+ Y             CA++ N   LLA R + G+  S+   L
Sbjct: 240 SVGPLLWSPVSDLYGRRVAYFFSMGLYVIFNIPCAIAPNLGCLLACRFLCGVWSSSGLCL 299

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVN 250
              ++A+++ +  R   + F+                F+     R   +FW+     GV 
Sbjct: 300 VGGSIADMFPSETRGKAIAFFAYSPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAFAGVM 359

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXX 310
           +++    +PET+    PV  +R        RAA   ++        PK   E++A     
Sbjct: 360 WIISSA-IPETY---APVILKR--------RAAKLRKETG-----NPKIMTEQEA----- 397

Query: 311 XXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFV 370
                                        I  + +++   I   + S+ + ++ M     
Sbjct: 398 ---------------------------QGITFNEMMSACVIRPLKFSITEPVLFMT---- 426

Query: 371 LFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSL 430
             C+   L  + LY+    + ++  ++         Y +    IGL+++   +G+    L
Sbjct: 427 --CFYVCLIYSLLYAFFFAYPVIFGEL---------YGYKDNMIGLMFIPILIGASFAVL 475

Query: 431 CAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIF 490
                  + ++    +      PE RL          A+ L   G +   H  W+AP   
Sbjct: 476 TTFWCESQYLKLVKTRKP---TPEDRLLGAKIGAPFAAIALWMLGATTYNHRMWLAPASS 532

Query: 491 LGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSG--Y 548
               GFG  L   +   + +D Y  YA  AL T   L++  G AF  F T+   K G  +
Sbjct: 533 GMPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQMYHKLGLHW 592

Query: 549 KTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
            +  + + C  +I   FA    +YGK  R 
Sbjct: 593 ASWLLAFICTAMIALPFA--FSYYGKELRH 620

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 102/515 (19%), Positives = 186/515 (36%), Gaps = 72/515 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           +    +P NWP+W R     ++          ++ +  G   +  +FH SL         
Sbjct: 161 TNDPENPHNWPLWIRWCYTILLSTLVICVAYGSACITGGFGTVEEKFHVSLEASILSCSL 220

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    ++ SP + ++G+R+ Y             CA++ N   LLA R + G+  S
Sbjct: 221 MVIGFSVGPLLWSPVSDLYGRRVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSS 280

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTI 245
           +   L   ++A+++ +  R   + F+                F+     R   +FW+   
Sbjct: 281 SGLCLVGGSIADMFPSETRGKAIAFFAYSPYCGPVFGPLVNGFISVSTGRMDLIFWVNMA 340

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDA 305
             GV +++    +PET+    PV  +R        RAA   ++        PK   E++A
Sbjct: 341 FAGVMWIISSA-IPETY---APVILKR--------RAAKLRKETG-----NPKIMTEQEA 383

Query: 306 XXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                                             I  + ++T   +   + SV + ++ M
Sbjct: 384 --------------------------------QGITFNEMMTACVVRPLKFSVTEPVLCM 411

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
                  C+   L  + LY+    + ++ +++         Y +    IGL+++   +G+
Sbjct: 412 T------CFYVCLIYSLLYAFFFAYPVIFSEL---------YGYKDNIIGLMFIPILIGA 456

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWI 485
               L       + ++    +      PE RL          AL L   G +   H  W+
Sbjct: 457 SFAVLTTFWCESQYLKLIKTRK---PTPEDRLLGAKIGAPFAALALWMLGATTYNHRMWL 513

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK 545
           AP       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F T+   K
Sbjct: 514 APASSGMPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQMYHK 573

Query: 546 SG--YKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
            G  + +  + + C  +I   FA    +YGK  R 
Sbjct: 574 LGLHWASWLLAFICTAMIALPFAFS--YYGKELRH 606

>KLTH0G06754g Chr7 (541019..542461) [1443 bp, 480 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 480

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 83/160 (51%), Gaps = 10/160 (6%)

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFA 444
           +LAI+++  +A     V+G+  YSF+++++G+ Y+   VG +L      P S    R +A
Sbjct: 284 TLAIIYMFFIA--FPLVFGSL-YSFTTMELGVSYMGMLVGIVL----VAPTSLWFQRRYA 336

Query: 445 KK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLA 501
           +K   S G   PE R   +      T +GLM F W++ +H  WIAP I   V G G    
Sbjct: 337 QKVINSGGQQVPELRFEPLFYGAFLTPIGLMIFAWTSYSHVHWIAPIIGTAVFGAGVFFV 396

Query: 502 STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
            T    +TVD+++ Y+  A+   + ++++M   F  F T+
Sbjct: 397 FTGVFNYTVDAFRLYSASAMACNSFVRSMMAGVFPLFTTQ 436

>SAKL0G13376g Chr7 complement(1147643..1149508) [1866 bp, 621 aa]
           {ON} weakly similar to uniprot|Q06451 Saccharomyces
           cerevisiae YPR156C TPO3 Polyamine transport protein
          Length = 621

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 99/518 (19%), Positives = 182/518 (35%), Gaps = 74/518 (14%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
              + DP  W   ++     ++G  CF     ++++    +     F  SL  I   V  
Sbjct: 124 EDDRDDPRTWNTRQKWNLTALLGIVCFDVAMMSAVVTGDMESPREYFGVSLEVIILTVTL 183

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    ++ +P +  FG+  VY             C  ++N  +LLA R + GL  S
Sbjct: 184 MVLGFGLGPLVFAPLSEEFGRNWVYHPTLFVAIVFIVPCGAAKNIGTLLAFRFLDGLAFS 243

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
               L   ++++++   ER   +  ++              S +       W++W + I 
Sbjct: 244 APMCLIGGSLSDMWRNKERGVAMSVFSAAPFMGPVMGPIVGSLLSVKCSWRWVYWFMLIF 303

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
               + + V+F+PET              +T + R A   R          K  G+    
Sbjct: 304 SACLYGVMVVFLPETH------------HQTLLKRRAKKLR----------KLTGDP--- 338

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                            S+R +S ++ +      +   +V G                +L
Sbjct: 339 -----------------SYRAISEIKVR------SLKEVVEG---------------TLL 360

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
           RP  L     ++F   LY   I  L+ +      V  +    +  I+  L+++   VG I
Sbjct: 361 RPITLLT-ELIVFLITLYMSVIYGLLYMFFFAYPVVYSEGKHWGDIKTSLMFIPVGVGVI 419

Query: 427 LGSLCAGPLSDKMVRHFAKKSC-----GIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQA 480
               C+  +S  + R + K++      G   P E RL  ++        GL  + WS+  
Sbjct: 420 ----CSTAISPLLNRDYLKRAQRYLDRGEVPPAELRLIPMMVGCWFIPAGLFAYAWSSYP 475

Query: 481 HDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNT 540
           H +W  P       G G ++    A  + VDSY+ YA   L     ++++ G A   F  
Sbjct: 476 HVSWAGPCFSGFACGLGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGAAVPLFTI 535

Query: 541 KFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           +   + G +    +   + L  C      Y +G R R+
Sbjct: 536 QMYHRLGNQWATSLMAFISLACCAIPYAFYIFGARIRK 573

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 106/483 (21%), Positives = 182/483 (37%), Gaps = 89/483 (18%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           +P +  +G+ IV  +              + N+ +++ +R + GL  +   S+    VA+
Sbjct: 115 APWSEEYGRWIVMQLSLLFSNIWQILGGKAPNFGAIIVARGLCGLSQAG-GSVTLGVVAD 173

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           ++   E  Y + +                  + E+L  HW FWI  I  GV+ +LH   V
Sbjct: 174 LWDPSEHGYAVAYIVLASVGGSVLGPVFGGLMQEHLSWHWNFWIQLIFNGVSQILHFFLV 233

Query: 259 PETFWDRTPVPNERSIRETAIA-RAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXX 317
           PET             R T +  R A   R+     Y                       
Sbjct: 234 PET-------------RATILVNREAKRRRNTGEDPYC---------------------- 258

Query: 318 XVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLF-CYPA 376
              P+++HR                     GL     R  +  W     RPF +F C P 
Sbjct: 259 -YGPSENHR--------------------IGL-----RELLVTWA----RPFYMFLCEPI 288

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAG--- 433
           VLF + L   A   + +  Q    ++    + FS    GL+++S  +  ++G L      
Sbjct: 289 VLFCSLLSGFADHLIFICNQAFTPIFKQ--WGFSPTSQGLIFLSMVIAYLIGWLLHCFDI 346

Query: 434 PLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA--HDAWIAPTIFL 491
               K +    +   G   PE RL ++L      ++GL GF W++    +  WIAP IF 
Sbjct: 347 SFQMKKIDQILRSPRG---PERRLLLLLFLAPLLSIGLFGFAWTSMGPEYTPWIAPAIFS 403

Query: 492 GVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTT 551
            V+G  +       I + V +Y  YA  A     + ++V+    + + T      G+K  
Sbjct: 404 SVIGIANYSIYIATIDYMVAAYGPYASSATGGNGMARDVLSGIAAMYATPLYDNIGHKFH 463

Query: 552 F----IVYGCVELIVCLFAIPLYHY-GKRARRWTDSKGLL--DFSYVKKNHSRGSTGDRH 604
           +     + GC+  I+C   I ++++ G   R+ +     L  DF   KKN    ++   H
Sbjct: 464 YQWASTLLGCLG-ILCTVPIYIFYWKGPEIRKKSKFAQELSADFDEQKKNR---TSDIPH 519

Query: 605 MED 607
           ++D
Sbjct: 520 LDD 522

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 106/455 (23%), Positives = 176/455 (38%), Gaps = 80/455 (17%)

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
            ++ N+ +++ +R + G+ ++   S+    VA+++   +  Y + F              
Sbjct: 144 GLAPNFGTIIVARFLGGMSLAG-GSVTLGVVADMFDPIDHGYAVAFIVLSSVCGSVIGPI 202

Query: 226 XASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADG 285
               + E+L  HW FWI  I  GV  +LH   VPET   R+ V  +R  +     R  + 
Sbjct: 203 FGGLMQEHLSWHWNFWIQLIFNGVAQILHFFIVPET---RSSVLVDREAK-----RRRES 254

Query: 286 ARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHL 345
             D  I G       GE+                                          
Sbjct: 255 GEDPTIYG------PGEDKKMD-------------------------------------- 270

Query: 346 VTGLGIFHGRHSVDKWIMVMLRPFVLF-CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGN 404
                 FH  H    W+    RPF +F C P VLF + L   A   + +  Q    ++  
Sbjct: 271 ------FH--HVFTTWV----RPFHMFVCEPIVLFCSLLSGFADHLIFICNQSFGPIFMQ 318

Query: 405 PPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAG 464
             + FS    GL++++  +G +L  +          R   K +     PE RL ++L   
Sbjct: 319 --WGFSITAQGLIFIAVLIGYLLAYVFHVVDVFYQKRDVEKIANSPRGPERRLLLLLYLV 376

Query: 465 LSTALGLMGFGWSAQ--AHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALV 522
              A+GL GF W++   A+  WIAP IF  ++G  +       I + V +Y  YA  A  
Sbjct: 377 PWLAIGLFGFAWTSMGPAYTPWIAPAIFAALIGIANYSIYMATIDYMVAAYGPYASSATG 436

Query: 523 TLNVLKNVM-GFAFSFFNTKFNVKSG---YKTTFIVYGCVELIVCLFAIPLY-HYGKRAR 577
              + ++V+ G A  + N  ++   G   Y+    + GC+  I+C   IP+Y  Y K   
Sbjct: 437 GNGLARDVLSGIAAMYANPLYDNIGGKFHYQWASTLLGCLA-ILC--TIPIYIFYWKGPE 493

Query: 578 RWTDSKGLLDFSYVKKNHSRGSTG-DRHMEDSYQS 611
               SK   + S   ++  RG  G D+    S++S
Sbjct: 494 IRDKSKFAQELSQTFED-DRGHRGLDKAGRPSFES 527

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 100/511 (19%), Positives = 187/511 (36%), Gaps = 74/511 (14%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +P NWP+W R     ++          ++ +  G   ++ +FH S  ++S L       
Sbjct: 190 ENPHNWPLWLRWVYTILLSILVIAVAYGSACITGGLGTVSDKFHVS-QEVSILTCSLMVL 248

Query: 131 XXXXS-IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIE 189
                 +I SP + + G+R+ Y +           CA++ N   LLA R + G+  S+  
Sbjct: 249 GFSLGPLIWSPVSDLLGRRVAYFISLGLYVIFNIPCALAPNIGCLLACRFLCGVWSSSGL 308

Query: 190 SLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVG 248
            L   ++A+++    R   + F+                F+    +R   +FW+     G
Sbjct: 309 CLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNGFISVATNRMDLIFWVNMAFAG 368

Query: 249 VNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXX 308
           V +++ V  +PETF    PV  +R        RAA   ++        PK   E++A   
Sbjct: 369 VMWII-VALIPETF---APVILKR--------RAARLRKETG-----NPKIMTEQEA--- 408

Query: 309 XXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRP 368
                                     +    + Q  L+  L +      +D         
Sbjct: 409 ------------------------QGLSVREMVQDCLLRPLYLAVTEPVLD--------- 435

Query: 369 FVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILG 428
             L C+   L  + LY+    + ++  ++         Y +    IGL+ +   +G+ + 
Sbjct: 436 --LMCFYVCLIYSLLYAFFFAYPVIFGEL---------YGYKDNLIGLMLIPILIGASVA 484

Query: 429 SLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPT 488
                   ++ ++   ++      PE RL   +      A+ L   G +A  H  W+ P 
Sbjct: 485 LATTTFCENQYIKITRRRKP---TPEDRLLGAMIGAPFAAIALWILGATAYKHIIWVGPA 541

Query: 489 IFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSG- 547
                 G+G  L   +   + +D Y  YA  AL T   L++  G AF  F  +   K G 
Sbjct: 542 SSGLAFGYGMVLIYYSLNNYIIDCYAVYASSALATKVFLRSAGGAAFPLFTEQMYHKLGL 601

Query: 548 -YKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
            + +  + +    ++   FA   +H+GK  R
Sbjct: 602 HWASWLLAFISTAMVAIPFA--FFHWGKDLR 630

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 103/513 (20%), Positives = 181/513 (35%), Gaps = 70/513 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           +   ++P NWP+W R     ++          ++ +  G   ++ +FH S  ++S L   
Sbjct: 182 TNDPQNPHNWPLWLRWVYTILLSILVIAVAYGSACITGGLFTVSDKFHVS-QEVSILTCS 240

Query: 127 XXXXXXXXS-IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                     +I SP + +FG+R+ Y V           CA++ N   LL  R + G+  
Sbjct: 241 LMVIGFSLGPLIWSPVSDLFGRRVAYFVSLGLYVIFNIPCALAPNIGCLLVCRFLCGVWS 300

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVT 244
           S+   L   ++A+++    R   + F+                F+     R   +FW+  
Sbjct: 301 SSGLCLVGGSIADMFPPETRGRAIAFFAYAPYCGPVFGPLVNGFISVSTHRMDLIFWVNM 360

Query: 245 IIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEED 304
              GV +++ V  +PETF    PV  +R        RAA   R+        PK   E++
Sbjct: 361 AFAGVMWLV-VACIPETF---APVILKR--------RAAKLRRETG-----NPKIMTEQE 403

Query: 305 AXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMV 364
           A             + P     YL+     +                             
Sbjct: 404 AQGLSVGEMVNACVLRPL----YLAVTEPVLD---------------------------- 431

Query: 365 MLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVG 424
                 L C+   L  + LY+    + ++  ++         Y +    IGL+ +   +G
Sbjct: 432 ------LMCFYVCLIYSLLYAFFFAYPVIFGEL---------YGYKDNLIGLMLIPILIG 476

Query: 425 SILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAW 484
           + + +L      +       K+      PE RL   +      A+ L   G +A  H  W
Sbjct: 477 ASV-ALATTSFCETQYLKITKRRNP--TPEDRLLGAMIGAPFAAIALWILGATAYHHIIW 533

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNV 544
           + P     V G+G  L   +   + +D Y  YA  AL T   L++  G AF  F  +   
Sbjct: 534 VGPASSGLVFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTEQMYH 593

Query: 545 KSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
           K G +    +   +   +       Y+YGK  R
Sbjct: 594 KLGLQWASWLLAFISTAMVAIPFAFYYYGKGLR 626

>KAFR0J00480 Chr10 (84206..85708) [1503 bp, 500 aa] {ON} Anc_5.284
           YHR048W
          Length = 500

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 97/461 (21%), Positives = 171/461 (37%), Gaps = 88/461 (19%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSAT 195
           +  SP + ++G+RI ++               S   E ++  R +SG   S+  S+   T
Sbjct: 113 LFLSPISELYGRRITFIFSLVLSMIFQCLTTWSATIEGVMFGRFLSGFFGSSFLSVAGGT 172

Query: 196 VAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHV 255
           +++++  ++    + F+T             +  ++  ++  W F +  I  GV F+L +
Sbjct: 173 ISDLFDKNQITVPMTFFTTAGLLGPSLGPLISGAMYT-VEYRWTFVLFLISSGVCFVLII 231

Query: 256 LFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXX 315
           L VPET+     +   + +R +                                      
Sbjct: 232 LTVPETYQPSLLIAKAKRLRNS-------------------------------------- 253

Query: 316 XXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPF-VLFCY 374
                 T   RY + +    K +N+  +  +T                   RPF +LF  
Sbjct: 254 ------TGEDRYYAPLEITRKETNLLSAMFLT-----------------CRRPFGLLFRD 290

Query: 375 PAVLFGAFLY----SLAIVWLIMVAQIINTVYGNPPYSFSSI-QIGLV-YVSPFVGSILG 428
           P  + G   +     LAIV+L  VA          PY+F ++ + G++     ++G + G
Sbjct: 291 P--MMGVLCFYTGVELAIVYLFFVAF---------PYTFKTLYKFGVMEQACAYIGLMCG 339

Query: 429 SLCAGPLSDKMVRHFAKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWI 485
            L A P +    + F K+   + G+  PE R   +      T +GLM F W+  ++  WI
Sbjct: 340 MLFAAPTAVLFQKRFEKRVANNGGVSVPEMRFEPLFYGAFLTPIGLMIFSWTCYSNVHWI 399

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK 545
            P I   V  FG          +TVD+YK YA   L     ++ +M   F  F  +    
Sbjct: 400 GPIIGSAVFSFGLLYVFVGIFNYTVDAYKKYAASGLACNTFVRCIMAGVFPLFGLQMYEG 459

Query: 546 SG--YKTTFIVYGCVELIVCLFAIPLYHYGKRARR---WTD 581
            G  + +  +    V +I   F    Y    RA+    WTD
Sbjct: 460 MGINWASFLLTMITVLMIPVPFIFTKYGASLRAKSPYAWTD 500

>Kpol_1051.15 s1051 (29969..31474) [1506 bp, 501 aa] {ON}
           (29969..31474) [1506 nt, 502 aa]
          Length = 501

 Score = 69.7 bits (169), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 86/415 (20%), Positives = 156/415 (37%), Gaps = 81/415 (19%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSAT 195
           +I SP + ++G+R+ ++               S+  E ++  R +SG   S+  S+   +
Sbjct: 114 LILSPLSELYGRRLTFIFSLALSIIWQCLTTWSKTIEGVMFGRFLSGFFGSSFLSVAGGS 173

Query: 196 VAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRH-WLFWIVTIIVGVNFMLH 254
           +++I+   +    +  +T                + +  D + W F ++ I  GV  +L 
Sbjct: 174 ISDIFEKKDIGIPMAIFTTSPMLGPSIGPIIGGALHK--DSYKWTFIVLLIASGVCLVLI 231

Query: 255 VLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXX 314
            L VPET+     +   + +R+           +     Y AP                 
Sbjct: 232 TLTVPETYKPMLLIRKAKRLRQ-----------ETGDDKYYAP----------------- 263

Query: 315 XXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCY 374
                        ++R  TK+  + I  +                       RPF L   
Sbjct: 264 -----------LEITRKETKLTSAIILSAR----------------------RPFGLLVR 290

Query: 375 PAVLFGAFLYS---LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS 429
             ++     Y+   LAIV+L  VA   I  TV+      F+ +++   Y+    G + G 
Sbjct: 291 DPMMAVLTFYTGLVLAIVYLFFVAFPYIFETVF-----KFTVMEVACAYI----GMLSGI 341

Query: 430 LCAGPLSDKMVRHFAKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
           L   P +  + + +AKK   + G+  PE R   +      T +GLM F W+      WI 
Sbjct: 342 LLVSPTALIIQKRYAKKVENNNGVSTPEMRFEALFYGAFLTPIGLMIFAWTCYPQVHWIG 401

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
           P I  G+ G G     T   ++TVD+Y+ YA  A+   + +++ M   F  F  +
Sbjct: 402 PVIGSGIFGSGVFFVFTGVFSYTVDAYRKYAASAMACNSFVRSTMSAVFPLFGLQ 456

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 90/205 (43%), Gaps = 7/205 (3%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YPAV       +++   L  V   I   Y  PPY+F  + IGL+Y+   V  
Sbjct: 443 LKSLHFLRYPAVSLAISFSAISFAALYFVNITIEYRYSRPPYNFKPLYIGLLYIPNSVTY 502

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
           I  S+  G   D +++ + +K  GI  PE R+ + V+ A +   + L+ FGW     + W
Sbjct: 503 IFASIYGGRWVDNLLKSYKEKH-GILAPEARISWNVVTAVICFPISLLIFGWCLDKKEHW 561

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-- 542
           + P +   + GF S +     +++ VDS        +   N+++ +      F       
Sbjct: 562 VTPLVGTALFGFASMMTIGATVSYLVDSLPGRGATGVALNNLIRQIFAATAVFVTEPMLE 621

Query: 543 NVKSGYKTT---FIVYGCVELIVCL 564
            + +G+  T   F+V G   +++ L
Sbjct: 622 GMGTGWAFTMLAFVVLGGSSVLIVL 646

 Score = 60.5 bits (145), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 84/192 (43%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +DP ++P   +   + ++ +   +G   TSI+      +  +++ S   ++  V      
Sbjct: 88  KDPRDYPSILKKFIVLLIAYASMMGPMGTSIVFPAIGLITSDYNTSTIMVNVSVGIYLIS 147

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  S  + + G+R VYLV            AVS N ++ +  R++ G   ++++S
Sbjct: 148 LGVFPLWWSSISELKGRRTVYLVSFTLLFAFCIGTAVSPNIQAFIILRVLCGASSASVQS 207

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + + T+A++Y   ER   LG++               S +  +       W + I+ G N
Sbjct: 208 VGAGTIADLYAPEERGKNLGYFYLGALTAPLLSPIIGSLLVNHWSWRSTQWFMVILAGAN 267

Query: 251 FMLHVLFVPETF 262
            +L VLF+PET 
Sbjct: 268 VILIVLFLPETL 279

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 96/512 (18%), Positives = 185/512 (36%), Gaps = 68/512 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           +    +P NWP+W R +   ++          ++ +  G   +  +FH S          
Sbjct: 152 TNDPENPHNWPLWIRWSYTILMSVLVIAVAYGSACITGGLFTVEEKFHVSQEVAILSCSL 211

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    +I SP + ++G+R+ Y +           CA+++N  +LL  R + G+  S
Sbjct: 212 MVIGFSLGPLIWSPVSDLYGRRVAYFISLGLYVIFNIPCALAKNIGTLLVCRFLCGVWSS 271

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTI 245
           +   L   ++A+++ A  R   + F+                F+    +R   +FW+   
Sbjct: 272 SGLCLVGGSIADMFPAETRGRAIAFFAYAPYCGPVFGPLVNGFIAISTNRMDLIFWVNMA 331

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDA 305
             GV +++ V  +PET+    PV  ++  +   I               + PK   E++A
Sbjct: 332 FAGVMWII-VSCIPETY---APVILKKRAKRLRIE-------------LNNPKIMTEQEA 374

Query: 306 XXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                                        +  S + ++ L+  L        +D      
Sbjct: 375 ---------------------------QGMSVSELVRACLLRPLYFAVTEPVLD------ 401

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
                L C+   L  + LY+    + ++  ++         Y +    IGL+++   +G+
Sbjct: 402 -----LMCFYVCLIYSLLYAFFFAYPVIFGKL---------YGYKDNIIGLMFIPILIGA 447

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWI 485
             G+L      +   R+ A        PE RL   +      A+ L   G ++  H  W+
Sbjct: 448 S-GALATTSWCES--RYVALTHKRKPTPEDRLLGAMIGAPFAAIALWILGATSYKHIIWV 504

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK 545
            P       G+G  L   +   + +D Y  YA  AL T   L++  G AF  F ++   +
Sbjct: 505 GPASSGLAFGYGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTSQMYDR 564

Query: 546 SGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
            G +    +   +   + L     Y+YGK  R
Sbjct: 565 LGLQWASWLLAFISTAMILIPFAFYYYGKALR 596

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 105/526 (19%), Positives = 193/526 (36%), Gaps = 73/526 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VX 125
           +    +P NW  W R     V+          ++ +  G + +  ++H S +++S L   
Sbjct: 152 TNDPENPHNWATWLRWLYTIVLSILVISVAYGSACITGGLELVNEKYHVS-TEVSILSCS 210

Query: 126 XXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                     +I SP + ++G+R+ Y V           CA++ N   LLA R + G+  
Sbjct: 211 LMVIGFSLGPLIWSPVSDLYGRRVAYFVSLGLYVIFNIPCALAPNIGCLLACRFLCGVWS 270

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVT 244
           S+   L   ++A+++ +  R   + F+                F+     R   +FW+  
Sbjct: 271 SSGLCLVGGSIADMFPSETRGKAIAFFAYAPYCGPVFGPLVNGFINISTGRMDLIFWVNM 330

Query: 245 IIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEED 304
              G  +++ V F+PETF    PV  +R        RAA   ++        PK   E++
Sbjct: 331 AFCGFMWIV-VAFIPETF---APVILKR--------RAARLRKETG-----NPKIMTEQE 373

Query: 305 AXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMV 364
           A                             +  S + ++ L+  L        +D     
Sbjct: 374 A---------------------------QGLSVSEMMRACLLRPLYFAVTEPVLD----- 401

Query: 365 MLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVG 424
                 L C+   L  + LY+    + ++  ++         Y +    IGL+++   +G
Sbjct: 402 ------LMCFYVCLIYSLLYAFFFAYPVIFGKL---------YGYKDNIIGLMFIPILIG 446

Query: 425 SILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAW 484
           +   +LC     +  +++ A        PE RL   +      A+ L   G ++  H  W
Sbjct: 447 AS-AALCTTYWCE--LKYVALTKRRKPTPEDRLLGAMIGAPFAAIALWILGATSYKHIIW 503

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNV 544
           + P       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  +   
Sbjct: 504 VGPASSGLAFGFGMVLIYYSLNNYIIDCYAMYASSALATKVFLRSAGGAAFPLFTNQMYD 563

Query: 545 KSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSY 590
           + G +    +   +   + L     Y+YGK  R     K   D+S+
Sbjct: 564 RLGLQWASWLLAFISTAMILIPFAFYYYGKGLRAKLSKK---DYSF 606

>TPHA0B03770 Chr2 (890983..892545) [1563 bp, 520 aa] {ON} 
          Length = 520

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 88/207 (42%), Gaps = 19/207 (9%)

Query: 386 LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHF 443
           LAIV+L  VA   I  T+Y      F ++++G  YV    G ++G L A P S  + +H+
Sbjct: 323 LAIVYLFFVAFPYIFETIY-----EFGAVEVGCAYV----GLLVGILLASPTSFIIQKHY 373

Query: 444 AKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSL 500
            KK   + GI  PE R   +      T +GLM F W+      WI P I   + G G   
Sbjct: 374 EKKVADNNGISTPEMRFEALYYGAFLTPIGLMIFCWTCYRKVHWIGPIIGSSIFGSGVFY 433

Query: 501 ASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVEL 560
             T   ++TVD Y+ ++  A+   + +++ M   F  F  +     G      +  C+  
Sbjct: 434 VFTGVFSYTVDGYRKFSATAMACNSFVRSTMSAVFPLFGLQMYKGMGVNWAGFLIACITT 493

Query: 561 IVCLFAIPLYHYGKRAR-----RWTDS 582
            +         YG + R      W D+
Sbjct: 494 AMIPVPFLFEKYGAKLRAKSPYAWDDN 520

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 109/545 (20%), Positives = 199/545 (36%), Gaps = 92/545 (16%)

Query: 52  VVQTTKKGIILNPQPSKSKR------------DPLNWPVWRRDTALFVVGWHCFVGGGQT 99
           V   +KKG    P P++ ++            +P NWP+W R     ++          +
Sbjct: 96  VTTVSKKG--EEPYPAEPEKLRFVTFVTGDPANPHNWPIWIRWLYTIILSTLVVCVAYGS 153

Query: 100 SILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXX 159
           + +  G   ++  +H         V           +I SP + I+G+R  Y V      
Sbjct: 154 ACITGGLSTVSDTYHVGNEVAILSVSLMVLGFAFGPLIWSPFSDIYGRRAAYFVSLGLYV 213

Query: 160 XXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXX 219
                CA+S N    +  R + G+  S+   L   ++A+++ A  R   + F+       
Sbjct: 214 IFNIPCAISPNISGHMICRFLCGVYASSGLCLVGGSIADMFPAETRGKAIAFFAFAPYCG 273

Query: 220 XXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETA 278
                    FV     R  ++ W      GV ++L V  +PET+    PV          
Sbjct: 274 PVFGPLVNGFVSVSTGRMDYIIWFNMAFAGVMWLL-VALIPETY---APV---------I 320

Query: 279 IARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCS 338
           ++R A   R          K  G+                          SR+ T+ +  
Sbjct: 321 LSRRAKKLR----------KETGD--------------------------SRLVTETEAQ 344

Query: 339 NIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQII 398
            ++   ++    +     SV + ++V+   ++            +YSL   +      I 
Sbjct: 345 GVSFKDMLRACLVRPLYFSVTEPVLVLTSGYI----------CLIYSLLYAFFFAYPVIF 394

Query: 399 NTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC----AGPLSDKMVRHFAKKSCGIYEPE 454
           N +YG     +    IGL+++   +G+ + +LC       L  K+++   ++ C    PE
Sbjct: 395 NELYG-----YKDNLIGLMFIPILIGACM-ALCTTFWCEHLYLKLIKQ--RRPC----PE 442

Query: 455 FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYK 514
            RL   +      A+ L   G ++  H  W+AP       G+G  L   +   + +D Y 
Sbjct: 443 DRLLGAMIGAPFAAIALWMLGATSYKHLIWVAPASSGLAFGYGMVLIYYSLNNYIIDCYA 502

Query: 515 CYAQEALVTLNVLKNVMGFAFSFFNTKF--NVKSGYKTTFIVYGCVELIVCLFAIPLYHY 572
            YA  AL T   L++  G AF  F T+   N+   + +  + +    +I+  FA   +  
Sbjct: 503 KYASSALATKVFLRSAGGAAFPLFTTQMYHNLGLQWASWLLAFIATGMIIIPFAFKRWGK 562

Query: 573 GKRAR 577
             RAR
Sbjct: 563 SLRAR 567

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 90/205 (43%), Gaps = 7/205 (3%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   +  V   +   Y  PPY+F  + IGL+Y+   V  
Sbjct: 465 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTY 524

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
              S+  G   D ++R + K+  GI  PE R+ + V+ + +S  + L+ FGW       W
Sbjct: 525 FFASIYGGRWVDMLLRRY-KEKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHW 583

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-- 542
           + P I   + G+ + +     +++ VDS        +   N+++ ++     F  T    
Sbjct: 584 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLN 643

Query: 543 NVKSGYKTT---FIVYGCVELIVCL 564
            + +G+  T   FIV G   ++V L
Sbjct: 644 GMGTGWAFTLLAFIVVGASSVLVVL 668

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 93/237 (39%), Gaps = 11/237 (4%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +D  ++P   +   +F++ +   +G   TSI+      +  EF  S+  ++  +      
Sbjct: 96  KDARDYPPKMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLS 155

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  S  + + G+R  Y+             A++ +  S +A R++ G   ++++S
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINSFIALRMLCGAASASVQS 215

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + + TVA++Y + +R   L +Y               S +          W + I+ G N
Sbjct: 216 VGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIFGSLLVNRWPWRSTQWFMVILSGCN 275

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETAIARAADGAR---DVAISGYSAPKFQGEED 304
            +L  + +PET          +   + AIAR     R   D    G     +Q EED
Sbjct: 276 VILLTVLLPETL--------RKQDSKGAIARILAERRIQVDHNEHGEIQENYQREED 324

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 100/514 (19%), Positives = 182/514 (35%), Gaps = 70/514 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           +    +P NWP+W R T   ++          ++ +  G   +  +FH  L         
Sbjct: 167 TNDPANPHNWPLWIRWTYTILLSTLVICVAYGSACITGGLGTVQDQFHVGLEAAILSCSL 226

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    +I SP + ++G+++ Y             CA++ N   LLA R + G+  S
Sbjct: 227 MVIGFSLGPLIWSPVSDLYGRQVAYFFSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSS 286

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTI 245
           +   L   ++A+++ +  R   + F+                F+     R   +FW+   
Sbjct: 287 SGLCLVGGSIADMFPSETRGKAIAFFAFCPYTGPVLGPVVNGFISVSTGRMDLIFWVNMA 346

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDA 305
             GV +++    +PET+    PV  +R        RAA   ++        PK   E++A
Sbjct: 347 FAGVMWIISSA-IPETY---APVILKR--------RAAKLRKETG-----NPKIMTEQEA 389

Query: 306 XXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                                             I+ + ++ G  +   + SV + ++  
Sbjct: 390 --------------------------------QGISFNEMMKGCVLRPLKFSVTEPVLFA 417

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
                  C+   L  + LY+    + ++ +++         Y +    IGL+ +   +G+
Sbjct: 418 T------CFYVCLIYSLLYAFFFAYPVIFSEM---------YGYKDNFIGLMMLPILIGA 462

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWI 485
                       K +     +      PE RL          ALGL   G +   H  W+
Sbjct: 463 TFALAFTFWCESKYLALIKTRKP---TPEDRLLGAKIGAPFAALGLWMLGATTYNHRMWV 519

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK 545
           AP       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F T+   K
Sbjct: 520 APASSGIPFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTTQMYHK 579

Query: 546 SG--YKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
            G  + +  + + C  +I   F    Y  G R +
Sbjct: 580 LGLHWASWLLAFICTAMIALPFGFSYYGQGLRHK 613

>TBLA0A10350 Chr1 (2550231..2551796) [1566 bp, 521 aa] {ON}
           Anc_5.284 YHR048W
          Length = 521

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 103/234 (44%), Gaps = 16/234 (6%)

Query: 353 HGRHSVDKWIMVML---RPFVLFCYPAVLFGAFLYS---LAIVWLIMVAQIINTVYGNPP 406
           + R S+  W  ++    RPF L  +  ++     YS   LAI++L  VA      Y  P 
Sbjct: 286 NTRSSIPFWKAILFSIRRPFGLLFFDPMMGVLCFYSGFELAIIYLFFVA----FPYVYPL 341

Query: 407 -YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGL 465
            ++F+ ++    Y+   VG IL ++ +  +  + +    KK+ GI  PE R   +     
Sbjct: 342 LWNFNVMETACSYIGMMVGIILSAITSLYVQKRYLEK-VKKNNGISIPEMRFEPLYIGAF 400

Query: 466 STALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
            + +GLM F W+  ++  WIAP I   + G G          +TVD+Y+ YA   L    
Sbjct: 401 LSPIGLMIFAWTCYSNVHWIAPIIGSTIFGMGVFYVFAGIFNYTVDAYRTYAASGLACNT 460

Query: 526 VLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLY--HYGKRAR 577
            ++ ++G  F  F  +  +  G    +  +    L +CL  +P    HYG   R
Sbjct: 461 FVRCILGGIFPLFGLQ--MFEGMTVNWAGFLLAMLAICLIPVPFLFDHYGAYLR 512

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/139 (20%), Positives = 61/139 (43%), Gaps = 1/139 (0%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           SP + ++G+RI ++               + N E +L  R ++G   S   S+   T+++
Sbjct: 137 SPISEMYGRRITFIFSLSMSIVWQCLTTWASNIEGMLFGRFLAGFFGSAFLSVAGGTISD 196

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           ++  +E    +  +T             +  ++ +++  W F ++ I  GV  +L VL V
Sbjct: 197 LFNKNEVGVPMALFTTAGFLGPSIGPLLSGAMY-HINYKWTFIVLLITSGVCLILVVLTV 255

Query: 259 PETFWDRTPVPNERSIRET 277
           PET+     +   + +R T
Sbjct: 256 PETYKPVLLINKAKRLRST 274

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 107/507 (21%), Positives = 188/507 (37%), Gaps = 89/507 (17%)

Query: 77  PVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSI 136
           PVWR+ + + V+G         TS+       ++ +FH S    +               
Sbjct: 111 PVWRKWSVIAVIGVCQLSMNFNTSVYPHAISLISEDFHISKQAANTSQMIFLVAYAFGCE 170

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           + +P +  +G+ IV                ++ N+ S++ +R + G+ ++   S+     
Sbjct: 171 LWAPWSEEYGRWIVMQCSLFSSNVWQILGGLAPNFGSIIVARFLGGISLAG-GSVTLGVA 229

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVL 256
           A+++   +  Y + F                  + E+L  HW FWI  I  GV  +LH  
Sbjct: 230 ADMWDPADHGYAVAFVVLCSVGGTVIGPIFGGLMEEHLSWHWNFWIQLIFNGVTQVLHFF 289

Query: 257 FVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXX 316
            VPET   R+ V  +RS +     +     RD  + G       GE  A           
Sbjct: 290 IVPET---RSTVIMDRSAK-----KMRKSGRDPHVYG------PGEVKAFS--------- 326

Query: 317 XXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPA 376
                                    +  L T +  FH         M +  P VLFC   
Sbjct: 327 ------------------------VKELLKTWIRPFH---------MFVCEPIVLFC--- 350

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC----- 431
               + L   A   + +  Q    ++    ++FS+   GL +++  +  ++G +      
Sbjct: 351 ----SLLSGFADHLIFICNQAFGPIFEQ--WNFSTTAQGLTFITLVIAYLIGYMLHLIDI 404

Query: 432 --AGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA--HDAWIAP 487
                + DKM+ H ++       PE RL ++L      +LGL GF W+     +  WIAP
Sbjct: 405 RQQRKIMDKML-HSSRG------PERRLLLLLFLAPLLSLGLFGFAWTTMGPRYTPWIAP 457

Query: 488 TIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVM-GFAFSFFNTKFNVKS 546
            IF  V+G G+       I + V +Y  Y+  A       ++++ G A  +    +N   
Sbjct: 458 AIFSTVIGIGNYSIYMATIDYMVSAYGPYSASATGGNGFARDLLAGIAAMYATPLYNNIG 517

Query: 547 G---YKTTFIVYGCVELIVCLFAIPLY 570
           G   Y+    + GC+ +   L  IP+Y
Sbjct: 518 GKFHYQWASTLLGCLGV---LCTIPIY 541

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 92/223 (41%), Gaps = 2/223 (0%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   +  V   +   Y  PPY+F  + IGL+Y+   +  
Sbjct: 459 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSITY 518

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
           +  S+  G   D +++ + K+  GI  PE R+ + V+ + +S  + L+ FGW       W
Sbjct: 519 LFASIYGGRWVDVLLKRY-KEKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCQW 577

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNV 544
           + P I   + G+ + +     +++ VDS        +   N+++ ++     F  T    
Sbjct: 578 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMIN 637

Query: 545 KSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLD 587
             G    F +   + L      I L  +G   R   D + L D
Sbjct: 638 GMGTGWAFTMLAFIVLAASSVLIILKKHGDYWRENYDLQRLYD 680

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 79/192 (41%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +D  ++P   +   +F++ +   +G   TSI+      +  EF  S+  ++  +      
Sbjct: 96  KDARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLS 155

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  S  + + G+R  Y+             A++ +  S +A R++ G   ++++S
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFAMLFAFSIGSALAPDINSFIALRMLCGAASASVQS 215

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + + TVA++Y + +R   L +Y               S +          W + I+ G N
Sbjct: 216 VGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIIGSLLVNRWPWRSTQWFMVILSGCN 275

Query: 251 FMLHVLFVPETF 262
            +L  + +PET 
Sbjct: 276 VILLTVLLPETL 287

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 96/226 (42%), Gaps = 15/226 (6%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   +  V   +   Y  PPY+F  + IGL+Y+   V  
Sbjct: 464 LKSLYFLQYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTY 523

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
              S+  G   D +++ + K+  GI  PE R+ + V+ + +S  + L+ FGW       W
Sbjct: 524 FFASIYGGRWVDMLLKRY-KEKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHW 582

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-- 542
           + P I   + G+ + +     +++ VDS        +   N+++ ++     F  T    
Sbjct: 583 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLN 642

Query: 543 NVKSGYKTT---FIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGL 585
            + +G+  T   FIV G   +++ L         KR   W ++  L
Sbjct: 643 GMGTGWTFTMLAFIVLGASSVLIIL--------KKRGDYWRENYDL 680

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/211 (18%), Positives = 87/211 (41%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V ++ ++G++ +       +D  ++P   +   +F++ +   +G   TSI+      +  
Sbjct: 77  VPKSERRGLLPHLALIPEFKDARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINAITT 136

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           EF  S+  ++  +           +  S  + + G+R  Y+             A + + 
Sbjct: 137 EFKTSVIMVNVSIGVYLLSLGVFPLWWSSMSELEGRRTTYITSFALLFAFNIGSAFAPDI 196

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            S +A R++ G   ++++S+ + TVA++Y + +R   L +Y               S + 
Sbjct: 197 NSFIALRMLCGAASASVQSVGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIIGSLLV 256

Query: 232 EYLDRHWLFWIVTIIVGVNFMLHVLFVPETF 262
                    W + I+ G N +L  + +PET 
Sbjct: 257 NRWPWRSTQWFMVILSGCNVILLTVLLPETL 287

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 89/423 (21%), Positives = 159/423 (37%), Gaps = 49/423 (11%)

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA-VSQNY 171
           FH S S I+  V           ++    A + G++I+YL+            A +S N 
Sbjct: 107 FHTSTSTINATVSVFMAVFAVGPLLWGAYADVGGRKILYLLSLALMFIVNVLLASLSPNI 166

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            +L   RI      S++ +L + TV ++     R   +G++              A  + 
Sbjct: 167 VALFILRIAQAFASSSVIALGAGTVTDLIVPSARGKAIGYFMMGPNMGPVIAPIVAGLIL 226

Query: 232 EYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVA 290
              DR  WLF    I+ GV  +   +F+PET                   R   G  D +
Sbjct: 227 INTDRWRWLFGFCAIMSGVALLCVWIFLPETL------------------RCIVGNGDPS 268

Query: 291 ISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLG 350
             G S    + +E               +   Q  ++       I+   ++       L 
Sbjct: 269 WKGESPLDIEAQE---------------LVECQPAKWQFCADIGIQ-KPVSNETTFKELY 312

Query: 351 IFHGRHSVDK-WIMVMLRP-FVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYS 408
           +   R  +   W M+  RP FV     A+LF  + Y+ ++ +         + +    Y 
Sbjct: 313 VRPPRAGLKTYWSMIKFRPIFVTASCNALLFANY-YAFSVTF---------SHFLEVSYH 362

Query: 409 FSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSC-GIYEPEFRLFMVLPAGLST 467
           +S ++IG  YV P +  ILGS   G LSD + + + KK+    Y  E RL + +   +  
Sbjct: 363 YSMLKIGAAYVCPGITMILGSQSGGHLSDFLRKRWKKKNPEKDYPLELRLRLNIVGIVIN 422

Query: 468 ALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVL 527
             G +G+GW+   H        F  ++ FG +  + T +T+  +     A   +   ++ 
Sbjct: 423 TAGCIGYGWAISRHFHVALVLFFSALLAFGLTWVNNTTMTYMTELMAHRASAGVAVNSMF 482

Query: 528 KNV 530
           +N+
Sbjct: 483 RNI 485

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 82/395 (20%), Positives = 141/395 (35%), Gaps = 57/395 (14%)

Query: 146 GKRIVYLVXXXXXXXXXX-XCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++ +Y+V             AV  N  +L   R+      S++ SL + TV ++     
Sbjct: 174 GRKFLYMVSLSLMLAVNIILAAVPANIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKH 233

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFW 263
           R   + ++              A  +    +   WLF   +I+ G+  +L    +PET  
Sbjct: 234 RGKAIAYFMMGPNMGPIIAPIVAGLILMKGNYWRWLFGFTSIMAGIALILVTALLPETL- 292

Query: 264 DRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ 323
                                      I G   PK+   +               V P+ 
Sbjct: 293 -------------------------RCIVGNGDPKWCERKKGVEGK---------VLPSS 318

Query: 324 SHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDK-------WIMVMLRPFVLFCYPA 376
             R LSR        ++     VT    F  ++           W MV   P ++     
Sbjct: 319 QRRGLSRWHL---FPDMGIRKPVTNDPFFQQKYPKPPKAGFTLYWKMVKCPPVIITSVST 375

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLS 436
            L  +  Y+ ++ +         + Y    Y F+ ++IG  YV P V  +LGS   G LS
Sbjct: 376 ALLFSSYYAFSVTF---------SYYLENDYHFTMLEIGAAYVCPGVAMLLGSQSGGHLS 426

Query: 437 DKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVG 495
           D +   + K       P EFRL + L   L T  G +G+GWS   H  ++   +F  +  
Sbjct: 427 DYLRSRWIKTHPEKKFPAEFRLILNLVGILLTMGGTVGYGWSIFFHHHFVVLLVFSSLTA 486

Query: 496 FGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNV 530
           FG +  S T++T+  + +   A   +   +  +N+
Sbjct: 487 FGMTWCSNTSMTYLTELFPKRAAGTVAVSSFFRNI 521

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 67/148 (45%), Gaps = 2/148 (1%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   L  V   +   Y   PY+F  + +GL+Y+   V  
Sbjct: 418 LKSLHFLRYPPVTLAITFSAISFAILYFVNMTVEYSYSRSPYNFKPLYVGLLYIPNSVTY 477

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
           ++ S+  G   D ++R + KK  G   PE R+ + V+ A +S  + L+ FGW       W
Sbjct: 478 VIASIYGGKWVDNLLRQY-KKKYGTLAPEARISWNVVTAVISFPISLLIFGWCLDKKQHW 536

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDS 512
           + P +   + G+ S +     + + VDS
Sbjct: 537 VTPLVGTALFGYASMMTIGATVAYLVDS 564

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/199 (19%), Positives = 83/199 (41%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V +  ++G++ N       +D  ++P   +   +F++ +   +G   TSI+      +  
Sbjct: 62  VARNQRRGVLANFSLVPEYKDARDYPPKLKAFIIFLIAYAAMMGPMGTSIIFPSITSIEK 121

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           +F  +   ++  V           +  S  + + G+R VY++            A++ N 
Sbjct: 122 DFDTTTMMVNVSVGIYLLSLGVLPLWWSSLSELRGRRTVYVLSFTLLCAFCIGSALAPNI 181

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
           E+ +  R++ G   ++++S+ + TVA++Y   +R  RLG+Y               S + 
Sbjct: 182 EAFIVFRMLCGASSASVQSVGAGTVADLYKPEDRGKRLGYYYLGALMAPLLSPIIGSLLV 241

Query: 232 EYLDRHWLFWIVTIIVGVN 250
                    W + I+ GVN
Sbjct: 242 NRWSWRSTQWFMVILAGVN 260

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 90/205 (43%), Gaps = 7/205 (3%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   +  V   +   Y  PPY+F  + IGL+Y+   V  
Sbjct: 465 LKSLHFLEYPPVALAITFSAISFSTVYFVNMTVEYKYSRPPYNFKPLYIGLLYIPNSVTY 524

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
              S+  G   D +++ + K+  GI  PE R+ + V+ + +S  + L+ FGW       W
Sbjct: 525 FFASIYGGRWVDMLLKRY-KEKYGILAPEARISWNVVTSVISFPIALLIFGWCLDKKCHW 583

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-- 542
           + P I   + G+ + +     +++ VDS        +   N+++ ++     F  T    
Sbjct: 584 VTPLIGTALFGYAAMMTIGATLSYLVDSLPGKGATGVALNNLIRQILAATAVFVTTPMLN 643

Query: 543 NVKSGYKTT---FIVYGCVELIVCL 564
            + +G+  T   FIV G   +++ L
Sbjct: 644 GMGTGWAFTMLAFIVLGASSVLIIL 668

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/264 (17%), Positives = 99/264 (37%), Gaps = 9/264 (3%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +D  ++P   +   +F++ +   +G   TSI+      +  EF  S+  ++  +      
Sbjct: 96  KDARDYPPMMKKMIVFLIAFSSMMGPMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLS 155

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +  S  + + G+R  Y+             A++ +  S +A R++ G   ++++S
Sbjct: 156 LGVFPLWWSSLSELEGRRTTYITSFALLFAFNIGSALAPDINSFIALRMLCGAASASVQS 215

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + + TVA++Y + +R   L +Y               S +          W + I+ G N
Sbjct: 216 VGAGTVADLYISEDRGKNLSYYYLGPLLAPLLSPIFGSLLVNRWPWRSTQWFMVILSGCN 275

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXX 310
            +L  + +PET          +   + AIA+     R + +      + Q +        
Sbjct: 276 VILLTVLLPETL--------RKQDSKGAIAQIL-AERRIQVDNNERGEIQEDYQRGEDET 326

Query: 311 XXXXXXXXVTPTQSHRYLSRVRTK 334
                      T+ H Y+  VR +
Sbjct: 327 DRIENQVATLSTEKHNYVGEVRDQ 350

>ZYRO0F08228g Chr6 (665663..667612) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 649

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 96/215 (44%), Gaps = 8/215 (3%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V +  ++G++ N       +D  ++P   + + +FV+ +   +G   TSI+      +  
Sbjct: 61  VTRNERRGVVANLSLIPEFKDSRDYPESVKKSIVFVIAFSSMMGPMATSIIFPSIHEIEK 120

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           +F  +   ++  V           +  S  + + G+R VY+V           CA+S N 
Sbjct: 121 DFSTTSMVVNVSVGVYQISLGVFPLWWSSISEMNGRRTVYVVSFMLLLGFNIGCALSPNI 180

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
            + +A R +SG   ++++S+ + TV+++Y + +R   LG Y              +  + 
Sbjct: 181 GAFIALRFLSGAASASVQSVGAGTVSDLYVSEQRGRNLGIY----YLGPLLAPLISPIIG 236

Query: 232 EYLDRHWLF----WIVTIIVGVNFMLHVLFVPETF 262
             L  HW +    W + I+ G N ++ +LF+PET 
Sbjct: 237 AALVSHWSWRSTQWFLVILAGANVLILILFLPETL 271

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 91/198 (45%), Gaps = 9/198 (4%)

Query: 374 YPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAG 433
           YP V+      S++   L  V   +   Y   PY+F  + +GL+Y+   V  IL ++  G
Sbjct: 433 YPPVMLAIIFSSVSFSILYFVNMTLEYDYSRSPYNFPPMLVGLMYIPNSVTYILAAILGG 492

Query: 434 PLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG 492
              D ++  +  K  GI  PE R+ + ++ A +S  + L+ FGW     + W  P +   
Sbjct: 493 KWVDYLLIQYKAKH-GILAPEARISWNIVTAVISFPISLVIFGWCIDKGEHWETPLVGTA 551

Query: 493 VVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK---SGYK 549
           + G+ S +     +++ VDS        +   N+++ ++  A + F T+  +K   +G+ 
Sbjct: 552 LFGYASMMTIGATVSYLVDSLPGRGATGVALNNLIRQLLA-AVAVFVTEPLIKGMGTGWL 610

Query: 550 TT---FIVYGCVELIVCL 564
            T   FI+     ++V +
Sbjct: 611 FTMLAFIIIAAASVLVII 628

>KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.570
           YBR180W
          Length = 575

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 102/470 (21%), Positives = 178/470 (37%), Gaps = 45/470 (9%)

Query: 109 LALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAV- 167
           L +E++ S + I+  V           +     A + G++I+YL+            +V 
Sbjct: 124 LQIEYNVSSTTINATVSVFMAVFAVGPLFWGMFADVGGRKILYLISLLLMTLINVLLSVL 183

Query: 168 SQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXA 227
             N  +L   RI+     S++ +L + T+ +I     R   +G++              A
Sbjct: 184 PTNIAALFVLRILQAFSSSSVITLGAGTITDITPPKHRGKAIGYFMIGPNMGPIVAPIIA 243

Query: 228 SFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPN-ERSIRETAIARAADG 285
             +    +   WLF   +I+ GV F++ ++F+PET   R  V N +   R T     ++ 
Sbjct: 244 GLILMKGNYWRWLFGFTSIMSGVAFIVVLIFLPETL--RCKVGNGDPGWRSTQADSGSEE 301

Query: 286 ARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSH-RYLSRVRTKIKCSNIAQSH 344
             D+  + Y AP+++                    P  SH ++  +     K S      
Sbjct: 302 GIDLPRALY-APEYK--------RWTFFSDIGVRKPVSSHPQFKEQYPAPPKPS------ 346

Query: 345 LVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGN 404
               L ++        W ++ + P  L      L  A  Y+ ++ +         + +  
Sbjct: 347 ----LTLY--------WHLIKIAPVTLTSISTALLFANYYAFSVTF---------SHFLK 385

Query: 405 PPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPA 463
             Y+FS + IG  YV P +  +LGS   G LSDK    + K   G   P E RL + +  
Sbjct: 386 DEYNFSQLAIGAAYVCPGIAMLLGSQIGGHLSDKTRSIWIKNHEGQEFPLELRLALQMWG 445

Query: 464 GLSTALGLMGFGWSAQAHDAWIAPTI-FLGVVGFGSSLASTTAITFTVDSYKCYAQEALV 522
            +   +G +G+GWS Q H   IA  + F   +  G +  S T +T+  +     A   + 
Sbjct: 446 IILNTVGCIGYGWSIQ-HKYHIAIILMFSAFLALGMTWTSNTTMTYLTELLAQRAASTVA 504

Query: 523 TLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHY 572
             +  +N+     S    K     G    F   G   LI  +F   L  Y
Sbjct: 505 LSSFFRNIAAAIGSAIIVKLYTIMGVGWCFTGLGLCNLISLMFNWYLVRY 554

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 95/475 (20%), Positives = 171/475 (36%), Gaps = 72/475 (15%)

Query: 71  RDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXX 128
            +P NWP W R   T L  +   C   G  ++ ++ G   +  +FH  L           
Sbjct: 159 ENPHNWPAWIRWSYTVLLSILVICVAYG--SACISGGLGTVEKKFHVGLEAAILSCSLMV 216

Query: 129 XXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                  +I SP + ++G+R+ Y V           CA++ N   LLA R + G+  S+ 
Sbjct: 217 IGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSG 276

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIV 247
             L   ++A+++ +  R   + F+                F+     R   +FW+     
Sbjct: 277 LCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA 336

Query: 248 GVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXX 307
           GV +M+    +PET+    PV  +   R+ A  R   G           PK   E++A  
Sbjct: 337 GVMWMVASA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA-- 377

Query: 308 XXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLR 367
                                           I+ S ++ G  +     +V + ++V   
Sbjct: 378 ------------------------------QGISMSEMMRGCLLRPLYFAVTEPVLVAT- 406

Query: 368 PFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSIL 427
                C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++ 
Sbjct: 407 -----CFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGALW 452

Query: 428 GSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAP 487
                    +K ++   ++      PE RL          A+ L   G +A  H  W+ P
Sbjct: 453 ALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVGP 509

Query: 488 TIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
                  GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 510 ASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 564

>AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR180W (DTR1)
          Length = 619

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 91/438 (20%), Positives = 162/438 (36%), Gaps = 51/438 (11%)

Query: 146 GKRIVYLVXXXXXXXXXXXCAV-SQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++++Y++            AV      +L   R+V     S+  SL + TV++I     
Sbjct: 223 GRKLLYVLSMGLNVIVNVLLAVMPARIGALFVLRVVQAFASSSALSLGAGTVSDITPPKN 282

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFW 263
           R   + ++              A  +    DR  WLF   +I+ G+ F+L  +F+PET  
Sbjct: 283 RGKAIAYFMLGPNAGPILAPIIAGLILFDNDRWRWLFGFTSIMAGIGFLLVCVFLPETL- 341

Query: 264 DRTPVPNERSIRETAIARAADGARDV--AISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP 321
                            R   G  DV   ++G++  +F                      
Sbjct: 342 -----------------RCIVGNGDVRWRLAGFAEGRFDDY------------------- 365

Query: 322 TQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGA 381
           T+  R L      I+   ++ S     L     + S+  +  ++  P +  C    L  A
Sbjct: 366 TRQPRLLLMKSFGIQ-HPVSTSPEFRRLYPRPPKPSLKTYWEIVKEPNLTIC---SLSTA 421

Query: 382 FLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR 441
            +++    + +  A  +   YG     FS++ IG  Y  P V  ++GSL  G +SD+  R
Sbjct: 422 LMFATYYGFSVTFAHYLKLDYG-----FSNLAIGACYACPGVALMMGSLLGGHISDRFRR 476

Query: 442 HFAKKSCGIYEPEFRLFMVLPAGLSTAL-GLMGFGWSAQAHDAWIAPTIFLGVVGFGSSL 500
            +  K+ G   P +   +    G+  ++ G +G+GW  Q H        F  ++  G + 
Sbjct: 477 KWVAKNPGKTFPSYNRLISQVFGICVSMAGCIGYGWGIQFHYHIAIVLFFSFLMALGMTW 536

Query: 501 ASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVEL 560
            S + +TF  +S    A   +   N  +N+     S    K     G    F   G ++L
Sbjct: 537 CSNSTMTFLTESNPKRAAGTIAVSNSFRNIAAAISSAIIFKLCNAMGVGWCFTGLGLIDL 596

Query: 561 IVCLFAIPLYHYGKRARR 578
           +  L    L   G+   R
Sbjct: 597 LSMLSVYYLIRNGREITR 614

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/411 (20%), Positives = 153/411 (37%), Gaps = 79/411 (19%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           SP + ++G+RI ++               S+  E +L  R +SG   S   S+    +++
Sbjct: 114 SPISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFGSVFLSVAGGAISD 173

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           I+   +    +  YT             +  ++ + +  W F  + I  GV   L V+ V
Sbjct: 174 IFSKKQIGIPMAIYTTAAFLGPSLGPIISGALY-HANYKWTFVTLLIASGVCLTLIVISV 232

Query: 259 PETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXX 318
           PET+     +   + +RE                                          
Sbjct: 233 PETYAPVLLIKKAQRLREE----------------------------------------- 251

Query: 319 VTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVL 378
              T   RY + +    K ++I +S +++                   RPF L     ++
Sbjct: 252 ---TGDDRYYAPLEITRKETSIFKSVVLSAK-----------------RPFGLLLRDPMM 291

Query: 379 FGAFLYS---LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAG 433
                Y+   LAIV+L  VA   +  T+Y      F+ +++G  Y+    G ++G L A 
Sbjct: 292 GVLCFYTGLVLAIVYLYFVAFPYVFETLY-----HFTVMEVGCSYI----GLMVGMLLAS 342

Query: 434 PLSDKMVRHF---AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIF 490
           P S    + +    +++ G+  PE R   +      T +GLM F W+  +H  WI P I 
Sbjct: 343 PTSYIFQKRYDAKVERNGGVRTPEMRFEPLYYGAFCTPIGLMIFAWTCYSHVHWIGPQIG 402

Query: 491 LGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
             + G G          +TVD+Y+ YA   +   + +++VM   F  F  +
Sbjct: 403 SAIFGVGVYFVFVGVFGYTVDAYRKYAASGMACNSFVRSVMSGVFPLFGLQ 453

>KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 642

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 85/205 (41%), Gaps = 7/205 (3%)

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           L+      YP V       +++   L  V   +   Y   PY+F  + +GL+Y+   V  
Sbjct: 418 LKSLHFLRYPPVTLAITFSAISFAILYFVNMTLEYSYSRSPYNFKPLYVGLLYIPNSVTY 477

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPAGLSTALGLMGFGWSAQAHDAW 484
           ++ S+  G   D ++R + KK  G   PE R+ + V+ A ++  + L+ FGW       W
Sbjct: 478 VIASIYGGKWVDNLLRQYKKKH-GTLAPEARISWNVVTAVVTFPISLLIFGWCLDKKQHW 536

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-- 542
           + P +   + G+ S +     + + VDS        +   N+++        F       
Sbjct: 537 VTPLVGTALFGYASMMTIGATVAYLVDSLPGRGATGVALNNLIRQAFAATAVFVTEPMLE 596

Query: 543 NVKSGYKTT---FIVYGCVELIVCL 564
            +  G+  T   FIV G   ++V L
Sbjct: 597 GMGPGWAFTMLAFIVIGASSVLVVL 621

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/199 (18%), Positives = 83/199 (41%)

Query: 52  VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL 111
           V +  ++GI+ N       +D  N+P   +   +F++ +   +G   TSI+      ++ 
Sbjct: 62  VPRKQRRGILANLSVVPEYKDARNYPGKLKAGIIFLIAYAAMMGPMGTSIIYPSINPISE 121

Query: 112 EFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY 171
           ++  +   ++  V           +  S  + + G+R VY++            A++ N 
Sbjct: 122 DYKTTTMMVNVSVGIYLLSLGVLPLWWSSLSELRGRRTVYVLSFSLLCAFCVGSALAPNI 181

Query: 172 ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVF 231
           ++ +  R++ G   ++++S+ + TVA+++   +R   LG+Y               S + 
Sbjct: 182 QAFIVFRMLCGACSASVQSVGAGTVADLFKPEDRGKMLGYYYLGALMAPLLAPIIGSLLV 241

Query: 232 EYLDRHWLFWIVTIIVGVN 250
                    W + I+ GVN
Sbjct: 242 SRWSWRSTQWFMVILAGVN 260

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 28/203 (13%)

Query: 361 WIMVMLRPFVLFC--YPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVY 418
           W+++   P V  C    A+LF A+ Y+ ++ +   + Q          YS S++QIG  Y
Sbjct: 356 WVLLKYLP-VTICSVTTAILFAAY-YAFSVTFSHFLRQ---------DYSLSNLQIGACY 404

Query: 419 VSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWS 477
           V P V  +LGS+  G +SD     + K+  G   P E RLF+ +   L  A G +G+GWS
Sbjct: 405 VCPGVALLLGSVLGGHMSDHFRHMWIKRHNGAEFPSEKRLFLQIWGLLLNAGGCIGYGWS 464

Query: 478 AQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSF 537
            Q H       +F  ++ FG +  S T++T+  +   C  + A  T+ V         SF
Sbjct: 465 IQFHHHLAVVLVFSFLMAFGMTWCSNTSMTYLTE---CIPKRAAGTVAV--------GSF 513

Query: 538 FNTKFNVKSGYKTTFIVYGCVEL 560
           F    N+ +G  +  ++  C E+
Sbjct: 514 FR---NLAAGISSVIVMKLCSEM 533

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 49/119 (41%), Gaps = 2/119 (1%)

Query: 146 GKRIVYLVXXXXXX-XXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++I+Y++             AV  N  +L   R++     S++ +L + TV++I     
Sbjct: 174 GRKILYMISLLLTVIVNVLLAAVPVNTGALFFLRVMQAFASSSVMALGAGTVSDIRPPQV 233

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
           R   + ++              A  +        WLF   +I+ G+  +  ++F+PET 
Sbjct: 234 RGKAIAYFMLGPNMGPILAPIIAGLILMRGSYWRWLFGFTSILSGIGLIAVIVFLPETL 292

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 104/536 (19%), Positives = 191/536 (35%), Gaps = 88/536 (16%)

Query: 10  PKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNPQPSKS 69
           P +N+D+  +  N + K              G  D+AP     ++     +  +P+    
Sbjct: 123 PSSNEDALESDNNEKGKE---------GDSSGANDEAPDLDPEIEFVTF-VTGDPE---- 168

Query: 70  KRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXX 127
             +P NWP W R   T L  +   C   G  ++ ++ G   +  +FH  L          
Sbjct: 169 --NPHNWPGWIRWSYTVLLSILVICVAYG--SACISGGLGTVEKKFHVGLEAAILSCSLM 224

Query: 128 XXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVST 187
                   +I SP + ++G+R+ Y V           CA++ N   LLA R + G+  S+
Sbjct: 225 VIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSS 284

Query: 188 IESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTII 246
              L   ++A+++ +  R   + F+                F+     R   +FW+    
Sbjct: 285 GLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAF 344

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
            GV +++    +PET+    PV  +   R+ A  R   G           PK   E++A 
Sbjct: 345 AGVMWIIASA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA- 386

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                                            I+   ++ G  +     SV + ++V  
Sbjct: 387 -------------------------------QGISMGEMMRGCLLRPLYFSVTEPVLVAT 415

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
                 C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++
Sbjct: 416 ------CFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGAL 460

Query: 427 LGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
                     +K ++   ++      PE RL          A+ L   G +A  H  W+ 
Sbjct: 461 WALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVG 517

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
           P       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 518 PASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 573

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 104/536 (19%), Positives = 194/536 (36%), Gaps = 88/536 (16%)

Query: 10  PKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNPQPSKS 69
           P +N+D+  +  N + K              G  D+AP     ++     +  +P+    
Sbjct: 123 PSSNEDALESDNNEKGKE---------GDSSGANDEAPDLDPEIEFVTF-VTGDPE---- 168

Query: 70  KRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXX 127
             +P NWP W R   T L  +   C   G  ++ ++ G   +  ++H  +      V   
Sbjct: 169 --NPHNWPAWIRWSYTVLLSILVICVAYG--SACISGGLGTVEKKYHVGMEAAILSVSLM 224

Query: 128 XXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVST 187
                   +I SP + ++G+R+ Y V           CA++ N  SLLA R + G+  S+
Sbjct: 225 VIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGSLLACRFLCGVWSSS 284

Query: 188 IESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTII 246
              L   ++A+++ +  R   + F+                F+     R   +FW+    
Sbjct: 285 GLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAF 344

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
            GV +++    +PET+    PV  +   R+ A  R   G           PK   E++A 
Sbjct: 345 AGVMWIISSA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA- 386

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                                       +    + ++ L+  L       SV + ++V  
Sbjct: 387 --------------------------QGVSMGEMMRACLLRPL-----YFSVTEPVLVAT 415

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
                 C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++
Sbjct: 416 ------CFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGAL 460

Query: 427 LGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
                     +K ++   ++      PE RL          A+ L   G +A  H  W+ 
Sbjct: 461 WALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVG 517

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
           P       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 518 PASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 573

>TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {ON}
           Anc_8.570 YBR180W
          Length = 599

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 86/414 (20%), Positives = 151/414 (36%), Gaps = 42/414 (10%)

Query: 165 CAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXX 224
             V  N  +L   R+    G S++ +L + TV++I    +R   + ++            
Sbjct: 218 ATVPSNIVALFVLRVFQAFGSSSVIALGTGTVSDISPPKDRGKAIAYFMMGPNMGPILAP 277

Query: 225 XXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAA 283
             +  +    D   WLF   +I+ G+  +L +  +PET   R  V N      +A   + 
Sbjct: 278 IISGLILIRGDYWRWLFGFTSIMSGIALLLVLALLPETL--RCIVGNGDQRWRSAERGSK 335

Query: 284 DGARDVAI-SGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQ 342
           + A D  I      PK    +D                P       SR+  K    ++  
Sbjct: 336 NSASDREIGETIQTPKINLFQDIGMQ-----------KPVNGSSQFSRLYPKPPKPSL-- 382

Query: 343 SHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVY 402
                          +  W M+   P  +      L  A  Y+ ++ +    A+ + T  
Sbjct: 383 ---------------IMYWHMIKFLPLTVASLSTALLFASYYAFSVTF----ARFLQT-- 421

Query: 403 GNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVL 461
               Y+ S + +G  YV P V  +LGS   G LSD + + +     G+  P E+RL + +
Sbjct: 422 ---DYNLSMLAVGAAYVCPGVAMLLGSQVGGHLSDYLRKRWLLSHQGLLYPLEYRLILQV 478

Query: 462 PAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEAL 521
              +    G +G+GWS + H       +F  +  FG +  S T +T+  +        A+
Sbjct: 479 WGIIINTAGCIGYGWSIERHYPLAVVLVFSALNAFGLTWCSNTTMTYISELMAKRTAGAI 538

Query: 522 VTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKR 575
              +  +NV     S   +K  +  G    F   G   +I     + L  +G R
Sbjct: 539 AVSSFFRNVGATISSAIISKLYLSMGIGWCFSGLGLCNIISLAAILYLIKFGNR 592

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 91/443 (20%), Positives = 167/443 (37%), Gaps = 85/443 (19%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           +P +  +G+R +  +              + N+ +++ +R + G+  +   S+    VA+
Sbjct: 137 APWSEEYGRRNIMQLSLFFTNIWQILGGKAPNFGTIIVARFLGGISQAG-GSVTLGVVAD 195

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           ++   +  Y + +                  + E+L  HW FWI  I  GV  +LH   V
Sbjct: 196 MWQPQDHGYAVAYVVLASVLGAVIGPVFGGLMEEHLSWHWNFWIQLIFGGVTQLLHFFLV 255

Query: 259 PETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXX 318
           PET   R  V  +R  +     R      D        P+  G  +              
Sbjct: 256 PET---RASVLTDREAK-----RRRKSGED--------PEIYGPHE-------------- 285

Query: 319 VTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVL 378
               +S  +   +RT ++                        + M +  P VLFC     
Sbjct: 286 ---VKSLDFKEIMRTWLR-----------------------PFYMFLCEPIVLFC----- 314

Query: 379 FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDK 438
             + L   A   + +  Q    ++    + FS+   GL++++  V   +    A PL   
Sbjct: 315 --SLLSGFADHLIFICNQSFTPIFKQ--WHFSTTACGLIFITLVVSYAI----AYPLHLI 366

Query: 439 MVRHFAKKSCGIYE----PEFRLFMVLPAGLSTALGLMGFGWSAQ--AHDAWIAPTIFLG 492
            + +  KK   +      PE RL ++L      ++GL GF W++   ++  WIAP IF  
Sbjct: 367 DIYYMRKKMDELMHSPRGPERRLLLLLYLAPLLSIGLFGFAWTSMGPSYTPWIAPAIFST 426

Query: 493 VVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMG-----FAFSFFNTKFNVKSG 547
           V+G  +       I + V +Y  YA  A     + ++++G     +A   +N     K  
Sbjct: 427 VIGIANYSIYMATIDYMVAAYGPYASSATGGNGLARDLLGGIAAMYAGPLYNN-IGGKFH 485

Query: 548 YKTTFIVYGCVELIVCLFAIPLY 570
           Y+    + GC+  I+C  +IP+Y
Sbjct: 486 YQWASTLLGCLS-IIC--SIPIY 505

>Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/388 (20%), Positives = 141/388 (36%), Gaps = 43/388 (11%)

Query: 146 GKRIVYLVXXXXXXXXX-XXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++ +Y+V             AV  N  +L   R+      S++ SL + TV ++     
Sbjct: 174 GRKFLYMVSLSLMLTVNILLAAVPANIAALFVLRVFQAFSSSSVISLGAGTVTDVVPPKH 233

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFW 263
           R   + ++              A  +    +   WLF   +I+ G+  +L   F+PET  
Sbjct: 234 RGKAIAYFMMGPNMGPIIAPIVAGLILMKGNYWRWLFGFTSIMTGIALILVSAFLPETL- 292

Query: 264 DRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ 323
                   R I      +  +   +      S P+ +G  D                P  
Sbjct: 293 --------RCIVGNGDPKWGEKKSEADDKELSLPQKKGVSDRRLFPDMGIRKPVSNDPFF 344

Query: 324 SHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFL 383
             ++    +               GL ++        W M+   P ++      L  +  
Sbjct: 345 QQKFPKPPKA--------------GLTLY--------WKMIKCLPILVTSISTALLFSSY 382

Query: 384 YSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHF 443
           Y+ ++ +         + Y    Y F+ ++IG  YV P V  +LGS   G LSD +   +
Sbjct: 383 YAFSVTF---------SYYLENDYHFNMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRW 433

Query: 444 AKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLAS 502
            K       P EFRL + L   L T  G +G+GWS   H  ++   +F  +  FG +  S
Sbjct: 434 IKTHPKKRFPAEFRLLLNLIGILLTICGTVGYGWSIFFHYHFVVLLVFSALTAFGMTWCS 493

Query: 503 TTAITFTVDSYKCYAQEALVTLNVLKNV 530
            T++T+  + +   A   +   +  +N+
Sbjct: 494 NTSMTYLTELFPKRAAGTVAVSSFFRNI 521

>YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putative
           dityrosine transporter, required for spore wall
           synthesis; expressed during sporulation; member of the
           major facilitator superfamily (DHA1 family) of multidrug
           resistance transporters
          Length = 572

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 83/398 (20%), Positives = 147/398 (36%), Gaps = 63/398 (15%)

Query: 146 GKRIVYLVXXXXXXXXX-XXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++ +Y+V             AV  N  +L   RI      S++ SL + TV ++     
Sbjct: 174 GRKFLYMVSLSLMLIVNILLAAVPVNIAALFVLRIFQAFASSSVISLGAGTVTDVVPPKH 233

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFW 263
           R   + ++              A  +    +   WLF   +I+ G+  +L    +PET  
Sbjct: 234 RGKAIAYFMMGPNMGPIIAPIVAGLILMKGNYWRWLFGFTSIMTGIALILVTALLPETL- 292

Query: 264 DRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ 323
                   R I      +  D   +       +P F+G +                    
Sbjct: 293 --------RCIVGNGDPKWGDKKDER--ENNESPFFEGNK-------------------I 323

Query: 324 SHRYLSR---VRTKIKCSNIAQSHL----VTGLGIFHGRHSVDKWIMVMLRPFVLFCYPA 376
           SHR L     +R  +      Q +       GL ++        W M+   P ++     
Sbjct: 324 SHRRLFPDIGIRKPVNNDAFFQENFPKPPKAGLTLY--------WKMIKCPPIIITSVST 375

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLS 436
            L  +  Y+ ++ +         + Y    Y F+ ++IG  YV P V  +LGS   G LS
Sbjct: 376 ALLFSSYYAFSVTF---------SYYLEHDYRFTMLEIGAAYVCPGVAMLLGSQSGGHLS 426

Query: 437 D----KMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG 492
           D    + ++   KK    +  EFRL + L   L T  G +G+GW+   H  ++   +F  
Sbjct: 427 DYLRSRWIKSHPKKK---FPAEFRLLLNLIGILLTICGTIGYGWAIFFHYHFVVLLVFSA 483

Query: 493 VVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNV 530
           +  FG +  S T++T+  + +   A   +   +  +NV
Sbjct: 484 LTAFGMTWCSNTSMTYLTELFPKRAAGTVAVSSFFRNV 521

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 101/534 (18%), Positives = 188/534 (35%), Gaps = 84/534 (15%)

Query: 10  PKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNPQPSKS 69
           P +N+D+  +  N + K              G  D+AP     ++     +  +P+    
Sbjct: 123 PSSNEDALESDNNEKGKE---------GDSSGANDEAPDLDPEIEFVTF-VTGDPE---- 168

Query: 70  KRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXX 129
             +P NWP W R T   ++          ++ ++ G   +  +FH  +            
Sbjct: 169 --NPHNWPGWIRWTYTVLLSILVICVAYGSACISGGLGTVEKKFHVGMEAAILSCSLMVI 226

Query: 130 XXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIE 189
                 +I SP + ++G+RI Y V           CA++ N   LLA R + G+  S+  
Sbjct: 227 GFSLGPLIWSPVSDLYGRRIAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGL 286

Query: 190 SLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVG 248
            L   ++A+++ +  R   + F+                F+     R   +FW+     G
Sbjct: 287 CLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFAG 346

Query: 249 VNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXX 308
           V +++  L +PET+    PV  +   R+ A  R   G           PK   E++A   
Sbjct: 347 VMWIVSSL-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA--- 386

Query: 309 XXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRP 368
                                     I  S + ++ L+  L           +  V    
Sbjct: 387 ------------------------QGISMSEMMRACLLRPL-----------YFAVTEPV 411

Query: 369 FVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILG 428
            V  C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++  
Sbjct: 412 LVATCFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGALWA 462

Query: 429 SLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPT 488
                   +K +    ++      PE RL          A+ L   G ++  H  W+ P 
Sbjct: 463 LATTFYCENKYLAIVKQRKP---TPEDRLMGAKIGAPFAAIALWILGATSYKHIIWVGPA 519

Query: 489 IFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
                 G+G  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 520 SAGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSCGGAAFPLFTIQM 573

>KLTH0B03894g Chr2 complement(317072..318892) [1821 bp, 606 aa] {ON}
           weakly similar to uniprot|P53283 Saccharomyces
           cerevisiae YGR138C TPO2 Polyamine transport protein
          Length = 606

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 76/195 (38%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
                DP NWP  ++     ++G  CF     ++I+       A  F  S+  +   V  
Sbjct: 119 DDDSEDPRNWPTRQKWNYTVLLGIICFDVAMMSAIITGDMDSPAAYFGVSMEVMCLCVSL 178

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    ++ +P +  FG+  VYLV           C  ++N  +LLA R + GL  S
Sbjct: 179 MVWGFGLGPMLFAPLSEEFGRNPVYLVTLFIAVVFIVPCGAAKNIGTLLAFRFLDGLAFS 238

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
               L   ++++++   ER   +  ++              S +       W++W + I 
Sbjct: 239 APMCLIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGPIVGSLLSVKCSWRWVYWFMVIF 298

Query: 247 VGVNFMLHVLFVPET 261
            G  + +  +F+PET
Sbjct: 299 SGCLYAVMAVFLPET 313

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 84/217 (38%), Gaps = 5/217 (2%)

Query: 365 MLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVG 424
           + RP VL     V       S+    L M       VY    + + +I+  ++++ P   
Sbjct: 354 LFRPLVLLTELIVFLITMYMSVIYGLLYMFFFAYPMVYTEGKH-YGAIKTSIMFI-PVGA 411

Query: 425 SILGSLCAGPLSDKMVRHFAKKSCGIYE---PEFRLFMVLPAGLSTALGLMGFGWSAQAH 481
            ++GS  A P  +K     A++     E    E RL  ++        GL  + WS+   
Sbjct: 412 GVIGSTVAAPFLNKDYVKRAQRYLDRGEVPPAELRLIPMMIGCWFVPAGLFAYAWSSYPR 471

Query: 482 DAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
            +W  P       GFG ++    A  + VDSY+ YA   L     ++++ G A   F  +
Sbjct: 472 LSWAGPCFSGFACGFGFNMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFTIQ 531

Query: 542 FNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
              +  Y+    +   + L  C      Y YG R R+
Sbjct: 532 MYRRLNYEWASTLMAFISLACCAIPYLFYFYGARIRQ 568

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 10/166 (6%)

Query: 369 FVLFCYPAVLFG----AFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVG 424
           F L  YP VL      A L++    + +  +  + T YG     +SS + GL Y+ P V 
Sbjct: 436 FSLLKYPPVLITSIGTALLFANYYAFSVTFSYYLQTQYG-----YSSFKTGLAYICPGVA 490

Query: 425 SILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDA 483
            ++GS   G LSD +   + K       P EFRL++ +   +    G +G+GW+ Q H++
Sbjct: 491 MLIGSQTGGHLSDYIRARWIKTHENRRFPSEFRLYLQIWGIVINTAGCIGYGWTIQKHNS 550

Query: 484 WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKN 529
            I   +F  +  FG +  S T +T+  +     A  A+    + +N
Sbjct: 551 IIWSYVFAAMNAFGLTWCSNTTMTYLTELLARRAATAVALSTMFRN 596

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 36/85 (42%)

Query: 178 RIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRH 237
           RI      S++ S+ + TV +I     R   + ++              A  +    +  
Sbjct: 268 RIFQAFSSSSVMSMGAGTVTDITAPKHRGKAIAYFMMGPNMGPIVAPIIAGVILINDNWR 327

Query: 238 WLFWIVTIIVGVNFMLHVLFVPETF 262
           WLF   +I+ GV F L ++F+PET 
Sbjct: 328 WLFGFTSIMSGVAFFLVLVFLPETL 352

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 102/522 (19%), Positives = 188/522 (36%), Gaps = 76/522 (14%)

Query: 67  SKSKRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLV 124
           +   ++P NWP+W R   T L      C   G  +S +  G   +  +FH S        
Sbjct: 165 TNDPQNPHNWPLWIRWGYTILLSCLVICVAYG--SSCITGGFGTVEDKFHVSQEAAILSC 222

Query: 125 XXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLG 184
                      ++ SP + ++G+R+ Y V           CA++ N   LL  R + G+ 
Sbjct: 223 SLMVIGFAVGPLLWSPVSDLYGRRVAYFVSMGLYTIFNIPCALAPNLGCLLVCRFLCGVF 282

Query: 185 VSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIV 243
            ++   L   ++A+++ +  R   + F+                F+     R   +FW+ 
Sbjct: 283 SASGLCLVGGSIADMFPSATRGKAIAFFAWAPYAGPCTGPLVNGFISVSTGRMDLIFWVN 342

Query: 244 TIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEE 303
               GV +++    +PET+    PV  +R        RAA   ++        PK   E+
Sbjct: 343 MAFAGVMWIVSSA-IPETY---APVILKR--------RAAKLRKETG-----NPKIMTEQ 385

Query: 304 DAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIM 363
           +A                             +   ++ ++ LV  L        V + ++
Sbjct: 386 EA---------------------------QGVNFQDMVKACLVRPL-----EFCVTEPVL 413

Query: 364 VMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFV 423
           VM       C+   L  + LY+    + ++  ++         Y +    +GL+ +   +
Sbjct: 414 VMT------CFYVCLIYSLLYAFFFAFPVVFGEL---------YDYGDNYVGLMMIPILI 458

Query: 424 GSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA 483
           G+    L       K +    K+      PE RL   +      A+ L   G +++    
Sbjct: 459 GACFALLFTFYCEKKYLSLIEKRR---PTPEDRLLGAMIGAPFAAIALWILGATSEKSVM 515

Query: 484 WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFN 543
           W+ P       GFG  L   +   + +D Y  +A  AL T   L++  G AF  F T+  
Sbjct: 516 WVGPASSGLSFGFGMVLIYYSLNNYIIDCYVQFASSALATKVFLRSAGGAAFPLFTTQMY 575

Query: 544 VKSG--YKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSK 583
            K G  + +  + + C  +I   F      +GK+ R     K
Sbjct: 576 HKLGLHWASWLLAFICTAMIALPFGFA--AWGKKLRHKLSKK 615

>Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 80/198 (40%), Gaps = 14/198 (7%)

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSI-QIGLVYVS-PFVGSILGSLCAGP---LSDKM 439
            LAIV+L  VA          PY F  +   G + V+  ++G ++G L + P   L  K 
Sbjct: 317 ELAIVYLYFVAF---------PYVFKKLYNFGPMAVACSYIGIMVGMLLSAPTCLLFQKT 367

Query: 440 VRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSS 499
                K++ G+  PE R   +      T +GL  F ++   H  WIAP I   V G G  
Sbjct: 368 FERRVKRNNGVKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWIAPIIGSAVFGSGVY 427

Query: 500 LASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVE 559
              T    +TVD+Y+ YA   +     ++ +M   F  F  +     G      +   V 
Sbjct: 428 FVFTGVFAYTVDAYRRYAASGMACNTFVRCIMAGVFPLFGLQMYKAMGVNWAGFLLAMVT 487

Query: 560 LIVCLFAIPLYHYGKRAR 577
           +++         YG R R
Sbjct: 488 VLMIPIPFLFTKYGARLR 505

>Smik_8.117 Chr8 (181800..183344) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 79/194 (40%), Gaps = 6/194 (3%)

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS-LCAGPLSDKMVRHF 443
            LAI++L  VA     V+    Y+F  ++I   Y+   VG IL +  C   L  K     
Sbjct: 317 ELAIIYLYFVA--FPYVF-KKLYNFGPMEIACSYIGIMVGMILSAPTCL--LFQKTFEWR 371

Query: 444 AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLAST 503
            K++ GI  PE R   +      T +GL  F ++   H  WIAP I   + G G     T
Sbjct: 372 VKRNNGIKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWIAPIIGSAIFGSGVYFVFT 431

Query: 504 TAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVC 563
               +TVD+Y+ YA   +     ++ +M   F  F  +     G      +   V +++ 
Sbjct: 432 GVFAYTVDAYRRYAASGMACNTFVRCIMAGIFPLFGLQMYEAMGVNWAGFLLAMVTVVMI 491

Query: 564 LFAIPLYHYGKRAR 577
                   YG R R
Sbjct: 492 PVPFLFTKYGPRLR 505

>Kpol_1044.21 s1044 (47355..49118) [1764 bp, 587 aa] {ON}
           (47355..49118) [1764 nt, 588 aa]
          Length = 587

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 93/216 (43%), Gaps = 11/216 (5%)

Query: 367 RPF-VLFCYPAVLFGAFL--YSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFV 423
           RP  +LF  P +    F   Y   I++L++ AQ I  V G   Y F+     L  +S  V
Sbjct: 367 RPLKMLFTEPVIAMLTFYDSYCYGILYLLLEAQPIIYVEG---YGFNR-NGALPSISVIV 422

Query: 424 GSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA 483
           G I+ ++      ++ ++   KK  G   PE RL  V+    +  +G++   W+   HD 
Sbjct: 423 GMIICTVYVWVGDNRYIKAAEKK--GKLLPELRLREVITCSFAMPIGVLWLTWTGHYHDR 480

Query: 484 --WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
             WI P I    VGFG   +    + + ++SY   A  AL     ++ + G  F  F   
Sbjct: 481 IHWIVPVIADAFVGFGLLGSLLQCVNYLIESYFYLAASALAANTFMRAIFGGTFILFCRP 540

Query: 542 FNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
                G     ++ G V +++    + LY  G++ R
Sbjct: 541 MFATMGTNFAGLLLGIVAIVLIPVPVLLYFKGEKMR 576

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 65/176 (36%), Gaps = 3/176 (1%)

Query: 70  KRDPL---NWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           K DPL   NW +  R    F++G         +S    G   +  E+H         V  
Sbjct: 130 KDDPLHPFNWSLKLRIFICFILGLDVINVAVASSNFVFGVPQITEEYHVGQDTAMLGVTL 189

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    II +P + I+G+++V LV            A  ++ ++LL  R   GL  S
Sbjct: 190 FVLGFAGAPIIYAPLSEIYGRQMVILVSAFGTAVFQFAVATGKDIQTLLICRFFGGLVGS 249

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWI 242
               +  A  A+++    RA  +  ++              +++ ++    WL +I
Sbjct: 250 APFVVVPAMFADLFDTDIRAKAVCLFSLGTLAGPVMTPIFGTYITQHTTWRWLDYI 305

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 99/514 (19%), Positives = 179/514 (34%), Gaps = 70/514 (13%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VX 125
           +    +P NWP+W R      +          +S +  G   +  +FH   S +S L   
Sbjct: 227 TNDPENPHNWPLWLRWVYTITLSMLVICVAYGSSCITGGLFTVQEKFHVG-SVVSILSCS 285

Query: 126 XXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                     +I SP + I+G+R+ Y V           CA+  N  +L+  R   G+  
Sbjct: 286 LMVLGFSFGPLIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAIPNNIATLMICRFFCGVWS 345

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVT 244
           S+   L   ++A+++ +  R   + F+                F+     R   +FW+  
Sbjct: 346 SSGLCLVGGSLADMFPSETRGRAIAFFAYAPYCGPVFGPLVNGFISISTRRMDLIFWVNM 405

Query: 245 IIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEED 304
              G  +++ V  +PETF    PV  ++        RAA   ++        PK   E++
Sbjct: 406 AFAGAMWII-VALIPETF---APVILKK--------RAAKLRKETG-----NPKIMTEQE 448

Query: 305 AXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMV 364
           A                             I+ S + +  ++  L        +D     
Sbjct: 449 A---------------------------QGIEFSAMMKDCVIRPLYFAVTEPVLD----- 476

Query: 365 MLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVG 424
                 L C+   L  + LY+    + ++  ++         Y +    +GL+ +   +G
Sbjct: 477 ------LTCFYVCLIYSLLYAFFFAFPVIFGEL---------YDYKDNLVGLMLIPILIG 521

Query: 425 SILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAW 484
           + L         +  +    K+      PE RL   +      A  L   G ++  H  W
Sbjct: 522 ASLALATTFYCENVYLAIIRKRKP---TPEDRLLGAMIGAPFAAAALWILGATSYKHIIW 578

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNV 544
           + P       G+G  L   +   + +D Y  YA  AL T   L++  G AF  F  +   
Sbjct: 579 VGPASSGLAFGYGMVLIYYSLNNYIIDCYAQYASSALATKVFLRSAGGAAFPLFTPQMYH 638

Query: 545 KSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           + G +    +   +   + LF    Y YGK  R+
Sbjct: 639 RLGLQWASWLLAFISTAMILFPFSFYVYGKGWRK 672

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 1/156 (0%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCG-IYEPEFRLFMVLPAGL 465
           Y+ SS Q+G  YV P V  +LGSL  G LSD   + + KK+    + P  RL + +   L
Sbjct: 422 YNLSSFQVGAAYVCPGVALLLGSLTGGHLSDYFRKRWLKKNEDQKFSPARRLKLQVWGLL 481

Query: 466 STALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
            +  G +G+GWS + H   +   +F  ++ FG +  S   +T+  ++    A   +   +
Sbjct: 482 ISMCGCIGYGWSIERHYHLVVVLVFSFLIAFGMTWCSNATMTYLTETIPKRAAGTVAVSS 541

Query: 526 VLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
             +N+     +    K   + G    F   G  +LI
Sbjct: 542 FFRNIAAAISAVIIMKLCERMGIGWCFTGLGLCDLI 577

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 47/119 (39%), Gaps = 2/119 (1%)

Query: 146 GKRIVYLVXXXXXXXXX-XXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++ +Y+V             AV  N  +L   RI    G S++ SL   TV++I     
Sbjct: 203 GRKFLYIVSLLLTIIVNILLSAVPTNIGALFFLRIAQAFGSSSVMSLGIGTVSDITPPKS 262

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
           R   + ++              A  +    +   WLF  + II G+   L VL +PET 
Sbjct: 263 RGRAVSYFMLGPNMGPILAPIIAGLILMSSNNWRWLFGFICIISGIALFLVVLLLPETL 321

>ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 76/171 (44%), Gaps = 10/171 (5%)

Query: 361 WIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS 420
           W M+ + P  +      L  A  Y+ ++     ++  + T      Y+ S++Q+G  YV 
Sbjct: 351 WNMMKMMPVTISSISTALLFANYYAFSVT----LSHFLQT-----DYNMSNLQVGASYVC 401

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQ 479
           P +  ++GS   G LSD M + + K       P EFRL + +   L   LG +G+GWS  
Sbjct: 402 PGIAMLIGSQSGGHLSDYMRQRWMKNHENQKFPLEFRLILQIFGILINMLGCIGYGWSID 461

Query: 480 AHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNV 530
            H       +F  +  FG +  S T +T+  +        A+   ++ +NV
Sbjct: 462 RHYHLAVILVFSALSAFGLTWCSNTTMTYLSELLTRRTAGAIAVSSLFRNV 512

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 1/99 (1%)

Query: 165 CAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXX 224
            +V  N  +L   R+    G S+  SL + TV +I     R   +G++            
Sbjct: 183 ASVPANIGALYVLRVFQAFGSSSAISLGTGTVTDITPPKHRGKAIGYFMMGPNMGPILAP 242

Query: 225 XXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
             +  +    D   WLF   +I+ G+ F+  VL +PET 
Sbjct: 243 IISGLILMESDAWRWLFGFTSIMSGIAFIAVVLILPETL 281

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 92/475 (19%), Positives = 169/475 (35%), Gaps = 72/475 (15%)

Query: 71  RDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXX 128
            +P NWP W R   T L  +   C   G  ++ ++ G   +  ++H  +           
Sbjct: 159 ENPHNWPSWVRWSYTVLLSILVICVAYG--SACISGGLGTVEKKYHVGMEAAILSCSLMV 216

Query: 129 XXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                  +I SP + ++G+R+ Y V           CA++ N   LLA R + G+  S+ 
Sbjct: 217 IGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSG 276

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIV 247
             L   ++A+++ +  R   + F+                F+     R   +FW+     
Sbjct: 277 LCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFA 336

Query: 248 GVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXX 307
           GV +++    +PET+    PV  +   R+ A  R   G           PK   E++A  
Sbjct: 337 GVMWIISSA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA-- 377

Query: 308 XXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLR 367
                                      +  S + ++ L+  L           +  V   
Sbjct: 378 -------------------------QGVSMSEMMRACLLRPL-----------YFAVTEP 401

Query: 368 PFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSIL 427
             V  C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++ 
Sbjct: 402 VLVATCFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGALW 452

Query: 428 GSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAP 487
                    +K ++   ++      PE RL          A+ L   G +A  H  W+ P
Sbjct: 453 ALATTFYCENKYLQIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATAYKHIIWVGP 509

Query: 488 TIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
                  GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 510 ASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 564

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 98/450 (21%), Positives = 161/450 (35%), Gaps = 80/450 (17%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSAT 195
           +I SP + I+G+R+ Y V           CAV++N ++L+  R   G+  S+   L   +
Sbjct: 223 LIWSPVSDIYGRRVAYFVSMFLYVIFNIPCAVAKNPQTLMICRFFCGVWASSGLCLVGGS 282

Query: 196 VAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLH 254
           +A+++    R   + F+                F+     R   +FW+     GV +++ 
Sbjct: 283 IADMFPNDTRGRAIAFFAYAPYCGPVFGPLVNGFISVSTGRMDLIFWVNMAFAGVMWII- 341

Query: 255 VLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXX 314
           V  +PET+    PV  +R   + A  R   G           PK   E++A         
Sbjct: 342 VALIPETY---APVILKR---KAAKLRKETGN----------PKIMTEQEAQGLSLNEML 385

Query: 315 XXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCY 374
               V P                                       +  V      L C+
Sbjct: 386 KACCVRPL--------------------------------------YFAVTEPVLDLTCF 407

Query: 375 PAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGP 434
             +L  + LY     + ++  ++         Y +     GL+++   +G+ L +LC   
Sbjct: 408 YVMLIYSLLYGFFFAFPVIFGEL---------YDYKDNLTGLMFIPILIGASL-ALCTTF 457

Query: 435 LSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVV 494
             +   ++ A        PE RL   +      A+ L   G +A     W+AP       
Sbjct: 458 YCEN--KYLAITRRRKPNPEDRLLGAMIGAPFAAISLWMLGATATKKVIWVAPASSGLPF 515

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSG-----YK 549
           G+G  L   +   + +D Y  YA  AL T   L++  G AF  F T+     G     + 
Sbjct: 516 GYGMVLIYYSLNNYIIDCYAQYASSALATKVFLRSAGGAAFPLFTTQMYHNLGLHWASWL 575

Query: 550 TTFIVYGCVELIVCLFAIPLYHYGK--RAR 577
             FI  G V LI  LF    Y +GK  RAR
Sbjct: 576 LAFIASGMV-LIPYLF----YTFGKGLRAR 600

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 117/521 (22%), Positives = 190/521 (36%), Gaps = 85/521 (16%)

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
           + L  EF+   + ++  V            ++   A +FG+R + L             A
Sbjct: 126 RQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGLA 185

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            + +Y  +   R +  +G+S   ++ S  V +    HER   +G  +             
Sbjct: 186 CAPSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGLVLLGQCFGSLI 245

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGA 286
            + +    D   +FW + I  GV  ++    +PET   RT V N  SI+   I       
Sbjct: 246 GAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPET--KRTIVGN-LSIKPKNILN----- 297

Query: 287 RDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLV 346
                    AP F                            L  V+ + K  N       
Sbjct: 298 --------RAPVF---------------------------LLKPVQKRFKYDN------- 315

Query: 347 TGLGIFHGRHSVDKWI--MVMLRPFVLFCYPAVLFGAFLYSLAI-VWLIMVAQIINTVYG 403
                     ++DK I  + +   F +   P +L   F   L   +W +M++ I +T+  
Sbjct: 316 ------PDYETLDKTIPRLDLASAFKICALPEILLSLFPAGLQFALWTLMLSSISSTLSA 369

Query: 404 NPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMVRHFAKKSCGIYEPE----- 454
            PPY++    IG+ Y+   VG +LGS+  G   D    K +R F KK      PE     
Sbjct: 370 -PPYNYRLTIIGVCYLPGGVGGLLGSMLTGRFLDYIYKKALRDFEKKKQNGTIPENEEFN 428

Query: 455 ---FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG--VVGFGSSLASTTAITFT 509
               RL  ++P      +  + FGWS  A   W  P + +   V  F +    +++ T  
Sbjct: 429 TIKVRLNAIIPQNFIAVISFLLFGWS--ADKGWKIPAMLITSCVSSFCAMSTLSSSTTLL 486

Query: 510 VDSYKCYAQEALVTLNVLKNVMGFAF--SFFNTKFNVKSGYKTTFIVYGCVELIVCLFAI 567
           VD Y   A  A    N ++  +   F   F   KF +  G   TF+V G + +   L  I
Sbjct: 487 VDLYPKKASTASSCFNFIRCSLSSIFMGCFAKMKFAMTVGGTFTFMV-GLILVGNFLMLI 545

Query: 568 PLYHYGKRARRWTDSK--GLLDFSYVKKNHSRGSTGDRHME 606
           P+  YG   RR  ++K   LL+    K N S     D + +
Sbjct: 546 PM-KYGMEWRREREAKEQALLE---QKLNESMDGNDDDNSQ 582

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 102/536 (19%), Positives = 187/536 (34%), Gaps = 88/536 (16%)

Query: 10  PKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNPQPSKS 69
           P +N+D+  +  N + K              G  D+AP   G+    +    +   P   
Sbjct: 123 PSSNEDALESDNNEKGKE---------GDSSGANDEAP---GLDPEIEFVTFVTDDP--- 167

Query: 70  KRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXX 127
             +P NWP W R   T L  +   C   G  ++ ++ G   +  ++H  L          
Sbjct: 168 -ENPHNWPGWIRWSYTVLLSILVICVAYG--SACISGGLGTVQKKYHVGLEAAILSCSLM 224

Query: 128 XXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVST 187
                   +I SP + ++G+R+ Y V           CA++ N   LL  R + G+  S+
Sbjct: 225 VLGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLVCRFLCGVWSSS 284

Query: 188 IESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTII 246
              L   ++A+++ +  R   + F+                F+     R   +FW+    
Sbjct: 285 GLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAF 344

Query: 247 VGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAX 306
            GV +++    +PET+    PV  +   R+ A  R   G           PK   E++A 
Sbjct: 345 AGVMWIIASA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQEA- 386

Query: 307 XXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVML 366
                                            I+   ++    +     SV + ++V  
Sbjct: 387 -------------------------------QGISMGEMMKACLLRPLYFSVTEPVLVAT 415

Query: 367 RPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSI 426
                 C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++
Sbjct: 416 ------CFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVIGAL 460

Query: 427 LGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
                     +K +    ++      PE RL          A+ L   G +A  H  W+ 
Sbjct: 461 WALATTFYCENKYLAIVKQRKP---TPEDRLMGAKIGAPFAAIALWILGATAYKHIIWVG 517

Query: 487 PTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
           P       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 518 PASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 573

>Skud_8.107 Chr8 (179754..181322) [1569 bp, 522 aa] {ON} YHR048W
           (REAL)
          Length = 522

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 80/196 (40%), Gaps = 10/196 (5%)

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGP---LSDKMVR 441
            LAI++L  VA     V+    Y+F  ++I   Y+    G ++G L + P   L  K  +
Sbjct: 325 ELAIIYLYFVA--FPYVF-KKLYNFGPMEIACSYI----GIMVGMLLSAPTCLLFQKTFQ 377

Query: 442 HFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLA 501
              K++ G+  PE R   +      T +GL  F ++   H  WIAP I   + G G    
Sbjct: 378 WRVKRNNGVKTPEMRFEPLFYGAFLTPIGLFIFAFTCYKHVHWIAPVIGSAIFGSGVYFV 437

Query: 502 STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELI 561
            T    +TVD+Y+ YA   +     ++ +M   F  F  +     G      +   V + 
Sbjct: 438 FTGVFAYTVDAYRKYAASGMACNTFVRCIMAGVFPLFGLQMYEAMGVNWAGFLLAMVTVA 497

Query: 562 VCLFAIPLYHYGKRAR 577
           +         YG R R
Sbjct: 498 MIPVPFLFTKYGARLR 513

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 78/194 (40%), Gaps = 6/194 (3%)

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS-LCAGPLSDKMVRHF 443
            LAI++L  VA     V+    Y+F  ++I   Y+   VG IL +  C   L  K     
Sbjct: 317 ELAIIYLYFVA--FPYVF-KKLYNFGPMEIACSYIGIMVGMILSAPTCL--LFQKTFEWR 371

Query: 444 AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLAST 503
            K++ G+  PE R   +      T +GL  F ++   H  WIAP I   + G G     T
Sbjct: 372 VKRNNGVKTPEMRFEPLFYGAFLTPVGLFIFAFTCYKHVHWIAPIIGSAIFGSGVYFVFT 431

Query: 504 TAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVC 563
               +TVD+Y+ YA   +     ++ +M   F  F  +     G      +   V + + 
Sbjct: 432 GVFAYTVDAYRRYAASGMACNTFVRCIMAGVFPLFGLQMYKSMGVNWAGFLLAMVTVAMI 491

Query: 564 LFAIPLYHYGKRAR 577
                   YG R R
Sbjct: 492 PVPFLFTKYGARLR 505

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGL 465
           Y  +++QIG  YV P V  +LGS+  G LSD   + + K+  G   P E RL + +   L
Sbjct: 392 YGLTNLQIGACYVCPGVALLLGSIIGGHLSDYFRKLWVKRHNGEKFPSEKRLVLQIWGLL 451

Query: 466 STALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
               G +G+GWS Q H   +   +F     FG +  S T++T+  +   C  + A  T+ 
Sbjct: 452 LNICGCVGYGWSVQFHHHLVVVLVFSFFTAFGMTWCSNTSMTYLTE---CVPRRAAGTVA 508

Query: 526 V 526
           V
Sbjct: 509 V 509

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 48/119 (40%), Gaps = 2/119 (1%)

Query: 146 GKRIVYLVXXXXXXXXXXXCA-VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           G++I+Y++            A V  N  +L   R+V     S++ +L + TV++I     
Sbjct: 172 GRKILYMISLLMTVVVNVLLASVPVNVGALFTLRVVQAFASSSVMALGAGTVSDIRPPKV 231

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
           R   + ++              A  +  +     WLF    I+ G   ++ V+ +PET 
Sbjct: 232 RGKAIAYFMLGPNMGPILAPIIAGLILMHGSYWRWLFGFTCILSGFGLLMVVVLLPETL 290

>Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 77/383 (20%), Positives = 135/383 (35%), Gaps = 74/383 (19%)

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           AV  N  +L   R+      S++ SL + TV ++     R   + ++             
Sbjct: 195 AVPVNIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPNMGPIIAPI 254

Query: 226 XASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAAD 284
            A  +    D   WLF    II G+  +L    +PET                       
Sbjct: 255 VAGLILMKGDYWRWLFGFTAIIAGIALILVSALLPETL---------------------- 292

Query: 285 GARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSH 344
                 I G   P++  +++                        ++  + +K + I + H
Sbjct: 293 ----RCIVGNGDPRWSEKKNESK---------------------NKEHSSVKGNEILRWH 327

Query: 345 LVTGLGIFHG-------RHSVDK---------WIMVMLRPFVLFCYPAVLFGAFLYSLAI 388
           L   +GI          R    K         W M+   P ++      L  +  Y+ ++
Sbjct: 328 LFPDMGIRKPVTNDQFFRQKFPKPPKAGITLYWKMIKCPPILITSISTALLFSSYYAFSV 387

Query: 389 VWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSC 448
            +         + Y    Y F+ ++IG  YV P V  +LGS   G LSD +   + K   
Sbjct: 388 TF---------SYYLENDYHFTMLEIGAAYVCPGVAMLLGSQSGGHLSDYLRSRWIKSHP 438

Query: 449 GIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAIT 507
               P E RL + L   L T  G +G+GWS   H  ++   +F  +  FG +  S T++T
Sbjct: 439 EKKFPAECRLLLNLVGILLTICGTVGYGWSIFFHYHFVVLLVFSALTAFGMTWCSNTSMT 498

Query: 508 FTVDSYKCYAQEALVTLNVLKNV 530
           +  + +   A   +   +  +N+
Sbjct: 499 YLTELFPKRAAGTVAVSSFFRNI 521

>SAKL0G10758g Chr7 (913417..915018) [1602 bp, 533 aa] {ON} similar
           to uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 533

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 83/208 (39%), Gaps = 19/208 (9%)

Query: 386 LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHF 443
           LAIV++  VA   I  T+Y      F  +++   Y+    G   G L   P S      +
Sbjct: 335 LAIVYMYFVAFPYIFETLY-----QFKIMEVACCYL----GLAAGMLVVSPSSLYFQYKY 385

Query: 444 AKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSL 500
            +K   + GI  PEFR   +     +T +GLM F W+  +H  WI P I   + G G   
Sbjct: 386 EEKVRRNNGIRVPEFRFDPLFYGAFATPIGLMIFAWTCYSHVHWIGPVIGTSIFGAGVFF 445

Query: 501 ASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVEL 560
                  +TVD+Y+ Y   A+   + +++ M   F  F  +     G      +   V +
Sbjct: 446 VFVGVFGYTVDAYRLYTASAMACNSFVRSTMSGIFPLFGLQMYKGMGINWAGFLLAMVAI 505

Query: 561 IVCLFAIPLYHYGKRARR-----WTDSK 583
            +       + YG   R      W D++
Sbjct: 506 AMIPIPFLFHKYGPYLRSKSPYAWDDAR 533

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 98/450 (21%), Positives = 160/450 (35%), Gaps = 68/450 (15%)

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
           K L  +F+ S   ++  V            I+   A ++G+R V L+            A
Sbjct: 111 KQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRRPVILMGMLIYVCASIGLA 170

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            SQ+Y  ++  R +   G+S I ++ S  V +    HER   +G  +             
Sbjct: 171 CSQSYGVIVFLRCLQSAGISPIIAINSGVVGDFTLKHERGTFVGAVSGFTLMGQAFGSLI 230

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGA 286
            + +    D   +FW +TI  G   +++ L +PET   RT V N  SIR   +       
Sbjct: 231 GAALTAAFDWRAIFWFLTIGCGTCMIINFLILPET--KRTLVGN-LSIRPKRLIN----- 282

Query: 287 RDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLV 346
                    AP                              L  VR K+   N     L 
Sbjct: 283 --------RAPIL---------------------------LLKSVRRKLHFDNPDYETLD 307

Query: 347 TGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAI-VWLIMVAQIINTVYGNP 405
              G       VD      +  F +  +P ++       L   +W I +A I ++     
Sbjct: 308 PNKG------KVDP-----ISAFKIILHPEIILSLMPAGLQFALWTITLASI-SSQLSVT 355

Query: 406 PYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMVRHF-AKKSCGI--YEPEF--- 455
           PY+F    IG+ Y+   +G ++GS   G + D    + +R F  KK  GI   + +F   
Sbjct: 356 PYNFKLTIIGICYLPSGIGGLIGSFVTGKVIDIYYRRALRRFEEKKEQGIIPIDSKFNTL 415

Query: 456 --RLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSY 513
             RLF  +P      +    FGWS +       P I   +  F +    +++ T  VD Y
Sbjct: 416 RARLFTSIPQNFLAVIAFTLFGWSVERGWNIAVPLITSAIGSFCAMSTLSSSSTLLVDLY 475

Query: 514 KCYAQEALVTLNVLKNVMGFAFSFFNTKFN 543
              +  A    N ++  +   F    +K N
Sbjct: 476 PSKSSTATSCYNFIRCSLSAIFMACLSKMN 505

>TBLA0E02520 Chr5 complement(632027..633718) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 107/533 (20%), Positives = 183/533 (34%), Gaps = 96/533 (18%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +PLNW  W++   +F V     +    +SI   G + +  EFH      +  +      
Sbjct: 108 ENPLNWKPWKKGLIMFEVMLLTSINYMGSSIYTPGQEEIQREFHVGHVVATLNLSMYVLG 167

Query: 131 XXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                +I SP +    FG+  +Y++            A   N   L+  R +SG+  S  
Sbjct: 168 YGIGPMILSPLSEYARFGRLHIYIISMFLFTIFQIGAATVHNIGGLIVIRFISGILCSPA 227

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            +    T+A+          +G ++              + +    D  W+FW++  +  
Sbjct: 228 LATGGGTLADFLDPKTLPRYIGLWSLGFMSAPVSAPLLGACMVVAKDWRWIFWLLLFMSV 287

Query: 249 VNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXX 308
             F++ + F PET                 + R A   R                     
Sbjct: 288 ALFVMLIFFFPETH------------HGNILHRRAQRLRK-------------------- 315

Query: 309 XXXXXXXXXXVTPTQSHRYLS-RVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLR 367
                        T   RY + ++R +   +          LG F  +  +  + +++  
Sbjct: 316 ------------ETGDDRYYTLQIREEANLT----------LGPFLKKCLLKPFKLIIQE 353

Query: 368 PFVLF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
           P +L    Y AV +G F        L+ V            Y+F+ I++GL Y    +G 
Sbjct: 354 PIILSFDLYLAVCYGIFYLFFEAFPLVFVGI----------YNFTLIELGLSY----LGF 399

Query: 426 ILGSLCAGPLSDKMVRHF--AKKSCGIYEPEFRLFMVLPAGLS--TALGLMGFGWSAQAH 481
            +G + A P+       F   K +   + PE   FMVL   +     L L  FGW+A+ H
Sbjct: 400 CVGCVFAYPIFLTFFNKFITPKFANNTFTPEH--FMVLSKYICWFLPLALFFFGWTAKVH 457

Query: 482 DAWIAPTI-----FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
             WI P I      +GV     +L S  A+ +T      YA          +++   AF 
Sbjct: 458 --WILPIISEMFFVIGVFNLFQTLFSYLALCYTEHLSSVYAGNGF-----FRSIFASAFP 510

Query: 537 FFNTKFNVKSGYKTTFIVYGC-----VELIVCLFAIPLYHYGKRARRWTDSKG 584
            F        G K   + +G      + + + L  I +Y YG   R  +   G
Sbjct: 511 LFGQAMFNNLGTKNYPVAWGSSLLGFIAIGLTLIPIVIYKYGGYLRSKSSFSG 563

>TPHA0K02160 Chr11 complement(461256..463082) [1827 bp, 608 aa] {ON}
           Anc_4.30 YLL028W
          Length = 608

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 106/241 (43%), Gaps = 24/241 (9%)

Query: 353 HGRH-----SVDKWIMVML-RPFVLFCYPAVL-----FGAFLYSLAIVWLIMVAQIINTV 401
           H  H     ++D+ I  M+ RP V+     VL     + +F+Y   I++L++ A  I  +
Sbjct: 369 HASHENVELTIDEIITNMITRPLVMLVKEPVLLVVSIYNSFVY--GILYLLLEAYPIVFI 426

Query: 402 YGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPL--SDKMVRHFAKKSCGIYEPEFRLFM 459
            G   Y F+     L Y++  +G IL   C   +  SD       +++ G   PE RLF 
Sbjct: 427 QG---YGFTK-NGELPYLALIIGMIL---CTAFIWYSDIDYLKRVEQNQGHVVPEARLFP 479

Query: 460 VLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYA 517
           ++ AG+   +GL+ F W+   + +  WI PTI    +GFG        + + ++SY    
Sbjct: 480 MIVAGILFPIGLLWFTWTGNYYTSIHWIVPTIAGSFIGFGLIGIFLPCLNYIIESYLYLT 539

Query: 518 QEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
             A+     L++  G +F  F        G     ++ G V +++    + L  YGK  R
Sbjct: 540 ASAVAANTFLRSAFGASFPLFAGYMFKGMGVNFAGLLLGLVAIVLIPVPLFLLRYGKAIR 599

Query: 578 R 578
            
Sbjct: 600 E 600

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 63/142 (44%), Gaps = 2/142 (1%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGL-GVSTIESLPSA 194
           II +P + +FG++ V L+            A + N +++L  R  +GL G + I  +P A
Sbjct: 221 IIFAPLSELFGRQKVILISSFGNALFQYAVATAANLQTILICRFFAGLIGAAPIAVVP-A 279

Query: 195 TVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLH 254
             A+I+  + R   +  ++              S++ ++    W  ++++ +     +L 
Sbjct: 280 VFADIFDTNIRGKAIALFSLGVFIGPILGPIIGSYIVQHTTWRWTEYVISFLSTFVTLLI 339

Query: 255 VLFVPETFWDRTPVPNERSIRE 276
           +LF+ ET      V   + +R+
Sbjct: 340 LLFLEETHHPIILVNKAKKLRK 361

>KNAG0B04900 Chr2 (940751..942301) [1551 bp, 516 aa] {ON} 
          Length = 516

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 89/205 (43%), Gaps = 18/205 (8%)

Query: 367 RPFVLFCYPAVLFGAFLYS---LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSP 421
           RPF+L     ++     Y+   LAI++L  VA   I  T+Y      F+ +Q   +Y+  
Sbjct: 298 RPFMLLFRDPMMAVLCFYTGLELAIIYLYFVAFPYIYQTLY-----RFTVMQSACMYIGL 352

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
            VG IL    A P S  + R +  K   + G+  PE R   +    + + +GLM F W+ 
Sbjct: 353 MVGMIL----ATPTSVLIQRRYEAKVAQNGGVSVPEMRFDPLFYGAILSPVGLMIFAWTL 408

Query: 479 QAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
            +H  WI   I   + G G          +TVD+Y+ YA   +   + ++ VM   F  F
Sbjct: 409 YSHVHWIGSMIGSALFGAGVLYVFIGIFNYTVDAYRRYAASGMACNSFVRCVMAGVFPLF 468

Query: 539 NTKFNVKSGYK-TTFIVYGCVELIV 562
             +     G    +F++  C   +V
Sbjct: 469 GLQMYEGMGINWASFLIAMCTLAMV 493

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 60/162 (37%), Gaps = 18/162 (11%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           SP + ++G+R  ++               S+    ++  R +SG   S+  S+    +++
Sbjct: 132 SPISELYGRRATFIFSLTLSIVWQCLTTWSRTLTGVMFGRFLSGFFGSSFLSVAGGAISD 191

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           I+   +    +  YT             +  ++  +D  W F    I  GV  +  V+ +
Sbjct: 192 IFLKSQITVPMSLYTTAAMMGPSLGPIISGALYT-VDFRWTFVTFIIASGVCLVAIVVTI 250

Query: 259 PETFW-----------------DRTPVPNERSIRETAIARAA 283
           PET+                  DR   P E + RET+   AA
Sbjct: 251 PETYRPLLLINKARRFRKETGDDRYFAPLEVTRRETSFLSAA 292

>NCAS0A06580 Chr1 (1303456..1305042) [1587 bp, 528 aa] {ON}
           Anc_5.284
          Length = 528

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/454 (18%), Positives = 164/454 (36%), Gaps = 80/454 (17%)

Query: 139 SPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAE 198
           SP +  +G+R  ++               S+  E ++  R +SG   ST  S+   ++++
Sbjct: 144 SPISEFYGRRPTFIFSLTVSIIWQCLTTWSRTIEGMMFGRFLSGFFGSTFLSVAGGSISD 203

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFV 258
           I+        +  YT             +  +++ +D  W F  + I  GV   L ++ V
Sbjct: 204 IFDKDSITVPMAIYTTSAMLGPELGPIISGALYK-VDYKWTFVTLLIASGVCLALIIVTV 262

Query: 259 PETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXX 318
           PET+  +  +   + +RE                                          
Sbjct: 263 PETYEPKLLIKKAQRLREE----------------------------------------- 281

Query: 319 VTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFV-LFCYPAV 377
              T   R+++ +    K ++   S  ++         S   +++++  P + + C+   
Sbjct: 282 ---TGDERWVAPLEITKKETSFMSSVFLS---------SKRPFLLLVRDPMMGVLCFYTG 329

Query: 378 LFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD 437
           L  A +Y    ++ +    I   +YG     F  +++   Y    +G ++G L A P S 
Sbjct: 330 LVLAIVY----LFFVAFPYIFKKLYG-----FHEMEVACAY----IGMLVGMLVACPTSI 376

Query: 438 KMVRHF---AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVV 494
              + +    K + G   PE R   +      + +GL+ F W+  +H  WI P I  GV 
Sbjct: 377 IFQKRYELKVKANNGERTPEMRFEPLFYGAFLSPVGLLIFAWTCYSHVHWIGPIIGSGVF 436

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIV 554
           G G          +TVD+Y+ +A   +   + +++ M   F  F  +     G      +
Sbjct: 437 GTGVFFVFVGVFNYTVDAYRRFAASGMACNSFVRSTMSGVFPLFGLQMYEGMGINWASFL 496

Query: 555 YGCVELIVCLFAIPL-------YHYGKRARRWTD 581
              V ++  +  +P        Y  GK    WTD
Sbjct: 497 LAMVTML--MIPVPFLFTKYGAYLRGKSPYAWTD 528

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/473 (18%), Positives = 166/473 (35%), Gaps = 68/473 (14%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +P NWP W R T   ++          ++ ++ G   +  +FH  +             
Sbjct: 158 ENPHNWPGWIRWTYTVLLSILVICVAYGSACISGGLGTVEKKFHVGMEAAILSCSLMVIG 217

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +I SP + ++G+R+ Y V           CA++ N   LLA R + G+  S+   
Sbjct: 218 FSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLACRFLCGVWSSSGLC 277

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGV 249
           L   ++A+++ +  R   + F+                F+     R   +FW+     GV
Sbjct: 278 LVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVNMAFAGV 337

Query: 250 NFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXX 309
            +++  L +PET+    PV  +   R+    R   G           PK   E++A    
Sbjct: 338 MWIVSSL-IPETY---APVILK---RKAVRLRKETG----------NPKIMTEQEA---- 376

Query: 310 XXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPF 369
                                    +  S + ++ L+  L           +  V     
Sbjct: 377 -----------------------QGVSMSEMMRACLLRPL-----------YFAVTEPVL 402

Query: 370 VLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS 429
           V  C+   L  + LY+    + ++  ++         Y +    +GL+++   +G++   
Sbjct: 403 VATCFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNIVGLMFIPIVIGALWAL 453

Query: 430 LCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
                  +K +    ++      PE RL          A+ L   G ++  H  W+ P  
Sbjct: 454 ATTFYCENKYLAIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATSYKHIIWVGPAS 510

Query: 490 FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
                G+G  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 511 AGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSCGGAAFPLFTIQM 563

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/348 (20%), Positives = 130/348 (37%), Gaps = 43/348 (12%)

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           AV ++  +L   R+   +G S +  L   TV+++     RA  + ++             
Sbjct: 196 AVPKHLAALYILRVFQAIGTSAVIPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPILGPI 255

Query: 226 XASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAAD 284
               +    ++  WLF   +I  GV  +L V F+PET          R I      R  +
Sbjct: 256 FGGLILMNGNQWRWLFGFTSITTGVGLILIVTFLPETL---------RCIVGNGDPRWKE 306

Query: 285 GARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSH 344
            +   A           EE                 P       +++  +         +
Sbjct: 307 DSEFPASLSIEESSQTKEESVVKPHMQLFRDLGLQKPVNDTPVFAKLYPRPPKPTWRSYY 366

Query: 345 LVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGN 404
           L                  + LR  +     A+LF ++ Y  +++    ++  +++ +G 
Sbjct: 367 LT----------------FLELRVIICSISTAILFSSY-YCFSVI----LSHELHSRFG- 404

Query: 405 PPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRL-FMVLPA 463
               F+++QIG  YV P +G + GSL  G LSD     F K     + PE+RL F +   
Sbjct: 405 ----FNNLQIGACYVCPGIGLLCGSLSGGHLSD-----FFKAKSKKWIPEYRLWFQIWGL 455

Query: 464 GLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVD 511
            +S A G  GFGW+ +     +   +F  ++ FG +  S   +TF  +
Sbjct: 456 AISMA-GCCGFGWAIEKELHIVVILVFSFLLAFGMTWCSNATMTFLTE 502

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 111/555 (20%), Positives = 204/555 (36%), Gaps = 76/555 (13%)

Query: 30  IGVTGTFAMMGG----PGDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTAL 85
           +G TG+    GG    P +D   TGG  Q   + I L         +P NW + RR    
Sbjct: 97  LGRTGSAVPRGGSGTEPENDKGETGG--QELDEDIELVTFVIGDPENPHNWSLRRRWAYT 154

Query: 86  FVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIF 145
            ++          ++ + AG   +  ++  S                   ++ +P + ++
Sbjct: 155 LLLSLLVVAVAYGSACVTAGMWLITRKYDVSTEVAILSCSLVVLGYGVGQLVWAPLSDLY 214

Query: 146 GKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHER 205
           G+RI Y             CAV+ N ++LL  R + G+  S+   L   ++A+++ A  R
Sbjct: 215 GRRITYFTSLFLYVVFNIPCAVAPNIQTLLVCRFICGVLSSSGLCLVGGSLADMFPADLR 274

Query: 206 AYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETFWD 264
              + F+                F+    +R   +FW+   + G  ++L V  VPET+  
Sbjct: 275 GLTIAFFAFAPYGGPVFAPLINGFIAVRTERLDLIFWVNMALAGAVWLL-VALVPETY-- 331

Query: 265 RTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQS 324
             P+          + R A+  R          K  G ++              +   Q 
Sbjct: 332 -API---------ILKRRAEKLR----------KLTGNQN--------------IMTEQE 357

Query: 325 HRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLY 384
            + LS        S + Q+ L+  L        +D           L C+   L  + LY
Sbjct: 358 AQGLS-------LSAMVQTCLLRPLYFIFTEPVLD-----------LMCFYVCLIYSLLY 399

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFA 444
           +    + ++ +++         Y +   +IGL+++   +G+ L +L      +K  R  A
Sbjct: 400 AFFCAYPVIFSEL---------YGYKDDKIGLMFLPIIIGASL-ALATTYWCEKKYRELA 449

Query: 445 KKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTT 504
            +   +  PE RL   +     +A+ L   G ++  H  W+ P       G+G  +   +
Sbjct: 450 ARRPCV--PEDRLLGAMIGAPFSAIALWILGATSYKHIIWVGPASSGLAFGYGMVMVYYS 507

Query: 505 AITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSG--YKTTFIVYGCVELIV 562
              + +D+Y  YA  AL     L++  G AF  F  +   + G  + +  + +    LI 
Sbjct: 508 LNNYIIDTYALYASSALAAKVFLRSAGGAAFPLFTRQMYHRLGLQWASWLLAFVATALIA 567

Query: 563 CLFAIPLYHYGKRAR 577
             FA   Y    R R
Sbjct: 568 LPFAFDRYGAALRRR 582

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 1/125 (0%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEP-EFRLFMVLPAGL 465
           Y  S ++IGL YV P V  I GS   G LSD +   + K   G   P E RL + +   L
Sbjct: 357 YKLSMLKIGLSYVCPGVCMIFGSQLGGHLSDHLRARWIKTHEGQSFPLESRLVLHICGIL 416

Query: 466 STALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
               G +G+GW+ Q H       +F G++ FG +  S T +T+  +        A+   +
Sbjct: 417 INTAGCIGYGWAIQKHFHLAIVLLFSGLMAFGLTWCSNTTMTYLSELMTTKTAGAIALSS 476

Query: 526 VLKNV 530
             +NV
Sbjct: 477 FFRNV 481

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 73/180 (40%), Gaps = 2/180 (1%)

Query: 85  LFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVI 144
           +F++ +  F+G    +I       L  +F+ S + I+  V           +     A +
Sbjct: 71  MFIITFIGFLGPLSGNIYIPALPTLQKDFNVSSTVINATVSVFMAVFAVGPLFWGLFADV 130

Query: 145 FGKRIVYLVXXXXXXXXXXXCA-VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAH 203
            G++++Y+             A +  +  SL   RIV   G S++ +L + TV +I    
Sbjct: 131 GGRKVLYICSILLMVIVNILLASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPK 190

Query: 204 ERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
           +R   +G++              A  +    +   WLF +  I+ GV  +L V F+PET 
Sbjct: 191 QRGRAIGYFMIGPNMGPVLAPIIAGLILMKGNYWRWLFGLTGIMGGVGLLLIVAFLPETL 250

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 91/479 (18%), Positives = 167/479 (34%), Gaps = 72/479 (15%)

Query: 67  SKSKRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLV 124
           +    +P NWP W R   T L  +   C   G  ++ ++ G   +  ++H  +       
Sbjct: 152 TDDPENPHNWPAWIRWSYTVLLSILVICVAYG--SACISGGLGTVQKKYHVGMEAAILSC 209

Query: 125 XXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLG 184
                      +I SP + ++G+R+ Y V           CA++ N   LL  R + G+ 
Sbjct: 210 SLMVLGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLVCRFLCGVW 269

Query: 185 VSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIV 243
            S+   L   ++A+++ +  R   + F+                F+     R   +FW+ 
Sbjct: 270 SSSGLCLVGGSIADMFPSETRGKAIAFFAFAPYVGPVVGPLVNGFISVSTGRMDLIFWVN 329

Query: 244 TIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEE 303
               GV +++    +PET+    PV  +   R+ A  R   G           PK   E+
Sbjct: 330 MAFAGVMWIIASA-IPETY---APVILK---RKAARLRKETG----------NPKIMTEQ 372

Query: 304 DAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIM 363
           +A                             I    + ++ L+  L           +  
Sbjct: 373 EA---------------------------QGISMGEMMKACLLRPL-----------YFA 394

Query: 364 VMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFV 423
           V     V  C+   L  + LY+    + ++  ++         Y +    +GL+++   +
Sbjct: 395 VTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGEL---------YGYKDNLVGLMFIPIVI 445

Query: 424 GSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA 483
           G++          +K +    ++      PE RL          A+ L   G +A  H  
Sbjct: 446 GALWALATTFYCENKYLAIVKQRKP---TPEDRLLGAKIGAPFAAIALWILGATAYKHII 502

Query: 484 WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
           W+ P       GFG  L   +   + +D Y  YA  AL T   L++  G AF  F  + 
Sbjct: 503 WVGPASAGLAFGFGMVLIYYSLNNYIIDCYVQYASSALATKVFLRSAGGAAFPLFTIQM 561

>TDEL0E04480 Chr5 complement(836068..837918) [1851 bp, 616 aa] {ON} 
          Length = 616

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 92/220 (41%), Gaps = 24/220 (10%)

Query: 375 PAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSS------IQIGLVYVSPFVGSILG 428
           P +L    +  L  +++ ++  ++   +   P  +S       I+  L+++   VG +L 
Sbjct: 365 PVILLSELIVFLITLYMSIIYGLLYMFFFAYPMVYSEGKKWGDIKTSLMFIPLGVG-VLI 423

Query: 429 SLCAGPLSDKMVRHFAKKSC--GIYEP-EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWI 485
           S    P+ +K     A++    G   P E RL  ++   +   +GL  + WS+  H +W 
Sbjct: 424 STAISPILNKDYLKRAQRYIDRGEVPPAELRLIPMMIGSIFVPVGLFAYAWSSFPHVSWA 483

Query: 486 APTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVK 545
            P       GFG  +    A  + VDSY+ YA   L     ++++ G A   F  +   +
Sbjct: 484 GPCFSGMACGFGFLMLYNPANNYIVDSYQHYAASGLAAKTFVRSMWGGAVPLFTIQMYHR 543

Query: 546 SGYK-----TTFIVYGCVELIVCLFAIP--LYHYGKRARR 578
            GY+       FI   CV       AIP   Y YG R R+
Sbjct: 544 LGYEWATTLMAFISLACV-------AIPFMFYIYGARIRK 576

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 77/195 (39%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
              + DP  W   ++     ++G  CF     ++I+       A  F  S   +   V  
Sbjct: 127 EDDREDPRCWSTRQKWNLTILLGVVCFAVALMSAIITGDMTSPAEYFGVSSIVMCLCVSL 186

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVS 186
                    ++ +P +  FG+  VY             CAV++N  +LLA R + GL  S
Sbjct: 187 MVWGFGVGPLLFAPLSEEFGRNWVYHTTLLVAVVFIVPCAVAKNIGTLLAFRFLDGLAFS 246

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
               L   ++++++   ER   +  ++              S +   ++  W ++ + I 
Sbjct: 247 APMCLIGGSLSDMWRNEERGVAMSVFSAAPFIGPVMGPIIGSLLSVKINWRWPYYFMIIF 306

Query: 247 VGVNFMLHVLFVPET 261
            G  +++ V+F+PET
Sbjct: 307 SGCLYIIMVIFLPET 321

>KAFR0K00100 Chr11 complement(10324..11913) [1590 bp, 529 aa] {ON} 
          Length = 529

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 103/517 (19%), Positives = 181/517 (35%), Gaps = 80/517 (15%)

Query: 72  DPLNWPVWRRD-TALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
           +P NWP  +++   + ++   C    G +SI   G +G+  +FH      +  +      
Sbjct: 75  NPQNWPQAKKNFITIEIMMLTCITYMG-SSIYTPGQEGIQNDFHVGHVTATLNLSLYVLG 133

Query: 131 XXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                +  SP + +   G++ +Y++           CA  QN E L+  R +SG+  S  
Sbjct: 134 YGLGQVFFSPLSEVAKIGRQQLYIITYFLFMVFQIGCATVQNIEGLIILRFISGILCSPS 193

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            S   AT+A+I    +    +  +               + +    D  W FW++  +  
Sbjct: 194 LSTGGATIADIIRPEKLTPYIALWAVGAVASPTVGPLLGASMVVSKDWRWTFWLLLWLSI 253

Query: 249 VNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXX 308
              ++ + F PET           S       RAA   +    S Y     Q   DA   
Sbjct: 254 PWLIIFIFFFPET-----------SAANILSRRAARIRKQTGDSRYYTR--QERSDA--- 297

Query: 309 XXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRP 368
                     V+P Q   +++ +   I+   IA+  +V    I                 
Sbjct: 298 ---------KVSPKQ--FFVNTLYRPIEM--IAKEPIVMAFDI----------------- 327

Query: 369 FVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILG 428
                Y AV +G F        ++ +            + F+ +++GL Y+    G  + 
Sbjct: 328 -----YLAVCYGTFYLFFEAFPIVFINN----------WHFTIVELGLSYMGFIAGCFIA 372

Query: 429 SLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAP- 487
                  ++K+V    ++  G + PE  L + +        GL  FGW+A  H  WI P 
Sbjct: 373 FSILLFFTNKVVT--PRRDNGTFVPETFLLLAMSVSWCLPCGLFLFGWAAMTH--WIVPI 428

Query: 488 --TIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF-NTKFN- 543
              IF  +  F    A+    ++    Y  Y         + ++    AF  F    FN 
Sbjct: 429 IAEIFFCICVFNLFQAT---FSYLAMCYPKYVASVYAGNGLCRSAFACAFPLFGQAMFNN 485

Query: 544 -VKSGYKTTF--IVYGCVELIVCLFAIPLYHYGKRAR 577
               GY   +   + G V +++ L    LY YG   R
Sbjct: 486 LAIDGYPVAWGTSILGFVSIVLALIPFVLYKYGADLR 522

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 93/455 (20%), Positives = 159/455 (34%), Gaps = 70/455 (15%)

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           I+   A ++G+R + L             A S +Y  ++  R V   G+S + ++ S  V
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFLRCVQSAGISPLIAISSGVV 211

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVL 256
            +     ER   +G  +              + +    D   +FW +TI  G  F+++  
Sbjct: 212 GDFTTKSERGSFVGAVSGFALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGCGTCFVINFF 271

Query: 257 FVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXX 316
            +PET   RT   N     +  I RA                                  
Sbjct: 272 LLPET--KRTITGNLSIKPKRMINRA---------------------------------- 295

Query: 317 XXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPA 376
               P  +  Y  R   ++K  N     L       H    +D     ++    +  +P 
Sbjct: 296 ----PILALPYFQR---RLKYDNPDYDSLD------HSEVKID-----LISALKIIAHPE 337

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLS 436
           ++       L      +    I++     PY++S   IG+ Y+   +  ++GS C G + 
Sbjct: 338 IIMSLMPAGLQFALWTLTLTSISSQLAEAPYNYSLTIIGICYLPAGISGLIGSFCTGKVI 397

Query: 437 D----KMVRHF-AKKSCGIYEPE-------FRLFMVLPAGLSTALGLMGFGWSAQAHDAW 484
           D      +R F  ++  G+  P+        RL   LP    + +    FGWS Q     
Sbjct: 398 DIYYKSALRKFQQRQEQGLIAPDARFNILKARLITALPQNFVSVVAFTIFGWSVQKGWHI 457

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMG--FAFSFFNTKF 542
             P +  G+  F +    +T+ T  VD Y   +  A    N ++  +   F   F   K 
Sbjct: 458 AVPLVTSGIGSFCAMSTLSTSSTLLVDLYPSKSSTATSCYNFIRCSLSAIFMACFAKMKA 517

Query: 543 NVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
           ++  G   TFI  G V +   +  IPL +YG   R
Sbjct: 518 SMTVGGTFTFI-SGLVFIGNFVTLIPL-NYGMEWR 550

>TBLA0E01510 Chr5 (346010..348025) [2016 bp, 671 aa] {ON} Anc_4.30
           YLL028W
          Length = 671

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 95/213 (44%), Gaps = 15/213 (7%)

Query: 330 RVRTKIKCSNIAQSHLVTGLGI-FHGRHSVDKWI-MVMLRPFVLFCYPAVLFGAFLYSLA 387
            +R K     I  +H    L I    R +V + I M+   P +LF     ++ +F+Y   
Sbjct: 422 EIRKKTNNKMIRAAHEDVELSIKLIIRDTVSRPIVMLFTEPILLFI---TIYNSFVY--G 476

Query: 388 IVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKS 447
           I++L++ A  I  V G   Y + +  I L Y S  VG +L S     +    +R   +K 
Sbjct: 477 ILYLMLEAYPIVFVEG---YGYKTNGI-LPYCSLIVGMVLCSTFIWYMEKDYLRRVERK- 531

Query: 448 CGIYEPEFRLFMVLPAGLSTALGLMGFGWSA--QAHDAWIAPTIFLGVVGFGSSLASTTA 505
            G   PE RL+ ++P+G+  + G++ F W+   Q    W+ PTI   ++GFG        
Sbjct: 532 -GKLVPEARLYPMIPSGVLFSAGILWFCWTGAWQRRIHWVVPTIAGSLIGFGLIGIFLPC 590

Query: 506 ITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
           + + ++SY      A+     +++     F  F
Sbjct: 591 LNYIIESYLLLTASAVAANTFMRSAFAGVFPLF 623

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 76/173 (43%), Gaps = 4/173 (2%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+W+R     ++   C      +SI ++G   L  ++H  +  ++ L V       
Sbjct: 222 PFNWPLWKRSVLSLLLCLDCLNVSVGSSIFSSGMPQLEEKYH-IIEVVAILGVTLYVLGF 280

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG-LGVSTIES 190
               +I +P + ++G+R V ++            A ++N ++++  R  +G LG +    
Sbjct: 281 AFSPVIYAPLSELYGRRGVIVISAFGFSLFQFAVATAENIQTIMICRFFAGFLGAAPFPV 340

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIV 243
           +P+A  A+++  + R   +  ++              S++ +Y    WL ++V
Sbjct: 341 VPAA-FADMFDTNLRGKAICLFSMGVFLGPVIAPVMGSYMAKYTTWRWLNYLV 392

>KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 589

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 98/224 (43%), Gaps = 24/224 (10%)

Query: 367 RP-FVLFCYPAV----LFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           RP ++LF  P +    ++ +F+Y   I++L++ A  I  V G   Y+   +        P
Sbjct: 369 RPIYMLFTEPIIFLITVYNSFVY--GILYLLLEAYPIVFVKGYHFYANGEL--------P 418

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
           ++  I+G   A  ++  M + + ++   + G   PE RLF ++   +   +G++ F W+ 
Sbjct: 419 YIALIIGMFFAAVVNIYMEKDYVRRVIANSGKPVPEARLFPMMVGSIIFPIGILWFCWTG 478

Query: 479 QAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
              +   WI PTI    +G+G          + +DSY   A  A+     +++  G AF 
Sbjct: 479 NYPNKVHWIVPTIGGSFIGYGLMAIFLPCFNYLIDSYLFLAASAIAGNTFMRSSFGAAFP 538

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFAIP--LYHYGKRARR 578
            F        G     ++ G      CL  +P   Y YG+R R+
Sbjct: 539 LFAGFMFENMGTNWAGLLLGL--FAACLIPVPFLFYKYGRRLRQ 580

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/206 (18%), Positives = 85/206 (41%), Gaps = 4/206 (1%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+ ++     ++G  C      +SI A+    ++ E +   + +S L +       
Sbjct: 138 PFNWPLKKKLVICIMLGLDCIAITMGSSIFASAVTTIS-EIYEVANVVSILGITLYVLGF 196

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG-LGVSTIES 190
               +I +P + ++G++ V L+            A ++N +++L  R   G +G + +  
Sbjct: 197 AASPVIYAPLSELYGRQGVLLIASFGFALFQFAVATAENLQTILICRFFGGFIGAAPLAV 256

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           +P A+ ++++   +R   +  +               S++ +Y    W  ++  I   V 
Sbjct: 257 VP-ASFSDMFDNTQRGTAVTMFALGVFVGPILAPVFGSYIVQYTSWRWTEYVTGIFASVI 315

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRE 276
           F+L   F  ET      V   + +R+
Sbjct: 316 FVLLCYFFEETHHPTILVNKAKMMRK 341

>Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}
           similar to Ashbya gossypii AGR195W
          Length = 620

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 73/173 (42%), Gaps = 1/173 (0%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y +S++ IG  Y  P V  ++GS+  G  SD   + +  K      P ++  +    GL+
Sbjct: 445 YGYSNLAIGACYACPGVALMMGSIIGGHSSDYFRKSWIAKHSDQKYPSYKRLLSQIMGLN 504

Query: 467 TAL-GLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
            ++ G +G+GW+ Q H    A   F  ++ FG +  S + +T+  +S    A   +   N
Sbjct: 505 VSMVGCIGYGWAIQLHYHVAALLFFSFLMAFGMTWCSNSTMTYLTESNPKRAAGTIAVSN 564

Query: 526 VLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
             +N+     S    K     G    F   G  +LI  L    L   G R+ +
Sbjct: 565 SFRNIAAAISSAIIFKLCDAMGVGWCFTGLGLCDLISVLSIYYLIRNGNRSSK 617

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 64/156 (41%), Gaps = 2/156 (1%)

Query: 109 LALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA-V 167
           L  EF+ S + I+  V           ++ +  A   G++++Y++            A +
Sbjct: 189 LEREFNVSTTTINTTVSVFMAVFSFAPLLWAIYADYGGRKLLYVISMGLNVIVNILLASI 248

Query: 168 SQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXA 227
             N  +L   RI      S++ SL + TV++I    +R   + ++              A
Sbjct: 249 PTNIGALYFLRIAQAFASSSVISLGAGTVSDITSPKDRGKAVAYFMLGPNAGPVLAPIIA 308

Query: 228 SFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
             +    D   WLF   +I+ GV FML  LF+PET 
Sbjct: 309 GIILMNGDNWRWLFGFTSIMAGVGFMLVCLFLPETL 344

>ZYRO0G16302g Chr7 complement(1336890..1338533) [1644 bp, 547 aa]
           {ON} similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048W Hypothetical ORF
          Length = 547

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/407 (19%), Positives = 150/407 (36%), Gaps = 65/407 (15%)

Query: 136 IIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSAT 195
           ++ SP + ++G+RI ++               S   E +L  R +SG   S+  S+ S T
Sbjct: 160 LLLSPISELYGRRITFIFSLSFSVAWQCLVIWSPTIEGVLFGRFLSGFFGSSFLSVASGT 219

Query: 196 VAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHV 255
           +++I+   +    + FY              +   F      W F ++ I+  V   L  
Sbjct: 220 ISDIFTKDQIGIPMTFYALAPFAGPSLGPVLSG-AFNKDGYKWPFIVMMIVSSVLLGLVT 278

Query: 256 LFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXX 315
             VPE++            +   + R A   R                            
Sbjct: 279 FTVPESY------------KPVLLIRKAKRLRK--------------------------- 299

Query: 316 XXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYP 375
                 T   +Y + +    + +NI +  L+          SV + I ++LR +++    
Sbjct: 300 -----ETGDDKYFAPLEVIRREANIFRLILL----------SVKRPIDLLLRDYMI---- 340

Query: 376 AVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPL 435
            VL  +F   L +  + +   +   +Y    ++F+ ++ GL Y+   +G I+  +C   L
Sbjct: 341 GVL--SFYTGLVLAIIYLYFTVFPYIYPKL-WNFTVMETGLAYLGLLIGMII--VCPSCL 395

Query: 436 S-DKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVV 494
              K      +++ G   PE R   +      T +GLM F W+  +H  WI   I   V 
Sbjct: 396 IFQKNYARRVERNGGKSTPEMRFEALFYGAFCTPIGLMIFAWTCYSHVHWIGSLIGSAVF 455

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTK 541
           G G          +TVD+Y+ YA  A+     ++ +M   F  F  +
Sbjct: 456 GAGVFFVFVGVFAYTVDAYRRYAASAMACNTFVRCIMAGVFPLFGRQ 502

>ZYRO0D00286g Chr4 complement(17054..18580) [1527 bp, 508 aa] {ON}
           similar to uniprot|O43081 Schizosaccharomyces pombe
           SPBC947 SPBC947.06c protein and weakly similar to
           YHR048W uniprot|P38776 Saccharomyces cerevisiae YHR048W
           Hypothetical ORF
          Length = 508

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 106/251 (42%), Gaps = 36/251 (14%)

Query: 347 TGLGIFHGRHSVDKWIMVM--------LRPFVLFCYPAVLFGAFL--YSLAIVWLIMVAQ 396
           TG   +H +H  ++W + +        +RPF +   P V F A    Y   I++LI+ + 
Sbjct: 264 TGNWAYHAKH--EEWDLDLNEYLSTHLIRPFAMLATPIVFFLALFASYVFGILYLIVTSL 321

Query: 397 IINTVYGNPPYSFSSIQ-----IG-LVYVSPFVGSILGSLCA--GPLSDKMVRHFAKKSC 448
                    P +F   +     +G L  ++  VG ILG +    G L  + +   A K  
Sbjct: 322 ---------PLTFKMTRGWEGTLGNLPMLAVLVGVILGGVANVWGGLRYRRIL-IANKGV 371

Query: 449 GIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITF 508
            I E  F   M+    + T  GL  F W++ AH  WIAP I L  + FG  +     + +
Sbjct: 372 PIPEERFPPMMMFAWLMPT--GLFIFAWTSWAHVHWIAPCIGLSCMAFGFFVIFQGCLNY 429

Query: 509 TVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF--NVKSGYKTTFIVYGCVELIVCLFA 566
            VD++  YA  A+      ++++   F  F +    N+   +  + I +  + +I   F 
Sbjct: 430 LVDAFTKYAASAIAANTFFRSILAGVFPLFGSALFGNLGVHWGASTIAFVALGMIPIPFV 489

Query: 567 IPLYHYGKRAR 577
              Y +G + R
Sbjct: 490 --FYAFGSKIR 498

>KAFR0F04390 Chr6 (860978..862681) [1704 bp, 567 aa] {ON} Anc_4.30
           YLL028W
          Length = 567

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 93/497 (18%), Positives = 186/497 (37%), Gaps = 77/497 (15%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NW + ++     ++   C      +SI A+G   +  E +  +  ++ L V       
Sbjct: 118 PFNWTLTKKTIICLILCLDCICISMASSIFASGVTQIC-EIYHVIQVVAILGVTLYVFGF 176

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               II +P + I+G+R V ++            A ++N ++++  R   GL  +   ++
Sbjct: 177 AASPIIYAPLSEIYGRRGVLVLSSLGFCIFQFAVATAENLQTIMICRFFGGLIGAAPMAV 236

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
             A  A+++  + R   +  ++              S++ ++    WL ++V  +  + F
Sbjct: 237 VPAAFADMFDTNMRGKAVCLFSLGVFVGPIISPVMGSYIVQHTTWRWLEYVVGCLAALVF 296

Query: 252 MLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXX 311
           +L  LF  ET      V   + +R+         A + A                     
Sbjct: 297 VLVALFFEETHHPSILVGKAKQMRQDTNNWGIHAAHENA--------------------- 335

Query: 312 XXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVL 371
                                 ++   +I Q+ +   L            IM+   P +L
Sbjct: 336 ----------------------ELSIRDIVQNTITRPL------------IMLFTEPVLL 361

Query: 372 FCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC 431
                 ++ +F+Y   I++L++ A  I  V G   Y ++     L Y++  +G I  ++ 
Sbjct: 362 I---VSIYNSFVY--GILYLLLEAYPIVFVEG---YGYTK-NGELPYIALIIGMIFCAMF 412

Query: 432 AGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTI 489
              +    ++   K   G   PE RL  ++ AG+   +G++ F W+    +   WI PTI
Sbjct: 413 IWYMDSSYLKKVNKA--GGLVPEARLEPMILAGIVFPIGILWFCWTGNYPEKIHWICPTI 470

Query: 490 FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYK 549
               +GFG        + + ++SY   A  A+     +++  G  F  F       +GY 
Sbjct: 471 AGAFIGFGLMGIFLPCLNYIIESYLLVAASAVAANTFMRSSFGATFPLF-------AGYM 523

Query: 550 TTFIVYGCVELIVCLFA 566
              +  G   L++ LFA
Sbjct: 524 FEGMGTGWAGLLLGLFA 540

>KAFR0I01400 Chr9 complement(291910..293679) [1770 bp, 589 aa] {ON}
           Anc_4.30 YLL028W
          Length = 589

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 112/252 (44%), Gaps = 42/252 (16%)

Query: 350 GIFHGRHSVDKWIM-----VMLRP-FVLFCYPAVL----FGAFLYSLAIVWLIMVAQIIN 399
           GI   + SV+  I       M RP ++LF  P +L    + +F+Y L  ++L++ A  I 
Sbjct: 349 GIHAAQESVELSIKDICEKTMTRPIYMLFTEPILLIVTIYNSFVYGL--LYLLLEAYPIV 406

Query: 400 TVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGP----LSDKMVRHFAKKSCGIYEPEF 455
            V G   Y F  I  G +   P++  I+G L  G     + D  +R + KK  G   PE 
Sbjct: 407 FVEG---YGF--ITNGEL---PYIALIIGMLVCGAFIWYMDDDYLRRYRKK--GGLVPEA 456

Query: 456 RLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSY 513
           RL  ++  G+   +G++ F W+    +   W  PTI    +GFG        + + ++SY
Sbjct: 457 RLIPMIVGGIVFPIGILWFCWTGNYPNRIHWSCPTIAGSFIGFGLMGIFLPCLNYIIESY 516

Query: 514 KCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA---IP-- 568
                 A+     +++  G AF  F       +GY    +  G   L++ LFA   IP  
Sbjct: 517 LYIPASAVAANTFMRSAFGAAFPLF-------AGYMFRNMGTGWAGLLLGLFAASMIPVP 569

Query: 569 --LYHYGKRARR 578
             L  YG++ R+
Sbjct: 570 LLLLRYGEKIRK 581

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 77/189 (40%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NW + R+    F++  +C      ++I A+G   +  EFH         +        
Sbjct: 140 PFNWSLARKIIPCFILCLNCICITLGSAIYASGVLQICAEFHIIQVVAILGITLYVLGFA 199

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLP 192
              +I +P + ++G++ V +V            A +++ ++LL  R  +G   +   ++ 
Sbjct: 200 ASPVIFAPLSEVYGRKGVLVVSAFGFTIFNFAVATAKDLQTLLICRFFAGFIGAAPLAVV 259

Query: 193 SATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFM 252
            A  A+I+  + R   +  ++              S++ ++    WL ++V  +  V F+
Sbjct: 260 PAAFADIFDTNVRGKAICLFSLGVFVGPILGPVIGSYIVQHTTWRWLEYVVGCLSAVVFV 319

Query: 253 LHVLFVPET 261
           L   F  E+
Sbjct: 320 LVTFFYQES 328

>NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa]
           {ON} Anc_8.570
          Length = 500

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 1/173 (0%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKK-SCGIYEPEFRLFMVLPAGL 465
           Y  S ++IG  YV P +  ++GS   G LSD +   + K+     +  E+RL + +   L
Sbjct: 326 YHLSPLKIGACYVCPGISMLVGSQVGGHLSDYLRSRWLKRHEAETFPLEYRLVLHIFGIL 385

Query: 466 STALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLN 525
               G +GFG+S   H       +F G++ FG +  S T +T+  +     A   +   +
Sbjct: 386 MNTAGCIGFGFSISFHYHLALILMFSGLMAFGMTWCSNTTMTYLTELMTNKAAATIALSS 445

Query: 526 VLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
             +NV     S        + G    F+  G V ++  +  I L   GK  +R
Sbjct: 446 FFRNVGAAISSAIIITLCDQMGVGWCFMGLGLVNIMSLVLIIYLICTGKGRQR 498

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 1/98 (1%)

Query: 166 AVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           AV  +  +L A R+V   G S++ +L + TV +I     R   + ++             
Sbjct: 117 AVPSHIGALFAMRVVQAFGSSSVITLGAGTVTDITPPKHRGKAIAYFMMGPNIGPVIAPI 176

Query: 226 XASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLFVPETF 262
            A  +    D   WLF    I+ G+     ++F+PET 
Sbjct: 177 IAGLILMKGDYWRWLFGFTAIMSGIGLFAIIIFLPETL 214

>CAGL0H06017g Chr8 complement(588556..590229) [1674 bp, 557 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008c FLR1
          Length = 557

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 78/359 (21%), Positives = 129/359 (35%), Gaps = 73/359 (20%)

Query: 136 IIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPS 193
           I+ SP   I   G+  VY++           CA++ N+  L+  R ++G+  S   S   
Sbjct: 167 IVFSPLTEISSIGRLPVYMITFFLFTMLQIGCALAPNFAGLVILRFITGVLCSPALSTGG 226

Query: 194 ATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFML 253
           AT+ +I   +  A  LG ++              + +    D  W+FW++        +L
Sbjct: 227 ATLGDIVSQNYLALVLGLWSIGAVAAPVLAPLLGASMVVAKDWRWIFWLLFFCCCATMLL 286

Query: 254 HVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXX 313
              F PET  D            T + R A   R +                        
Sbjct: 287 LTFFFPETSSD------------TVLHRKAARIRKL------------------------ 310

Query: 314 XXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLF- 372
                   T  +RY +  + + +     +  L+  L           + M++  P VL  
Sbjct: 311 --------TGDNRYYTE-KEREEAQLPKKQFLIETL--------YRPFSMMITEPIVLAF 353

Query: 373 -CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC 431
             Y A+ +GAF          +  +    V+G   Y F+ ++ GL Y    VG I   + 
Sbjct: 354 DLYIALCYGAFY---------LFFEAFPIVFGGI-YHFTLVEQGLAYFGFCVGCIFAYII 403

Query: 432 AGPLSDKMV-RHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
               S K+  + FA  +   + PE  L + +  G    L L  FGW+A+ H  WI P I
Sbjct: 404 LLVFSIKVAAKRFANNT---FTPETTLILAMCIGWCIPLALFMFGWTAKVH--WILPII 457

>Kpol_1057.25 s1057 (56904..58550) [1647 bp, 548 aa] {ON}
           (56904..58550) [1647 nt, 549 aa]
          Length = 548

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 81/223 (36%), Gaps = 2/223 (0%)

Query: 56  TKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHR 115
            K   +++    +    P NW   ++   +  V     V    +SI   G + +  EFH 
Sbjct: 78  NKDPFLVDWNGDEDPEHPYNWSTPKKTIMILQVMLLTAVTYMGSSIYTPGQEAVQKEFHV 137

Query: 116 SLSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYES 173
                +  +           II SP +     G++ +Y++            A  +NY  
Sbjct: 138 GHVAATLNLSIYVLGYGIGPIIFSPLSEFATLGRQNIYIITLFCFCIFQIGAATVKNYGG 197

Query: 174 LLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEY 233
           ++  R +SG+  S   +   ATV +I         LG +               + + E 
Sbjct: 198 MVVIRFISGIFCSPALATGGATVTDIMKPELVPVVLGLWAVGAIAAPVLAPLLGAAILEA 257

Query: 234 LDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
            D  W+FW++  +     ++ + F PET  D   V   R +R+
Sbjct: 258 KDWRWIFWLLLWMCAATLIILIFFFPETHHDNILVRRARRLRK 300

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 106/494 (21%), Positives = 182/494 (36%), Gaps = 75/494 (15%)

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
           K L  EF  +   I+  V            I+   A ++G+R + L+            A
Sbjct: 107 KELEAEFDVNEELINITVVVYLLFQGIAPTISGGLADVYGRRPIILLGMLIYVIASIGLA 166

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            S++Y +++  R +   G+S I ++ S    +     ER   +G  +             
Sbjct: 167 CSKSYGAVVFLRCLQSAGISPIIAINSGVAGDFTVKSERGTFVGAVSGFTLMGQAFGSLI 226

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGA 286
            + +    D   +FW + I  G   ++    + ET   RT V N  SIR  +    A   
Sbjct: 227 GAALTAAYDWRAIFWFLVIGCGTCMIILCFLLIET--KRTIVGN-LSIRPKSWINIAPIT 283

Query: 287 RDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLV 346
           R  AI      + Q + D                P  S R LS V+  I  +        
Sbjct: 284 RLPAI------RKQFKYD---------------NPDYSSRDLSEVKFDITSA-------- 314

Query: 347 TGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPP 406
                          + +++ P ++    ++L  AF +SL   W + +A +   +  +P 
Sbjct: 315 ---------------MRILILPEIIL---SLLPAAFQFSL---WTLSLASLPAELALDP- 352

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRH-----FAKKSCGIYEPE------- 454
           Y +S   IG+ Y+   +G +LGS C G + D   +        KK  G+ + +       
Sbjct: 353 YDYSLTMIGVCYLPSGIGGLLGSFCTGKIIDVYYKRSHKKFLEKKEAGLIDKDARFNTFK 412

Query: 455 FRLFMVLPAGLSTALGLMGFGWSAQA--HDAWIAPTIFLGVVGFGSSLASTTAITFTVDS 512
            RL    P  +  A+    FGW+ +   H A +  T F+G   F +    +T+ T  VD 
Sbjct: 413 ARLISGAPQNVCAAVVFTLFGWALKQRWHIAVVLVTSFIG--SFCAMSTLSTSSTLLVDL 470

Query: 513 YKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTF-IVYGCVELIVCLFAIPLYH 571
           Y   +  A    N ++ V+   F    +K         TF  + G V +   L  IP+  
Sbjct: 471 YPSKSSTATSCYNFMRCVLSAIFMACFSKMKSSMNVGGTFTCISGMVFVGNFLILIPM-- 528

Query: 572 YGKRARRWTDSKGL 585
             K   +W   +G+
Sbjct: 529 --KYGMKWRYERGM 540

>ZYRO0E09988g Chr5 (796142..797788) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 548

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 88/456 (19%), Positives = 164/456 (35%), Gaps = 76/456 (16%)

Query: 41  GPGDDAPSTGGVVQT-----TKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVG 95
           GP +     G V Q      T+   +++    +    P NW   ++   +  V    F+ 
Sbjct: 58  GPNEAGDIDGAVEQMHDFKDTRDPFLIDFTGPEDPEHPHNWSTLKKTIVITEVSLLTFIT 117

Query: 96  GGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLV 153
              +SI   G + +  EF       +  +           II SP +   IFG++ +Y+V
Sbjct: 118 YMGSSIYTPGQEQIQQEFGVGHVVATLNLSVYVIGYGIGPIIFSPLSEFAIFGRQQLYIV 177

Query: 154 XXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYT 213
                      CA+  N   L+  R ++G+  S   +  +A++ ++         LG ++
Sbjct: 178 TLFLFTMLQAGCALVHNIAGLVILRFLTGVLCSPSLATGAASIGDVVRPKYVPILLGLWS 237

Query: 214 XXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERS 273
                         + +    +  W+FW++  +  +  +  + F PET        +E +
Sbjct: 238 GAAYAAPCVGPLIGAAMVIAKNWRWIFWLLMWMSALLLVTLIFFFPET--------SEDN 289

Query: 274 IRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRT 333
           I      R                K  G++                   + + + +R  +
Sbjct: 290 ILHRRCERIK--------------KITGDD-------------------RYYTFKAREES 316

Query: 334 KIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIM 393
           K+   +IA   L     I      V + I+  L  ++   Y   +F  F  S  IV+   
Sbjct: 317 KLNAKDIAIIALYRPFEIM-----VKEPIVQALDIYIALTYG--IFYLFFESFPIVF--- 366

Query: 394 VAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFA--KKSCGIY 451
                     +  Y F+ I++GL Y    +G ++GS  A   S   + ++A  K + G +
Sbjct: 367 ----------SGIYHFTLIELGLSY----LGFLVGSFVAYAASIIFLHYYADRKMANGTF 412

Query: 452 EPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAP 487
            PE  L + +        GL  FGW+A  H  W+ P
Sbjct: 413 TPETFLVLAMCVSWCLPCGLFIFGWAASVH--WMVP 446

>KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {ON}
           Anc_8.723 YOR273C
          Length = 677

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 76/191 (39%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++        + C V    +S+  +G   L  ++H  ++    L        
Sbjct: 82  NPHNWPTWKKWAVTMTAAFLCLVVSMGSSLYVSGVPELVAKYH--VNQTLALAGLTFYLL 139

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ +Y+V             +S  +   +L  R  +G   S   S
Sbjct: 140 GLSTVIGAPLSEVFGRKPIYVVSLPVSCLFIMGVGLSGGHMRVILPLRFFAGAFASPALS 199

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   E +  + F+              A F  EY    +  WI     G+ 
Sbjct: 200 IASGTIMDIFDLDEVSVAMTFFCLAPFMGPVLSPIMAGFAAEYRSWRYTQWIQLFASGMV 259

Query: 251 FMLHVLFVPET 261
           F   +L +PET
Sbjct: 260 FPF-ILLMPET 269

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 17/183 (9%)

Query: 367 RPFVLFCYPAVLFGAFLYS---LAIVWLIMVA--QIINTVYGNPPYSFSSIQIGLVYVSP 421
           RPF+L     ++     Y+   LAIV+L  VA   I   +YG     F  +QI   Y+  
Sbjct: 298 RPFLLLFLDPMMGVLCFYTGLVLAIVYLYFVAFPYIFKKLYG-----FGVMQIACCYL-- 350

Query: 422 FVGSILGSLCAGPLSDKMVRHFAK---KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
             G ++G   A P S    + +     K+  I  PE R   +        +GLM F W+ 
Sbjct: 351 --GMMVGMTLAAPTSLIFQKRYEMNVIKNNNIRTPEMRFEPLFYGAFCCPIGLMIFAWTC 408

Query: 479 QAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
             +  W+ P I   + G G          +TVD+Y+ YA   +   + +++ M   F  F
Sbjct: 409 YQNVHWMGPMIGSAIFGSGVFFVFVGVFNYTVDAYRRYAASGMACNSFVRSTMSGIFPLF 468

Query: 539 NTK 541
             +
Sbjct: 469 GLQ 471

>Kpol_1018.195 s1018 (493001..494647) [1647 bp, 548 aa] {ON}
           (493001..494647) [1647 nt, 549 aa]
          Length = 548

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/223 (19%), Positives = 80/223 (35%), Gaps = 2/223 (0%)

Query: 56  TKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHR 115
            K   +++         P NW   ++   +  V     V    +SI   G + +  EFH 
Sbjct: 78  NKDPFLVDWNGDDDPEHPYNWSTPKKTIMILQVMLLTAVTYMGSSIYTPGQEAVQKEFHV 137

Query: 116 SLSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYES 173
                +  +           II SP +     G++ +Y++            A  +NY  
Sbjct: 138 GHVAATLNLSIYVLGYGIGPIIFSPLSEFATLGRQNIYIITLFCFCIFQIGAATVKNYGG 197

Query: 174 LLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEY 233
           ++  R +SG+  S   +   ATV +I         LG +               + + E 
Sbjct: 198 MVVIRFISGIFCSPALATGGATVTDIMKPELVPVVLGLWAVGAIAAPVLAPLLGAAILEA 257

Query: 234 LDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
            D  W+FW++  +     ++ + F PET  D   V   R +R+
Sbjct: 258 KDWRWIFWLLLWMCAATLIILIFFFPETHHDNILVRRARRLRK 300

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 76/192 (39%), Gaps = 2/192 (1%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP+W R     ++          ++ +  G   +  ++H  L              
Sbjct: 175 NPHNWPLWIRWAYTVILSCLVICVAYGSACITGGLFTVQEQYHVGLEAAILSCSLMVIGF 234

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               +I SP + ++G+R+ Y +           CA+S N   LL  R + G+  S+   L
Sbjct: 235 SLGPLIWSPVSDLYGRRLAYFISMGLYTIFNIPCALSPNLGGLLVCRFLCGVFSSSGLCL 294

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVN 250
              ++A+++ +  R   + F+                FV     R   +FWI     GV 
Sbjct: 295 VGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLVNGFVSVCTRRMDLIFWINMAFAGVM 354

Query: 251 FMLHVLFVPETF 262
           +++ V F+PET+
Sbjct: 355 WII-VAFIPETY 365

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 69/177 (38%), Gaps = 3/177 (1%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y +    IGL+++   +G+ +         ++ ++   K+      PE RLF  +     
Sbjct: 447 YGYKDNLIGLMFIPILIGATMALATTFYCENEYLKLVKKRKP---TPEDRLFGAMIGAPF 503

Query: 467 TALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNV 526
            A  L   G ++  H  W+ P       G+G  L   +   + +D Y  YA  AL T   
Sbjct: 504 AAAALWILGATSYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATKVF 563

Query: 527 LKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSK 583
           L++  G AF  F  +   K G +    +   +   + L     Y+YGK  R     K
Sbjct: 564 LRSAGGAAFPLFTNQMYHKLGLQWASWLLAFISTAMILLPFGFYYYGKTLRHKLSKK 620

>Kwal_55.19590 s55 complement(38363..39964) [1602 bp, 533 aa] {ON}
           YBR008C (FLR1) - Major Facilitator Transporter [contig
           159] FULL
          Length = 533

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 107/525 (20%), Positives = 189/525 (36%), Gaps = 88/525 (16%)

Query: 68  KSKRDPLNWPVWRRD---TALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLV 124
           +   +PLNW   ++    + + ++    ++G    SI   G +G+  EF       +  +
Sbjct: 75  EDPDNPLNWSSGKKSLVVSQMMLLTCATYMGA---SIYTPGQEGIQREFGVGHVVGTLNL 131

Query: 125 XXXXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG 182
                      II SP + +   G++ +Y++            A  +N   LL  R +SG
Sbjct: 132 SLYVLGYGLGPIIFSPLSEVASVGRQQIYVITVFLFMLFQVGAATVKNIGGLLVIRFISG 191

Query: 183 LGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWI 242
           +  S   +   AT+ +I         +G +               + + +  +  + FWI
Sbjct: 192 ILCSPSLATGGATMGDIIKPEIVPIFIGLWAIGAVAAPVIAPLIGAAMVQAKNWRYTFWI 251

Query: 243 VTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGE 302
           +  I    F++ VLF PET      + + R++R     R   G            +F   
Sbjct: 252 LMWISAATFIVLVLFFPET--QHNNILHRRAVR----VRKVTGDN----------RFY-- 293

Query: 303 EDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWI 362
                              TQ  R  S++ T+                 F     V  ++
Sbjct: 294 -------------------TQQERIDSKIETRA----------------FMHEVFVRPFV 318

Query: 363 MVMLRPFVLF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS 420
           ++ L P VL    Y AV +GAF        L+ V            Y+F+ +++GL ++ 
Sbjct: 319 IMALEPAVLAFDIYIAVCYGAFYLFFEAFPLVFVGI----------YNFTLVELGLAFMG 368

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKK-SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ 479
             VG +L  +    L   + ++ A K     + PE  L + +    +  L L  FGW+A+
Sbjct: 369 FCVGCVLAYIA---LLIYLAKYIAPKFKNNTFTPEDFLPLSMAVCWALPLSLFMFGWTAR 425

Query: 480 AHDAWIAPTI--FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSF 537
            H  W+ P I     V+   +   S+ A  +    Y  Y      +    ++V   AF  
Sbjct: 426 VH--WVLPMIAEIFFVINVFNLFQSSFA--YLAICYPRYIASVFASNGFCRSVFASAFPL 481

Query: 538 FNTKFNVKSGYKTTFIVYGCVELIVC---LFAIP--LYHYGKRAR 577
           F        G +   + +G   +  C   L AIP   Y YG + R
Sbjct: 482 FGKAMYENLGSEKYPVGWGSSLIGFCSIALAAIPFIFYKYGPQMR 526

>Ecym_6229 Chr6 complement(427712..429415) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii AER339C
          Length = 567

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 90/227 (39%), Gaps = 13/227 (5%)

Query: 45  DAPSTGGVVQTTKK----GIILNPQPSK-----SKRDPLNWPVWRRDTALFVVGWHCFVG 95
           D  ++GG   T KK    G +++P+         + +P NWPVW++     V  + C V 
Sbjct: 16  DRIASGGGDNTHKKEGEEGDLIDPKDLDWDDRYDEDNPHNWPVWKKWYTTLVAAFLCLVV 75

Query: 96  GGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXX 155
              +S+  +    L L+++  +     L            ++ +P + ++G++ +YL+  
Sbjct: 76  SMGSSLYVSAVPELVLKYN--IDQTLALAGLTFYLLGLAMVVGAPLSEVYGRKPIYLLSL 133

Query: 156 XXXXXXXXXCAVS-QNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTX 214
                       S Q    +L  R +SG+  S   S+ S T+ +I+   + +  +  +  
Sbjct: 134 PPSMLFALGVGFSGQRMGIILPLRFLSGVFASPALSVASGTIVDIFDVDQVSVAMASFCM 193

Query: 215 XXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
                       A F  E     W  WI  +I G      V F+PE+
Sbjct: 194 APFLGPVISPIMAGFAAEKKGWKWGVWI-HLIAGAVLFPFVCFMPES 239

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/159 (20%), Positives = 56/159 (35%), Gaps = 5/159 (3%)

Query: 453 PEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDS 512
           PE  L +     ++    L   GWSA+    W+ P +     GFG  L   + + +   S
Sbjct: 389 PEEFLLVTKVGSIALPAALFWMGWSAKESVHWMVPLLAGVPFGFGLILIFFSVLMYFTTS 448

Query: 513 YKCY-AQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYH 571
           Y       A    N+L+ +    F  F  +     G      ++G + L +         
Sbjct: 449 YPVLVVSSAFAANNMLRYITSCVFPLFTVQMYNNLGIDWASSLFGFISLAMVPVPWIFER 508

Query: 572 YGKRARRWTDSKGLLDFSYVKKNHSRGSTGDRHMEDSYQ 610
           YGK  R+    K +  +  +K         +   ED+ +
Sbjct: 509 YGKAMRK----KSVFGYDALKPYQGASGPAEADSEDTTE 543

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 71/174 (40%), Gaps = 2/174 (1%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMV-RHFAKKSCGIYEP-EFRLFMVLPAG 464
           Y FS +  GL ++ P V  I GS   G LSD +  R   K S     P E RL + + A 
Sbjct: 477 YHFSRLGSGLAFICPGVAMIFGSQIGGHLSDYLRNRWLLKNSTDCKYPIEKRLQLQIIAI 536

Query: 465 LSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTL 524
           +  +LG++G+GWS +     +    F   + F  +  S T +T+  +        A+   
Sbjct: 537 VVNSLGIIGYGWSIEKRLDIVLVFFFAACISFSLTWCSNTTMTYLTELLARRTSAAISIS 596

Query: 525 NVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
           +  +N      S        K G    F   G + ++  L  + L  YG + R 
Sbjct: 597 SFFRNTAAAISSVIIVILCDKMGIGWCFTGLGLLNIVPFLGVLYLLQYGYKFRE 650

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 69/185 (37%), Gaps = 2/185 (1%)

Query: 80  RRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIAS 139
           +R    F+V +  F+G    +I       L   FH + + I+  V           I   
Sbjct: 108 QRMVMFFIVIYVGFLGPMSGNIYIPALPTLQKAFHTNTTVINATVSAFMGVFAVGPIFWG 167

Query: 140 PCAVIFGKRIVYLVXXXXXXXXXXXCAV-SQNYESLLASRIVSGLGVSTIESLPSATVAE 198
             A + G++ +YL             AV   N  SL   R+    G S++ +L S TV +
Sbjct: 168 VYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLFVLRVFQAFGSSSVITLGSGTVTD 227

Query: 199 IYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGVNFMLHVLF 257
           I     R   + ++              A  +    D   WLF    I+  + F+L ++F
Sbjct: 228 ITPMKHRGKAIAYFMLGPNMGPILGPIIAGLILINGDYWRWLFGFTCIMSAIGFLLVLIF 287

Query: 258 VPETF 262
           +PET 
Sbjct: 288 LPETL 292

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 81/199 (40%), Gaps = 6/199 (3%)

Query: 67  SKSKRDPLNWPVWRR--DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLV 124
           +   ++P NWP+W R   TAL      C   G  ++ +  G   +  +FH SL       
Sbjct: 163 TDDPQNPHNWPLWVRWSYTALLSTLVVCVAYG--SACITGGLGTVEEKFHVSLEAAILSC 220

Query: 125 XXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLG 184
                      ++ SP + ++G+++ Y             CA++ N   LLA R + G+ 
Sbjct: 221 SLMVIGFAVGPLLWSPVSDLYGRKVAYFFSMGLYTIFNIPCALAPNLGCLLACRFICGIF 280

Query: 185 VSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIV 243
            S+   L   ++A+++ ++ R   + F+                F+     R   +FW+ 
Sbjct: 281 ASSGLCLVGGSIADMFPSNSRGKAIAFFAWAPYAGPCIGPLVNGFISVSTGRMDLIFWVN 340

Query: 244 TIIVGVNFMLHVLFVPETF 262
               G  +++  L +PET+
Sbjct: 341 MAFCGTMWIVASL-IPETY 358

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 75/206 (36%), Gaps = 18/206 (8%)

Query: 365 MLRPFVLFCYPAVL-----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYV 419
           +LRP        VL     +   +YSL   +      I   +YG     +    IGL+++
Sbjct: 398 LLRPLYFAVTEPVLVATCFYVCLIYSLLYAFFFAFPVIFGDLYG-----YKDNLIGLMFI 452

Query: 420 SPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ 479
              +G+            K ++    +      PE RL   +      A+ L   G +A 
Sbjct: 453 PILIGATFALAFTFWCESKYMQIVKTRRP---TPEDRLLGAMIGAPFAAIALWILGATAL 509

Query: 480 AHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
               W+ P       GFG  L   +   + +D Y  +A  AL T   L++  G AF  F 
Sbjct: 510 KRIIWVGPASSGLAFGFGMVLIYYSLNNYIIDCYVQFASSALATKVFLRSAGGAAFPLFT 569

Query: 540 T----KFNVKSG-YKTTFIVYGCVEL 560
           T    K N+  G Y   FI    + L
Sbjct: 570 TQMYHKLNLHWGSYLLAFISTAMIAL 595

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 168/466 (36%), Gaps = 84/466 (18%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A I+G+R V L             A + +Y  ++  R +   G+S I ++ S  V +   
Sbjct: 162 ADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRCLQSCGISPIIAISSGCVGDFTM 221

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
             ER   +G  +              + +    D   +FW + I  G    + +L +PET
Sbjct: 222 KAERGTFVGAVSGLVLLGQAFGSLIGAALAAAWDWRAIFWFLAIGAGCCLFVGILVLPET 281

Query: 262 FWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTP 321
              RT V N     +  I R              AP F                      
Sbjct: 282 --KRTIVGNMSIKPKNIINR--------------APIF---------------------- 303

Query: 322 TQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLF-- 379
                 L   + + K  N     L             +K  + +L PF + C P ++   
Sbjct: 304 -----LLKSFQKRFKYDNPDYETL-----------DQNKPKLNLLAPFTIICQPEIVLSL 347

Query: 380 --GAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD 437
             G   ++L   W +M++  I++     PY++  I IG+ Y+   +G +LGSL  G + D
Sbjct: 348 LPGGLQFAL---WTLMLSS-ISSELAIEPYNYKLIIIGVCYLPAGMGGLLGSLITGRVID 403

Query: 438 KMVRHFAKKSCGIYE----PEFRLFMVLPAGLSTAL--------GLMGFGWSAQAHDAWI 485
              +   KK   + E    PE + F +  A L  AL          + FGW     D  +
Sbjct: 404 IYYKKSLKKFDAMKEAKEIPEDKQFNIFKARLLPALPQNFIAVAAFILFGWCV---DKGL 460

Query: 486 APTIFLGVVGFGSSLA---STTAITFTVDSYKCYAQEALVTLNVLKNVMGFAF--SFFNT 540
                L V  FGS  A    +T+ T  VD Y   +  A    N ++  +   F   F   
Sbjct: 461 KVESILIVSFFGSYCAMSTLSTSSTLLVDLYPGKSSTATSCFNFIRCSLSAMFMGCFAKM 520

Query: 541 KFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLL 586
           K ++  G   T IV G + +   L  IP+  YG   R+   +K  L
Sbjct: 521 KGSITVGGTFTLIV-GFLFVANFLVMIPV-MYGMEWRQKRANKAEL 564

>KNAG0F03480 Chr6 complement(657351..658997) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 92/459 (20%), Positives = 160/459 (34%), Gaps = 74/459 (16%)

Query: 41  GPGDDAPSTGGVVQTTKKGIILNPQPSKSKRD-PLNWPVWRRDTALF-VVGWHCFVGGGQ 98
           G  D     G V+Q       L         D P+NW + ++   +  ++   C    G 
Sbjct: 62  GAADGQGEYGSVLQKNGTDPFLVDWYGPQDPDYPVNWTMAKKIFLVIQIMLLTCLTYMG- 120

Query: 99  TSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVI--FGKRIVYLVXXX 156
           +SI   G + +  +FH      +  +           II SP + +  FG++ +Y+    
Sbjct: 121 SSIYTPGQEEIQKDFHVGHVTATLNLSMYVLGYGLGPIIFSPLSEVAKFGRQQIYIYTFF 180

Query: 157 XXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXX 216
                   CA  +N   L+  R  SG+  S   +   AT+ +I  A  R   +G +    
Sbjct: 181 LFMVFQVGCATVKNIGGLVVLRFFSGILCSPSLATGGATMGDIVEAKWRPVLIGLWAIGA 240

Query: 217 XXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
                      + +    +  W+FW++  + G + +L V+  PET  +       R +R+
Sbjct: 241 VAAPVLAPLLGAAMVVAKNWRWIFWLMLWMCGASLILFVICFPETSANNILSRRARRLRK 300

Query: 277 TAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIK 336
                                                        T   RY +  + +I 
Sbjct: 301 Q--------------------------------------------TGDDRYYT-TQERID 315

Query: 337 CSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLF--CYPAVLFGAFLYSLAIVWLIMV 394
            +   +  L+T L      +   K  M++L P ++    Y A+ +GAF        ++ +
Sbjct: 316 SAIEPKQFLITTL------YRPIK--MILLEPIIMAFDLYIALCYGAFYLFFEAFPIVFI 367

Query: 395 AQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPE 454
                       Y F+ +++G+ Y    VG I           K++    +K  G  E  
Sbjct: 368 GL----------YKFTLVEMGVAYFGFCVGCIFAYALLLLFLAKVLGPRFEKGEGTPETF 417

Query: 455 FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGV 493
             L M +   L  AL L  FGW+A  H  WI P I  G+
Sbjct: 418 LLLAMCVSWCLPCALFL--FGWAANTH--WIVPIIAEGI 452

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 83/193 (43%), Gaps = 4/193 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXX 130
           +P NWP+ RR     V+          ++ +A G   ++ ++H   S+++ L V      
Sbjct: 163 NPHNWPIARRWFFTVVLSTLVICVAYGSACIAGGLFTVSEKYHVG-SEVAVLSVSLMVIG 221

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                ++ SP + ++G+R+ Y V           CA+S N   L+  R + G+  S+   
Sbjct: 222 FSLGPLLWSPVSDLYGRRVAYFVSMGLYVIFNIPCAISPNISGLMVCRFLCGVWASSGLC 281

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDR-HWLFWIVTIIVGV 249
           L   ++A+++ +  R   + F+                F+     R   +FW+     GV
Sbjct: 282 LVGGSIADMFPSETRGKAIAFFAFAPYVGPVFGPLVNGFISVSTRRMDLIFWVNMAFAGV 341

Query: 250 NFMLHVLFVPETF 262
            +++ V F+PET+
Sbjct: 342 MWIV-VAFIPETY 353

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 82/224 (36%), Gaps = 13/224 (5%)

Query: 365 MLRPFVLFCYPAVL-----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYV 419
           +LRP        VL     +   +YSL   +      I + +YG     +     GL+++
Sbjct: 393 LLRPLYFAVTEPVLDATCFYVCLIYSLLYAFFFAYPVIFSELYG-----YKDNLCGLMFI 447

Query: 420 SPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ 479
              +G+++          K ++    +      PE RL   +      A+ L   G ++ 
Sbjct: 448 PIMIGALMALATTFWCESKYLQLIKTRKP---TPEDRLLGAMIGAPFAAIALWILGATSY 504

Query: 480 AHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
            H  W+ P       G+G  L   +   + +D Y  +A  AL T   L++  G AF  F 
Sbjct: 505 KHIIWVGPASSGIAFGYGMVLIYYSLNNYIIDCYVQFASSALATKVFLRSAGGAAFPLFT 564

Query: 540 TKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSK 583
           T+   K G +    +   +   +       Y +GK  R     K
Sbjct: 565 TQMYHKLGLQWASWLLAFIATAMIALPFGFYRWGKGLRHKLSKK 608

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 116/560 (20%), Positives = 193/560 (34%), Gaps = 79/560 (14%)

Query: 43  GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHC-FVGGGQTSI 101
           GDD+   G +V T  K I  N   S+++  P     + +   +  +   C F     + I
Sbjct: 24  GDDSTKHGDMVMTNDKPIENNGTISRNEA-PYTLLSYGQKWGMVALLTMCTFWSSLGSPI 82

Query: 102 LAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXX 161
                + L  EF+     ++  V             +   A I+G+R V ++        
Sbjct: 83  YYPALRQLEKEFNIDEDKVNVTVVVYLLFQGIAPTFSGGLADIYGRRPVIVIGMIIYVAV 142

Query: 162 XXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXX 221
               A S +Y  L+  RI+    +S   ++ S  V +     ER   +G  +        
Sbjct: 143 SVGLACSNSYGVLVFLRILQSACISPTIAISSGFVGDFTLKFERGTFVGATSGFALLGQA 202

Query: 222 XXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIAR 281
                 + +    D   +FW + I  GV  ++    +PET   RT V N     +  + R
Sbjct: 203 FGSLIGAALAAAWDWRAIFWFLVIGCGVCMLIIFTLLPET--KRTLVGNLSVKPKNILNR 260

Query: 282 AADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIA 341
           A              P F                   + P Q               N+ 
Sbjct: 261 A--------------PIF------------------LLKPVQKRFKYDNPDYDTLDPNVP 288

Query: 342 QSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTV 401
           +  L + L I                  +L  +PA L  A       +W +M++ I + +
Sbjct: 289 KLDLTSALKITAQPE------------IILSLFPAGLQFA-------MWTLMLSAISSEL 329

Query: 402 YGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKK-------SCGIYEPE 454
             NP Y++    IG+ Y+   +G ++GS   G + D   R   KK            E E
Sbjct: 330 SANP-YNYKLTIIGVCYLPAGIGGLVGSFITGRIIDIFYRKLTKKFEQDKENGTIPQETE 388

Query: 455 F-----RLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG--VVGFGSSLASTTAIT 507
           F     RL   +P      +  + FGWS      W  P + +   V  F +    +T+ T
Sbjct: 389 FNVIRARLLAGVPQNFIAVVSFLLFGWSVD--KGWRIPAVLITSCVSSFCAMSTLSTSST 446

Query: 508 FTVDSYKCYAQEALVTLNVLKNVMGFAF--SFFNTKFNVKSGYKTTFIVYGCVELIVCLF 565
             VD Y   +  A    N ++  +   F   F   K ++  G   TF+  G V +   L 
Sbjct: 447 LLVDLYPGKSSTATSCFNFIRCTLSAIFMGCFAKMKTSMTVGGTFTFMC-GLVFIGNFLL 505

Query: 566 AIPLYHYGKRARRWTDSKGL 585
            IP+  YG    +W + + L
Sbjct: 506 LIPM-RYG---MKWRNERAL 521

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 97/470 (20%), Positives = 163/470 (34%), Gaps = 74/470 (15%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           FG+R V L+            A + +Y  ++  R V  +G+S   ++ S  V +     E
Sbjct: 162 FGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSE 221

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G  +              + +    D   +FW +TI  G +F +    +PET   
Sbjct: 222 RGTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLPET--K 279

Query: 265 RTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQS 324
           R+ V N  SIR                     PK                    + P   
Sbjct: 280 RSIVGN-LSIR---------------------PK----------------NPLNIAPVT- 300

Query: 325 HRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLY 384
              L   R K+K  N     L     +F            +   F +   P +       
Sbjct: 301 --LLPAARRKLKYDNPDYETLDKTKPVFD-----------LTSAFKICALPEIFLSLLPP 347

Query: 385 SLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMV 440
            LA     ++   I++     PY++    IG+ Y+   +G ++GS   G + D    K +
Sbjct: 348 GLAFAMWTLMLSAISSELSAAPYNYKLTIIGVCYLPAGIGGLIGSFATGKIIDFQYKKKL 407

Query: 441 RHFAKKSCGIYEPE--------FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFL- 491
           + F +K      PE         RL  VLP      +  + FGWS      W  P+I + 
Sbjct: 408 KVFEEKKAAGIIPEDEKFNIMGARLQSVLPQNFLCVVTYILFGWSCD--KGWKIPSILIT 465

Query: 492 GVVGFGSSLASTTAI-TFTVDSYKCYAQEALVTLNVLKNVMGFAF--SFFNTKFNVKSGY 548
             V    ++++ +A+ T  VD Y   +  A    N ++  +       F   K ++  G 
Sbjct: 466 SCVSSFCAMSTLSAMSTLLVDLYPGKSSTASSCFNFMRCSLSAILMGCFAKMKHSLTVGG 525

Query: 549 KTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHSRG 598
             T +  G V +   L  IP+ H G R R   + +  L    + + +  G
Sbjct: 526 TFTLLA-GLVFVGNFLMFIPMKH-GMRWREEREQRAALKAKSMDQANENG 573

>ZYRO0B16808g Chr2 (1368857..1370446) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 110/555 (19%), Positives = 187/555 (33%), Gaps = 89/555 (16%)

Query: 41  GPGDDAPSTGGVVQTTKKGIILNP-----QPSKSKRDPLNWPVWRRDTALFVVGWHCFVG 95
           G  +       +V   +KG   +P     + +     P NW   +R   +F V     V 
Sbjct: 39  GDSERDSKESALVDEVEKGKYSDPFLVEFRGATDPEHPHNWSTIKRFVVVFNVMVLTCVT 98

Query: 96  GGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLV 153
              TS    G   +  EFH      +  +           +I  P +  V FG++ +++V
Sbjct: 99  YMGTSFYTPGQDLIEKEFHVGHVVGTLNLSLYILGFGLGPLIFGPLSEFVAFGRQRLFIV 158

Query: 154 XXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYT 213
                      CA+ +N   L+  R ++G+  S   +  +A V ++         LG + 
Sbjct: 159 TLFLFAMLQIGCALVRNIAGLVILRFLAGIFCSPSLANGAAAVGDVVRPRHVPVVLGLWA 218

Query: 214 XXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERS 273
                         S +    +  ++FW++  I     +L V   PET        NE S
Sbjct: 219 IGALVGPSTGPLLGSSMVVAKNWRFMFWLLMWISSATLVLMVFTYPET--------NEDS 270

Query: 274 I---RETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSR 330
           I   R   I R     R   +      K   ++               +  T  +R    
Sbjct: 271 ILYRRCQRIRRLTGDNRYYTVKSREEEKLNWKD---------------ICITTLYRPFEM 315

Query: 331 VRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVW 390
                    I +  +V  L ++H                      AV +G F        
Sbjct: 316 ---------IIKEPIVIALNVYH----------------------AVEYGVFY------- 337

Query: 391 LIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKK-SCG 449
             +  +    V+G+  Y F+ +++G+ Y+   VG I     A   S     + AKK S  
Sbjct: 338 --LFFEAFPIVFGDV-YHFTRVELGVSYMGFCVGCITAYGVAMVFS---CWYAAKKMSNN 391

Query: 450 IYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFT 509
            + PE  L +++    +  L L  FGW+A  H  WI P I   +   G      +  ++ 
Sbjct: 392 TFTPETHLVLMIWVCWTLPLSLFLFGWAASVH--WILPMISEVIFIIGQFNIFQSVFSYM 449

Query: 510 VDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF-------NVKSGYKTTFIVYGCVELIV 562
             SY  Y   A    N+ ++    AF  F               G+ ++ + + C+ L +
Sbjct: 450 AISYPKYMASAFAGNNLCRSGFACAFPLFGKAMYNNLAIDGYPVGWGSSIVGFCCLALSL 509

Query: 563 CLFAIPLYHYGKRAR 577
             F   LY YG   R
Sbjct: 510 VPFV--LYRYGAYLR 522

>ZYRO0F02090g Chr6 complement(169045..170850) [1806 bp, 601 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force- dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 601

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 86/218 (39%), Gaps = 17/218 (7%)

Query: 370 VLFCYPAVLFGAFLYSLAIVWLI--MVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSIL 427
           +L   P V F  F   +A  W I  +   +I   +    +    I  GL Y+S  +G  L
Sbjct: 317 MLLSEPVVFF--FGMWIAFTWFITFLFLSVITITFSEQKHWSEGIA-GLPYISLCIGVTL 373

Query: 428 GSLCAGPLSDKMVRHFAK---KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAW 484
           G      L+   +R + K   K+ G   PE RL+  +  G+   +GL  + ++      W
Sbjct: 374 GFF----LNFLQIRKYDKIRSKATGAIAPEHRLYGAMAGGIFLPIGLFIYSFTQYHWLHW 429

Query: 485 IAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMG-----FAFSFFN 539
           I P I L  + FG      +  ++T D Y   A  A+   + L+N +G     FA   F 
Sbjct: 430 IGPNIGLVCIAFGIFFIFESCYSYTSDCYGPSASSAIAGQSYLRNELGAVAPLFAAQMFR 489

Query: 540 TKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
              +  +G   + +  G   L   LF       GK  R
Sbjct: 490 GMHSEWAGLLCSLVGTGLSLLPFILFKFGPSIRGKSKR 527

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 39/213 (18%), Positives = 78/213 (36%), Gaps = 1/213 (0%)

Query: 49  TGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKG 108
           T  + +  K+ ++L   P   K +P NW   R+    +V+     + G   ++  +   G
Sbjct: 59  TESIEKDGKEWVMLTYAPG-DKENPFNWSSKRKWFYTWVLNLMTLMIGLGNTVYNSTISG 117

Query: 109 LALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVS 168
           +  + HRS       +           +  +P   + G+++VY              A+ 
Sbjct: 118 MCKDLHRSTEIGQLGLFVFNQTSGVLPLFLAPFCELVGRKVVYTAGFIGFCLTFIGLALG 177

Query: 169 QNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXAS 228
           +N  ++L  R + G   S    L   T  +++   ERA  +  ++             A 
Sbjct: 178 RNMATILVLRTLQGGCGSIGTILVGGTFDDMFIPEERAIPMALFSHIAIFGTMAAPIYAG 237

Query: 229 FVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
           F  + +   W+  I  +      ++ VLF  ET
Sbjct: 238 FADQAIGWRWVEGIQGLANIPLLIIVVLFFKET 270

>ZYRO0A13618g Chr1 (1083024..1084613) [1590 bp, 529 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 529

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 109/522 (20%), Positives = 179/522 (34%), Gaps = 88/522 (16%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
             P NW   +R   +F V     V    TS    G   +  EFH      +  +      
Sbjct: 74  EHPHNWSTIKRFVVVFNVMVLTCVTYMGTSFYTPGQDLIEKEFHVGHVVGTLNLSLYILG 133

Query: 131 XXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                ++  P +  V FG++ +++V           CA+ +N   L+  R +SG+  S  
Sbjct: 134 FGLGPLVFGPLSEFVAFGRQRLFIVTLFLFAMLQIGCALVKNIAGLVILRFLSGIFCSPS 193

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            +  +A V ++         LG +               + +    +  ++FW++  I  
Sbjct: 194 LANGAAAVGDVVRPRHIPVVLGLWAIGALAGPSTGPLLGASMVVAKNWRYMFWLLMWISS 253

Query: 249 VNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXX 308
              +L V   PET        NE SI    + R     R +                   
Sbjct: 254 ATLLLMVFSYPET--------NEDSI----LYRRCQRIRKL------------------- 282

Query: 309 XXXXXXXXXXVTPTQSHRYL---SRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                        T  +RY    SR   K+   +I  + L                 M++
Sbjct: 283 -------------TGDNRYYTVKSREEEKLNWKDIGITTLYRPFE------------MII 317

Query: 366 LRPFV--LFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFV 423
             P V  L  Y AV +G F          +  +    V+G+  Y F+ +++G+ Y+   V
Sbjct: 318 KEPIVIALNVYHAVEYGVFY---------LFFEAFPIVFGDV-YHFTRVELGVSYMGFCV 367

Query: 424 GSILGSLCAGPLSDKMVRHFAKK-SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHD 482
           G I     A   S     + AKK S   + PE  L +++    +  L L  FGW+A  H 
Sbjct: 368 GCITAYGVAMVFS---CWYAAKKMSNNTFTPETHLVLMIWVCWTLPLSLFLFGWAASVH- 423

Query: 483 AWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKF 542
            WI P I   +   G      +  ++   SY  Y   A    N+ ++    AF  F    
Sbjct: 424 -WIIPMISEVIFIIGQFNIFQSVFSYMAISYPKYMASAFAGNNLCRSGFACAFPLFGKAM 482

Query: 543 -------NVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
                      G+ ++ + + C+ L V  F   LY YG   R
Sbjct: 483 YNNLAIDGYPVGWGSSIVGFCCLALSVVPFV--LYRYGAYLR 522

>Smik_15.455 Chr15 complement(784048..786027) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/276 (20%), Positives = 104/276 (37%), Gaps = 28/276 (10%)

Query: 7   IQQPKTNDDSGS---TGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKG---- 59
           +  P T  +S S   T  N  SKAP        A  G     + STG +++  K+     
Sbjct: 1   MTSPLTRPESNSRFQTNINQDSKAP----NENLANGGNLDSSSSSTGSIMEDEKRSNSNA 56

Query: 60  ---IILNPQPSKSKR----------DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGS 106
                 N +P  S+           +P NWP W++  A     + C V    +S+  +  
Sbjct: 57  DSSSTTNSEPIDSRNLDWDGPDDPDNPHNWPSWKKWYATMTSAFLCLVVTMGSSLYVSSV 116

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
             L  ++H  ++    L           ++I +P + +FG++ +YL              
Sbjct: 117 PELVAKYH--VNQTLALAGLTFYLLGLSTVIGAPLSEVFGRKPIYLFSLPISMLFTMGVG 174

Query: 167 VSQNY-ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXX 225
           +S  +   +L  R +SG+  S   S+ S T+ +I+   + +  + ++             
Sbjct: 175 LSNGHMRIILPLRFLSGVFASPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPI 234

Query: 226 XASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
            A F  +     W  WI  +I G   +  +  +PET
Sbjct: 235 MAGFATQAKGWRWSEWI-QLIAGGLILPFIALMPET 269

>NDAI0D04840 Chr4 complement(1145041..1146960) [1920 bp, 639 aa]
           {ON} Anc_4.30
          Length = 639

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 88/208 (42%), Gaps = 4/208 (1%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLAL-EFHRSLSDISYL-VXXXXXX 130
           P NWP+ ++     V+   C      +SI   GS  L + E +  +  ++ L +      
Sbjct: 190 PFNWPMKKKVILCVVLCLDCIGISMGSSIF--GSAVLQICEIYDVIQVVAILGITLYVLG 247

Query: 131 XXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
                +I +P + I+G+R V ++            A ++N ++++  R  SG+  S   +
Sbjct: 248 FAVSPVIYAPLSEIYGRRGVLVISAFAFCIFQFAVATAENLQTIMICRFFSGVIGSAPMA 307

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           +  A  A+++  + R   +  ++              S++ +     WL ++V I  GV 
Sbjct: 308 VVPAAFADMFDTNLRGKAICLFSLFVFVGPILSPVFGSYMAQRTTWRWLEYVVGIFAGVV 367

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETA 278
           F+L VLF  ET      V   + +R+ +
Sbjct: 368 FVLIVLFYEETHHPSILVNKAKQMRKQS 395

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 105/227 (46%), Gaps = 31/227 (13%)

Query: 367 RP-FVLFCYPAVL----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIG-LVYVS 420
           RP F+LF  P +L    + +F+Y   I++L++ A  I  V G   Y F  I+ G L Y++
Sbjct: 421 RPIFMLFTEPMLLIITIYNSFVY--GILYLLLEAYPIVFVEG---YGF--IENGELPYIA 473

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA 480
             VG ++ S     +    ++  AKK  G   PE RL +++   +   +G++ F W+   
Sbjct: 474 LIVGMLVCSFFIWYMDTDYLKRCAKK--GGLVPEARLLLMILPSIFFPIGILWFCWTGNY 531

Query: 481 HDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
            +   ++ PT+  G +GFG        + + ++SY   A  A+     L++  G  F  F
Sbjct: 532 PEKIHFMVPTVAGGFIGFGLIGIFLPCLNYIIESYLLLAASAVAANTFLRSGFGAVFPLF 591

Query: 539 NTKFNVKSGYKTTFIVYGCVELIVCLFA---IP----LYHYGKRARR 578
                  +GY    +  G   L++ LFA   IP    LY YG   RR
Sbjct: 592 -------AGYMFHNLGIGWSGLVLGLFAAAMIPVPLLLYKYGAGIRR 631

>ZYRO0F04642g Chr6 (388032..389681) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 549

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 87/447 (19%), Positives = 160/447 (35%), Gaps = 78/447 (17%)

Query: 50  GGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGL 109
           GGV Q     ++    P   +R P+NWP+ ++    F V     V    T+I   G + +
Sbjct: 74  GGVPQQKDPFLVEYTGPDDPER-PVNWPLSKKAIVAFQVQLLTCVTYMGTAIYTPGQEEI 132

Query: 110 ALEFHRSLSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAV 167
              F       +  +           +  SP +   IFG++ +Y++           CA+
Sbjct: 133 QKAFGVGHVVATLNLSMYILGFGLGPMFFSPLSEFAIFGRQQLYIITLFLFSMLQIGCAL 192

Query: 168 SQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXA 227
             N   L+  R ++G+  S   S  +AT++EI         +G ++              
Sbjct: 193 VDNIAGLVILRFITGILCSPSLSTGAATISEIVTPPFVPVMIGMWSIGAVAAPAIGPILG 252

Query: 228 SFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGAR 287
           + +    +  ++FW++  I     ++  LF PET+ +       + I++T          
Sbjct: 253 AAMLVAKNWRFMFWLLMWITSGALIILSLFFPETYEENVLYRRCKRIQKT---------- 302

Query: 288 DVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYL---SRVRTKIKCSNIAQSH 344
                                             T  +RY    S+  +K+   +I  + 
Sbjct: 303 ----------------------------------TGDNRYFTAKSKEESKLSIKDITINA 328

Query: 345 LVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGN 404
           L   + I      V + I++ L  ++   Y    F  F  +  IV+L +           
Sbjct: 329 LWRPIEII-----VKEPIVLALDTYLALAYGT--FYLFFEAFPIVFLRI----------- 370

Query: 405 PPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKK--SCGIYEPEFRLFMVLP 462
             Y F+ +++GL Y    +G ++ S  A  +S    R F  +    G + PE  L + + 
Sbjct: 371 --YHFTPVELGLSY----LGFVVSSFIAYGVSLSFFRLFLPRIIKKGEFRPEKLLILAMW 424

Query: 463 AGLSTALGLMGFGWSAQAHDAWIAPTI 489
                   L  FGW+A  H  WI P +
Sbjct: 425 VCWCGPAALFIFGWTASVH--WILPIM 449

>TPHA0G01430 Chr7 (292540..294453) [1914 bp, 637 aa] {ON} Anc_8.723
           YOR273C
          Length = 637

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 74/191 (38%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++  A  V    C V    +S+  +G   L L +   ++    L        
Sbjct: 64  NPHNWPAWKKWYATMVAALLCLVVTMGSSLYVSGVPELVLRYQ--INQTLALAGLTFYLL 121

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ +YL+             +S  +   +L  R  SG+  S   S
Sbjct: 122 GLTTVIGAPLSEVFGRKPIYLISLPISMLFTMGVGLSGGHMRIILPLRFFSGVFGSPALS 181

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +++   E    +  +              A F  E     W  WI  +I G  
Sbjct: 182 VGSGTILDVFDMDEVPMAMAMFCLAPFLGPIISPVMAGFATEKQGWRWAEWI-QLIAGGL 240

Query: 251 FMLHVLFVPET 261
            +  +  +PET
Sbjct: 241 ILPFIALMPET 251

>Kpol_1018.193 s1018
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 bp, 548 aa] {ON}
           (487656..487952,487955..487999,488002..489165,
           489169..489309) [1647 nt, 549 aa]
          Length = 548

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 106/529 (20%), Positives = 194/529 (36%), Gaps = 104/529 (19%)

Query: 72  DPLNWPVWRR----DTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXX 127
           +PLN  ++++    D +  V+  + ++G   +SI   G +    EFH      +  +   
Sbjct: 96  NPLN--IYKQKSTNDISNNVIQLYTYMG---SSIYTPGQEDFQKEFHVGHIAATLNLSIY 150

Query: 128 XXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                   +I SP +  V  G + +Y++            A  +N+  ++    +SG+  
Sbjct: 151 VLGYGLGPLILSPLSEFVTLGCQQIYIITLFCFCILQIGAATVKNFGRMIVILFLSGVFC 210

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTI 245
           S   +   AT+A+I       Y LG ++                + E     W+FW++  
Sbjct: 211 SPALTTGGATIADIVKPEVVPYFLGLWSVRAIAAPVLAPLLGVAILEAKGGRWIFWLLLW 270

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDA 305
           +     M+ + F PET      V   R +R++                            
Sbjct: 271 MCAATLMILIFFFPETQQGNILVRRTRRLRKS---------------------------- 302

Query: 306 XXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                           T   RY ++ + K +  N+    L           ++ K + ++
Sbjct: 303 ----------------TGDKRYYTKEQKKEEQLNLTAFML----------SAIYKPVKII 336

Query: 366 LR-PFVLF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPF 422
           ++ P VL    Y AV +G F        L+ V            Y+F+ +++GL     F
Sbjct: 337 IKEPIVLAFDLYLAVCYGVFYLFFEAFPLVFVGI----------YNFTPVELGL----GF 382

Query: 423 VGSILGSLCAGPLSDK-MVRHFAKK-SCGIYEPEFRLFMVLPAGLSTA--LGLMGFGWSA 478
           +G  +G + + P+    +V++   + S   ++PE   FM+LP  +  A  L L  FGW+A
Sbjct: 383 MGYQVGCIISYPIFIVFLVKYLNPRFSDNTFKPE--DFMILPMLVCWALPLSLFLFGWTA 440

Query: 479 QAHDAWIAPTI---FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAF 535
             H  WI P I   F  +  F       T+  +    Y+ +         + +     AF
Sbjct: 441 GVH--WILPIISEVFFVINCFN---LFQTSFAYLALCYQDHVASVFAGNALARAGFACAF 495

Query: 536 SFFNTKFN------VKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
             F    N         G+ ++ + +  + L +  FAI  Y YGK  RR
Sbjct: 496 PLFGQAMNKLGSDKYPVGWGSSLLGFFSLGLEIIPFAI--YKYGKSLRR 542

>CAGL0L10912g Chr12 complement(1167086..1169041) [1956 bp, 651 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273c
          Length = 651

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 79/193 (40%), Gaps = 8/193 (4%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++  A  V  + C      +S+  +G   L  ++H  ++    L        
Sbjct: 76  NPHNWPSWKKWYATMVAAFLCLAVTMNSSLYVSGVPELVAKYH--VNQTLALAGLTFYLL 133

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ +YL              +S  +  ++L  R  +G   S   S
Sbjct: 134 GLANVIGAPLSEVFGRKPIYLFSLPISMLFTMGVGLSGGHMRTILPLRFFAGFFASPCLS 193

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLF--WIVTIIVG 248
           + S T+ +++   E +  + F++             A F  E  +R W +  WI     G
Sbjct: 194 VGSGTILDVFDVDEVSVAMTFFSLAPFLGPVISPIIAGFAVE--ERSWRYTQWIQLWASG 251

Query: 249 VNFMLHVLFVPET 261
           +   L +  +PET
Sbjct: 252 LILPL-IAIMPET 263

>KLTH0D12320g Chr4 complement(1001954..1003720) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q12256 Saccharomyces cerevisiae
           YOR273C TPO4 Polyamine transport protein
          Length = 588

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 72/191 (37%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++  A       C V    +S+   G   + LE+    S    L        
Sbjct: 38  NPHNWPTWKKWFATMTAALLCLVVTMGSSLYVNGVPRMVLEY--GYSQTLALAGLTFYLL 95

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVS-QNYESLLASRIVSGLGVSTIES 190
              +++ +P + IFG++ +Y+             A+S      +L  R  +G+  S   S
Sbjct: 96  GLSTVVGAPLSEIFGRKPIYVASLPLSMLFTMGVALSGGKMRVVLPVRFFAGVFASPALS 155

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   E +  +  +              A F  E     W  +I  +  G  
Sbjct: 156 VASGTIVDIFDMDEVSVAMSLFCLAPFLGPVISPVIAGFATEKQGWRWATYI-QLFAGGL 214

Query: 251 FMLHVLFVPET 261
            M  VL +PET
Sbjct: 215 IMPFVLLMPET 225

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 63/163 (38%), Gaps = 17/163 (10%)

Query: 452 EPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVD 511
           +PE  L +     ++  + L   GW++++   W+AP       GFG  L   + I +   
Sbjct: 374 KPEKLLDICKIGSIALPISLFWLGWTSKSSVHWMAPMAAGVPFGFGLILIFFSVIMYFST 433

Query: 512 SY-KCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKS--GYKTTFIVYGCVELIVCLFAIP 568
            Y   Y   AL   N+L+ V    F  F  +   K   G+ ++   + CV +I   +   
Sbjct: 434 CYPPLYVASALAANNLLRYVTSCVFPLFTIQMYEKMTIGWASSLFGFICVAMIPLPWIFE 493

Query: 569 LYHYGKRARRWTDSKGLLDFSYVKKNHSRGSTGDRHMEDSYQS 611
            Y  G R +           S    N   G  GD   E+S QS
Sbjct: 494 RYGEGMRQK-----------STFGFNALEGEKGD---EESCQS 522

>YBR008C Chr2 complement(252563..254209) [1647 bp, 548 aa] {ON}
           FLR1Plasma membrane multidrug transporter of the major
           facilitator superfamily, involved in efflux of
           fluconazole, diazaborine, benomyl, methotrexate, and
           other drugs; expression induced in cells treated with
           the mycotoxin patulin
          Length = 548

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 74/193 (38%), Gaps = 2/193 (1%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +P NWP+ ++   +F +     V    +SI   G + +  EFH      +  +      
Sbjct: 92  ENPQNWPLLKKSLVVFQIMLLTCVTYMGSSIYTPGQEYIQEEFHVGHVVATLNLSLYVLG 151

Query: 131 XXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                II SP +    +G+  +Y+V           CA   N   L+  R +SG+  S  
Sbjct: 152 YGLGPIIFSPLSETARYGRLNLYMVTLFFFMIFQVGCATVHNIGGLIVMRFISGILCSPS 211

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            +    TVA+I         LG ++              + + +  +  ++FW++  +  
Sbjct: 212 LATGGGTVADIISPEMVPLVLGMWSAGAVAAPVLAPLLGAAMVDAKNWRFIFWLLMWLSA 271

Query: 249 VNFMLHVLFVPET 261
             F+L   F PET
Sbjct: 272 ATFILLAFFFPET 284

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y FS +++GL Y+   VG +L     G L+ +++    +   G + PE  L + +     
Sbjct: 369 YHFSLVEVGLAYMGFCVGCVLAYGLFGILNMRII--VPRFRNGTFTPEAFLIVAMCVCWC 426

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+A+ H  WI P I
Sbjct: 427 LPLSLFLFGWTARVH--WILPVI 447

>NCAS0C05780 Chr3 complement(1188362..1190065) [1704 bp, 567 aa]
           {ON} Anc_4.30
          Length = 567

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 85/179 (47%), Gaps = 13/179 (7%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           IM+   P +LF     ++ +F+Y   I++L++ A  I  V G   Y F+     L Y++ 
Sbjct: 352 IMLFTEPILLF---VTIYNSFVY--GILYLLLEAYPIIFVQG---YGFTE-NGELPYIAL 402

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAH 481
            +G ++ ++    +    +R F K   G   PE RL+ ++ AG+   +G++ F W+    
Sbjct: 403 IIGMLVCAIFIWYMDSDYLRRFRKA--GTLVPEARLYPMIVAGIVFPIGILWFCWTGYYP 460

Query: 482 DA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
           +   ++ PT+    VGFG        + + ++SY   A  A+     +++  G +F  F
Sbjct: 461 EKIHFMVPTVGGAFVGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRSGFGASFPLF 519

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/205 (18%), Positives = 84/205 (40%), Gaps = 2/205 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+ ++     ++  +C      +SI A+    +  E +  +  ++ L V       
Sbjct: 118 PFNWPMKKKVITCVILCLNCICISMGSSIFASAVPQIC-EIYGVIQVVAILGVTLYVLGF 176

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               I+ +P + I+G+R V ++            A ++N ++++  R   GL  +   ++
Sbjct: 177 AISPIVYAPLSEIYGRRGVLVISSFGFCLFQFAVATAENLQTIMICRFFGGLMGAAPFAV 236

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
             A +A+++  + R   +  +T              S++ +     WL +++ I  GV  
Sbjct: 237 VPAAMADMFDTNTRGKAICLFTIGVFVAPVVSPVMGSYMAQRTTWRWLEYVIGIFAGVLT 296

Query: 252 MLHVLFVPETFWDRTPVPNERSIRE 276
              V+F  ET      V   + +R+
Sbjct: 297 AAVVVFFQETHHPSILVAKAKQMRK 321

>TBLA0A08530 Chr1 (2104870..2106717) [1848 bp, 615 aa] {ON} Anc_4.30
           YLL028W
          Length = 615

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 106/234 (45%), Gaps = 32/234 (13%)

Query: 357 SVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGL 416
           ++ K I+++    VLF     L+ +F+Y   I++L++ A  I  + G   Y  + +   L
Sbjct: 394 TITKPIVILFTEPVLFLIS--LYNSFVY--GILYLLLEAYPIIFIQG---YGLT-VNGYL 445

Query: 417 VYVSPFVGSILGSLCAGPL---SDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMG 473
            Y++  VG I+   CAG +        +  AK+   +  PE RL+ ++ AG+   +G++ 
Sbjct: 446 PYLALIVGIII---CAGMIWYADTDYSQQVAKQKKLL--PERRLYPMIVAGIVFPIGILW 500

Query: 474 FGWSAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVM 531
           F W+    +   WI PTI    +GFG        + + ++SY   A  A+     +++  
Sbjct: 501 FCWTGAYPEKIHWICPTIAGSFIGFGLIGIFLPCLNYIIESYLFIAASAVAANTFMRSTF 560

Query: 532 GFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA---IP----LYHYGKRARR 578
           G  F  F       +GY    +  G   L++ LFA   IP    L  YG   R+
Sbjct: 561 GAVFPLF-------AGYMFKGMGTGWAGLLIGLFAAAMIPVPFLLLKYGPTIRK 607

>TDEL0F01670 Chr6 complement(309067..310815) [1749 bp, 582 aa] {ON}
           Anc_4.30 YLL028W
          Length = 582

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/240 (18%), Positives = 93/240 (38%), Gaps = 9/240 (3%)

Query: 39  MGG--PGDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGG 96
           MGG  P   A  + G+ + T  G             P NWP+  +     V+G +C    
Sbjct: 104 MGGERPFPPALPSSGLYEVTFDG-------PNDPIHPFNWPIRTKLILCVVLGLNCISIA 156

Query: 97  GQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXX 156
             +SI A+G + +   +H         V           I+ +P + ++G+R V ++   
Sbjct: 157 MASSIFASGVEQICAIYHVIPVVAILGVSLFVLGFAASPIVYAPLSELYGRRGVLVISAF 216

Query: 157 XXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXX 216
                    A +++ ++++  R  +GL  +   ++  A  A+++  + R   +  +    
Sbjct: 217 GFTLFHFAIATAKDLQTIMICRFFAGLIGAAPMAVVPAAFADMFDTNTRGKSICLFALGV 276

Query: 217 XXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
                      S++ ++    WL +++ I  G  F+   L   ET      V   R++R+
Sbjct: 277 FVGPILAPVIGSYIVQHTTWRWLEYVMGIFSGCVFVAIALLFKETHHPTILVNKARAMRK 336

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 97/248 (39%), Gaps = 16/248 (6%)

Query: 341 AQSHLVTGLGIFHGRHSVDKWIM-----VMLRPFVLFCYPAVLFGAFLYS---LAIVWLI 392
           A   L    GI     +V+  I       + RP V+ C   VL    +Y+     I++L+
Sbjct: 333 AMRKLTNNWGIHAAHETVELSIKEIAQKTIARPIVMLCTEPVLLFVTIYNSFVYGILYLL 392

Query: 393 MVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYE 452
           + A  I  V G   Y F +    L Y++  +G               ++  AKK  G   
Sbjct: 393 LEAYPIVFVGG---YGFQT-NGELPYIALIIGMFFCGAFIWYFEVDYLKRVAKK--GGLV 446

Query: 453 PEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTV 510
           PE RL  ++ AG+   +G++ F W+    D   W+ PT+    +GFG        + + +
Sbjct: 447 PEARLIPMVYAGVVFPIGILWFCWTGNYPDKVHWMVPTVAGAFIGFGLIGIFLPCLNYII 506

Query: 511 DSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLY 570
           +SY   A  A+     L++  G  F  F        G     ++ G     +    I L 
Sbjct: 507 ESYLLLAASAVAANTFLRSAFGACFPLFAGYMFNNMGTNWAGLLLGLFAAALVPVPIILL 566

Query: 571 HYGKRARR 578
            YGKR R 
Sbjct: 567 KYGKRIRE 574

>TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa]
           {ON} Anc_8.723 YOR273C
          Length = 625

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 78/196 (39%), Gaps = 12/196 (6%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHR----SLSDISYLVXX 126
            +P NWP W++      V   C V    +S+  +G   + L +      ++S +++ +  
Sbjct: 62  ENPHNWPSWKKWYTTMTVAMLCLVVTMGSSLYVSGVPEMVLRYKYNQTLAISGLTFYL-- 119

Query: 127 XXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESL-LASRIVSGLGV 185
                   ++I +P + +FG++ VYL              +S  +  + L  R +SG   
Sbjct: 120 ----LGLSTVIGAPLSEVFGRKPVYLFSLPISMLFTMGVGLSNGHMRIVLPLRFLSGAFA 175

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTI 245
           S   S+ S T+ +I+   + +  + F+               SF  E     W  WI  +
Sbjct: 176 SPALSVGSGTIMDIFDMDQVSVAMTFFCVAPFLGPVISPIMGSFATEKQGWRWSQWI-QL 234

Query: 246 IVGVNFMLHVLFVPET 261
           I G   +  +  +PET
Sbjct: 235 IAGGLILPFIAIMPET 250

>KAFR0K00150 Chr11 complement(37495..39087) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 88/238 (36%), Gaps = 8/238 (3%)

Query: 30  IGVTGTFAMMGGPGDDAPSTGGVVQTTKKG----IILNPQPSKSKRDPLNWPVWRRDTAL 85
           I   GT   +     D  S GG  + ++KG    ++++        +P NW   +++  +
Sbjct: 32  IDAKGTPLYVDSSSTDIESKGG--KESQKGDVDPLLIDWNGEDDPDNPQNWTSSKKNLII 89

Query: 86  FVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVI- 144
           F +     +    +SI   G  G+  +FH      +  +           I  SP + + 
Sbjct: 90  FEIMMLTCINYMGSSIYTPGQGGIQDDFHVGHVTATLNLSLYVLGYGLGQIFFSPLSEVA 149

Query: 145 -FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAH 203
             G++ +Y++           CA  QN   L+  R ++G+  S   S   AT+A+I    
Sbjct: 150 KIGRQQIYIITFFIFMLLQIGCATVQNIAGLVILRFITGILCSPSLSTGGATIADIIHPD 209

Query: 204 ERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
             A  +  +               + +    +  W FW++  +     M+ V   PET
Sbjct: 210 NLAIYIALWAIGAVAAPIVGPLLGASMVVAKNWRWCFWLLLWLAIPCLMICVFLFPET 267

>SAKL0H25498g Chr8 complement(2229233..2231041) [1809 bp, 602 aa]
           {ON} similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 602

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 93/222 (41%), Gaps = 20/222 (9%)

Query: 367 RPF-VLFCYPAVL----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           RP  +LF  P +L    + +F+Y   I++L++ A  I  + G   Y+   +        P
Sbjct: 383 RPIKMLFTEPILLLLTIYNSFVY--GILYLLLEAYPIVFIKGYHFYANGEL--------P 432

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKK---SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
           ++  I+G +     +  M R + K+   + G   PE RLF ++ +G+   +G++ F W+ 
Sbjct: 433 YIALIIGMIVNAAFNIYMERDYVKRVEANGGKPVPEARLFPMMVSGIIFPIGILWFCWTG 492

Query: 479 QAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
              D   ++ PT+    +GFG          + +DSY   A  A+     +++  G  F 
Sbjct: 493 NYPDKVHFMVPTVAGSFIGFGLMGIFLPCFNYIIDSYLFLAASAIAGNTFMRSGFGAVFP 552

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARR 578
            F        G     ++ G     +       Y YGK  R+
Sbjct: 553 LFAGFMFDGMGTNWAGLLLGLFAAAMVPVPFLFYKYGKVLRQ 594

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/353 (18%), Positives = 129/353 (36%), Gaps = 66/353 (18%)

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           I+   A  FG+R + L             A + +Y  ++  R +  +G+S   ++ S  V
Sbjct: 155 ISGGLADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVV 214

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVL 256
            +    HER   +G  +              + +    D   +FW +TI  G  F++  L
Sbjct: 215 GDFTLKHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFL 274

Query: 257 FVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXX 316
            +PET   +  +    SIR       A     + + G    +F+ +              
Sbjct: 275 VLPET---KRTIAGNLSIRPKKFINRA----PIFLLGPVRRRFKYDN------------- 314

Query: 317 XXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPA 376
                   +  L R   K+  S+  +                    +++L   +L  +P+
Sbjct: 315 ------PDYETLDRTVPKLDLSSAGK--------------------ILVLPEIILSLFPS 348

Query: 377 VLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLS 436
            L  A       +W +M++  I++     PY++  + IG+ Y+   +G ++GS   G + 
Sbjct: 349 GLLFA-------MWTLMLSS-ISSGLSVAPYNYRLVIIGVCYLPGGIGGLMGSFFTGRVI 400

Query: 437 D-----KMVRHFAKKSCGIYEPE-------FRLFMVLPAGLSTALGLMGFGWS 477
           D     K+ +    K+ G+   +        RL  +LP      +  + FGWS
Sbjct: 401 DMYFKRKLKKFELDKANGLIPQDAEINMFRVRLVCLLPQNFLAVVAYLLFGWS 453

>Skud_15.438 Chr15 complement(773226..775205) [1980 bp, 659 aa] {ON}
           YOR273C (REAL)
          Length = 659

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 85/220 (38%), Gaps = 7/220 (3%)

Query: 43  GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSIL 102
           GD + +T G     K    L+        +P NWP W++  A  +  + C V    +S+ 
Sbjct: 56  GDSSDTTNGEPVDPKD---LDWDGPDDPDNPHNWPSWKKWYATMISAFLCLVVTMGSSLY 112

Query: 103 AAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXX 162
            +    L   +H  ++    L           ++I +P + +FG++ +YL          
Sbjct: 113 VSSVPELVARYH--VNQTLALAGLTFYLLGLSTVIGAPLSEVFGRKPIYLFSLPLSMLFT 170

Query: 163 XXCAVSQNY-ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXX 221
               +S  +   +L  R +SG+  S   S+ S T+ +I+   + +  + ++         
Sbjct: 171 MGVGLSNGHMRIILPLRFLSGVFASPALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPV 230

Query: 222 XXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
                A F  +     W  WI  I  G+  +  +  +PET
Sbjct: 231 LSPIMAGFATQAEGWRWSEWIQLIAGGI-ILPFIAVMPET 269

>Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON}
           complement(4040..6043) [2004 nt, 668 aa]
          Length = 667

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 73/191 (38%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++  A  V    C V    +S+  +G   + L +   ++    L        
Sbjct: 92  NPHNWPTWKKWYACMVAAILCLVVTMGSSLYVSGVPEIVLRYK--VNQTLALAGLTFYLL 149

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ VY               ++  +   +L  R +SG+  S   S
Sbjct: 150 GLSTVIGAPLSEVFGRKPVYFFSLPISMLFTMGVGLANGHMRIILPLRFLSGVFASPALS 209

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +++   E    L F+                F  E     W  WI  +I G  
Sbjct: 210 VGSGTILDVFDLDEVPVALTFFCLAPFLGPVISPVMGGFACESQGWRWAEWI-QLIAGGL 268

Query: 251 FMLHVLFVPET 261
            +  +  +PET
Sbjct: 269 ILPFIALMPET 279

>TPHA0F00330 Chr6 (67642..69396) [1755 bp, 584 aa] {ON} Anc_4.30
           YLL028W
          Length = 584

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 67/161 (41%), Gaps = 4/161 (2%)

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKK--SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
           P++  I+G L       K   ++ KK    G   PE RL+ ++ +G+  A+G++ F W+ 
Sbjct: 415 PYIALIVGILICTVFLWKFEEYYLKKCREAGGLVPEIRLYPIIYSGVVFAIGILWFCWTG 474

Query: 479 QAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
                  ++ PT+    +GFG        + + ++SY   A  A+     L++  G  F 
Sbjct: 475 YYPKKIHFMVPTVAGAFIGFGLFGIFLPCLNYIIESYLFVAASAVAANTFLRSGFGAVFP 534

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRAR 577
            F        G     ++ G     +    I L  YGKR R
Sbjct: 535 LFTNYMFHGMGVGWAGLLLGLFAFAMVPVPIFLVKYGKRIR 575

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/189 (16%), Positives = 74/189 (39%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NWP+ ++     ++   C      +SI   G   L  E+  +       V        
Sbjct: 135 PFNWPLRKKVILCVILCLDCIAISMGSSIFGNGIAQLREEYGIATVVGILGVTLYVLGFA 194

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLP 192
              +I +P + I+G++ V ++            A ++N +++   R   GL  +   ++ 
Sbjct: 195 ASPVIYAPLSEIYGRKGVIIISAFGFSIFQFAVATAENLQTIFICRFFGGLIGAAPMAVV 254

Query: 193 SATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFM 252
            A  A+++  + R   +  ++              S++ ++    WL +++     + F+
Sbjct: 255 PAAFADMFDNNMRGKAISLFSLGVFVGPVLGPVIGSYIVQHTTWRWLEYVIGCFSALIFV 314

Query: 253 LHVLFVPET 261
           L  +F+ ET
Sbjct: 315 LICIFMEET 323

>ZYRO0E10054g Chr5 complement(804765..806651) [1887 bp, 628 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force- dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 628

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 79/208 (37%), Gaps = 2/208 (0%)

Query: 370 VLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS 429
           +L   P V F     S A     +   +I   + +  + +S    GL Y+S  +G  +G 
Sbjct: 317 MLISEPVVFFFGLWISFAWFLTFLFLSVIGITFSHFKH-WSEGVAGLPYISLVIGVTIGF 375

Query: 430 LCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
           L    L  +   +  KKS     PE RL+  +   +   +GLM + ++      WI P I
Sbjct: 376 L-TNFLQIRKYENMRKKSKYPLPPENRLYGAMTGAVFLPIGLMIYSFTQYHWLHWIGPNI 434

Query: 490 FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYK 549
            L  +  G      +  ++T D Y   A  A+     ++N +G     F     +    +
Sbjct: 435 GLACISLGIFFIFESCYSYTSDCYGPDASSAIAGQGFMRNTLGAVSPLFGKYMFLNMHSQ 494

Query: 550 TTFIVYGCVELIVCLFAIPLYHYGKRAR 577
              ++   V   + L    LY +G   R
Sbjct: 495 WAGLLCSLVAFGLTLLPFVLYKFGPAIR 522

>KNAG0I03080 Chr9 (617011..618789) [1779 bp, 592 aa] {ON} Anc_4.30
           YLL028W
          Length = 592

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 98/230 (42%), Gaps = 39/230 (16%)

Query: 367 RPFVLFCYPAVL-----FGAFLYSLAIVWLIMVAQIINTVYG-----NPPYSFSSIQIGL 416
           RP ++ C    L     + +F+Y   I++L++ A  I  V G     N    + ++ IG+
Sbjct: 374 RPLIMLCVEPTLLIITIYNSFVY--GILYLMLEAYPIVFVEGYGYRENGELPYIALIIGM 431

Query: 417 VYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGW 476
           +  + F+    G        D + R    +  G   PE RL+ ++ AG+   +G++ F W
Sbjct: 432 LVCAAFIWYFEG--------DYLKR---VRKAGKLVPEARLYPMIYAGIVFPIGILWFCW 480

Query: 477 SAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFA 534
           +        WI PTI    +GFG        + + ++SY   A  A+     L++  G A
Sbjct: 481 TGYYPKKIHWICPTIGGSFIGFGLMGIFLPCLNYIIESYLLVAASAVAANTFLRSAFGAA 540

Query: 535 FSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA-----IPLY--HYGKRAR 577
           F  F       +GY    +  G   L++ LFA     +P +   YG R R
Sbjct: 541 FPLF-------AGYMFRGMGTGWAGLLLGLFAAAMIPVPFFFLKYGARIR 583

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 35/204 (17%), Positives = 75/204 (36%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NW + ++     V+   C      +SI A+    +  ++H         +        
Sbjct: 143 PFNWSLKKKVMICVVLCLDCLCITMASSIFASAVPQICEKYHVIQVVAILGITLFVLGFA 202

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLP 192
              II +P + I+G++ V ++            A ++N +++   R   GL  +   ++ 
Sbjct: 203 ASPIIYAPLSEIYGRKGVLVIAAFGFALFQFAVATAENLQTIFICRFFGGLIGAAPMAVV 262

Query: 193 SATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFM 252
            A  A+++  + R   +  ++              S++ +     WL ++V      NF+
Sbjct: 263 PAAFADMFDTNMRGKAICLFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASFNFL 322

Query: 253 LHVLFVPETFWDRTPVPNERSIRE 276
           L   F  ET      V   + +R 
Sbjct: 323 LLSYFYDETHHPIILVRKAKQMRR 346

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 61/143 (42%), Gaps = 11/143 (7%)

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           I+   A +FG+R V L+            A + +Y  ++  RI+  +G+S   ++ S  V
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASIGLACAPSYGVIVFLRIIQSIGISPTIAISSGVV 204

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFM 252
            +    HER    G +               S +   L   W    +FW +TI  G +F+
Sbjct: 205 GDFTLKHER----GTFVGATSGLVLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFI 260

Query: 253 LHVLFVPETFWDRTPVPNERSIR 275
           +  L +PET   RT V N  SIR
Sbjct: 261 IAFLLLPET--KRTLVGN-LSIR 280

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 97/228 (42%), Gaps = 22/228 (9%)

Query: 375 PAVLFGAFLYSLAI-VWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAG 433
           P +L   F   L   +W +M++ I +T+    PY++    IG+ Y+   VG +LGS+  G
Sbjct: 329 PEILLSLFPGGLQFALWTVMLSSISSTL-SVAPYNYRLTIIGVCYLPGGVGGLLGSMLTG 387

Query: 434 PLSDKMVRH----FAKKSCGIYEPE--------FRLFMVLPAGLSTALGLMGFGWSAQAH 481
              D + +     + +K      PE         RL  +LP      +  + FGWSA   
Sbjct: 388 RFIDFLYKRARSDYERKKASGELPEDAVFNTFQVRLRAILPQNFIAVISFLLFGWSAD-- 445

Query: 482 DAWIAPTIFLG--VVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAF--SF 537
             W  P + +   V  F +    +++ T  VD Y   A  A    N ++  +   F   F
Sbjct: 446 KGWKIPAMLITSCVSSFCAMSTLSSSTTLLVDLYPKKASTASSCFNFIRCSLSSIFMGCF 505

Query: 538 FNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKRARRWTDSKGL 585
              K ++  G   TF+V G + +   L  IP+  YG + R   ++K L
Sbjct: 506 AKMKHSMTVGGTFTFMV-GLIFVGNFLMFIPM-KYGMQWRLEREAKDL 551

>CAGL0E03674g Chr5 complement(343351..345084) [1734 bp, 577 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1
          Length = 577

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 13/179 (7%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           IM+   P +L      ++ +F+Y   I++L++ A  I    G   Y F +    L Y+S 
Sbjct: 362 IMLFTEPLLLI---VTIYNSFVY--GILYLLLEAYPIVFEQG---YGFHT-NGELPYISL 412

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ-A 480
            +G  +       + +  +R + KK  G   PE RL  ++ AG+   +G++ F W+    
Sbjct: 413 IIGMAICGAFIWWMDEDYLRRYRKK--GGLVPEARLLPMVVAGIVFPIGILWFCWTGNYP 470

Query: 481 HDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
           H   WI PTI     GFG        + + ++SY   A  A+     +++  G AF  F
Sbjct: 471 HKIHWIVPTIAGAFTGFGLIGIFLPCLNYIIESYLLIAASAVAANTFMRSGFGAAFPLF 529

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/205 (15%), Positives = 83/205 (40%), Gaps = 2/205 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+ ++     ++  +C      +SI A G + +  E +  +  ++ L +       
Sbjct: 128 PFNWPLRKKVMLCIILCLNCISITMGSSIFATGIRQIC-EIYHVIPVVAILGITLYVLGF 186

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               +I +P + I+G+R V ++            A +++ ++++  R  +G   +   ++
Sbjct: 187 AASPVIYAPLSEIYGRRGVLVISSFGFALFNFAVATAKDLQTIMICRFFAGFIGAAPLAV 246

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
             A  A+++  + R   +  ++              S++ ++    WL +++       F
Sbjct: 247 VPAAFADMFDTNIRGKAICLFSLGVFVGPILAPVIGSYITQHTTWRWLEYVIACFASAIF 306

Query: 252 MLHVLFVPETFWDRTPVPNERSIRE 276
           +  + F  E+      V   + +R+
Sbjct: 307 VAILFFFEESHHPSILVGKAKELRK 331

>Kpol_478.3 s478 (12238..13980) [1743 bp, 580 aa] {ON}
           (12238..13980) [1743 nt, 581 aa]
          Length = 580

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 107/238 (44%), Gaps = 36/238 (15%)

Query: 355 RHSVDKWIMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYG-----NPPYSF 409
           + +V + I+++ R  +L      ++ +F+Y   I++L++ A  I  V G     N    +
Sbjct: 357 QKTVTRPIVMLFREPILLI--ITIYNSFVY--GILYLLLEAYPIVFVEGYGLRVNGELPY 412

Query: 410 SSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTAL 469
            ++ +G++  + F+  +          D       +K+ G+  PE RL+ ++ AG+   +
Sbjct: 413 IALIVGIMICTVFIWKM----------DAFYLSRVRKAGGLV-PEARLYPMIVAGVVFPI 461

Query: 470 GLMGFGWSAQ-AHDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVL 527
           G++ F W+    H   WI PTI    +GFG        + + ++SY   A  A+     +
Sbjct: 462 GILWFCWTGYYPHKIHWIVPTIAGSFIGFGLMGIFLPCLNYIIESYLFLAASAVAANTFM 521

Query: 528 KNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFA---IP----LYHYGKRARR 578
           +++ G  F  F       +GY    +  G   L++ LFA   IP    L  YGK  R+
Sbjct: 522 RSMFGAVFPLF-------AGYMFHNMGTGWAGLVLGLFAAAMIPVPLLLLKYGKAIRQ 572

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/206 (19%), Positives = 86/206 (41%), Gaps = 4/206 (1%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NW   ++     V+   C      +SI  +G   L  EFH  ++ +S L +       
Sbjct: 131 PFNWTTTKKVFLCTVLCLDCIAITMGSSIFGSGVLQLNEEFH-VITVVSVLGITLYVLGF 189

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGL-GVSTIES 190
               II +P + ++G++ V ++            AVS++++S++  R   GL G + +  
Sbjct: 190 AASPIIYAPLSELYGRKGVIILSAFGFSVFQFAVAVSKDFQSIMICRFFGGLIGAAPMAV 249

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           +P A  A+++  + R   +  ++              S++ ++    WL +++       
Sbjct: 250 VP-ACFADMFDTNMRGKAIALFSLGVFVGPILGPVMGSYIVQHTTWRWLEYVIGCFSAAI 308

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRE 276
           F+  + F+ ET      V   + +R+
Sbjct: 309 FVALLFFMEETHHPSILVNKAKQMRK 334

>Skud_15.531 Chr15 (957329..958948) [1620 bp, 539 aa] {ON} YBR008C
           (REAL)
          Length = 539

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y F+ +++GL Y+   VG  L     G L+ K++    +   G   PE  L M +    S
Sbjct: 361 YQFTLVEMGLAYMGFCVGCFLAYGLFGVLNKKII--VPRFRNGTLTPEVFLIMAMCVSWS 418

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+AQ H  WI P I
Sbjct: 419 LPLSLFLFGWTAQVH--WILPII 439

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 73/192 (38%), Gaps = 2/192 (1%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NW + ++   +F +    FV    +SI   G + +  EFH      +  +       
Sbjct: 85  NPHNWSLQKKSLVVFQIMLLTFVTYMGSSIYTPGQEYIQEEFHVGHVVTTLNLSLYVLGY 144

Query: 132 XXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIE 189
               II SP + I  +G+  +Y++           CA   +   L   R +SG+  S   
Sbjct: 145 GLGPIIFSPLSEIARYGRLNLYMITLSLFMIFQVGCATVHSIGGLTVMRFISGILCSPSL 204

Query: 190 SLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGV 249
           +    TV +I         LG ++              + + +  +  ++FW++  +   
Sbjct: 205 ATGGGTVTDIISPEMVPLVLGIWSAGVFSAPVFAPLLGAAMVDAKNWRFIFWLLMWLSAA 264

Query: 250 NFMLHVLFVPET 261
            F+L   F PET
Sbjct: 265 TFILLAFFFPET 276

>Smik_2.128 Chr2 complement(240029..241672) [1644 bp, 547 aa] {ON}
           YBR008C (REAL)
          Length = 547

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 77/198 (38%), Gaps = 3/198 (1%)

Query: 66  PSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVX 125
           PS ++ +P NW V ++   +F V     V    +SI   G + +  EFH      +  + 
Sbjct: 88  PSDAE-NPQNWSVPKKSLVIFQVMLLTCVTYMGSSIYTPGQEYIQEEFHVGHVVATLNLS 146

Query: 126 XXXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGL 183
                     II SP + I  +G+  +Y+V           CA   N   L+  R +SG+
Sbjct: 147 LYVLGYGLGPIIFSPLSEIARYGRLYLYMVTLFFFMIFQVGCATVHNIGGLIVMRFISGI 206

Query: 184 GVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIV 243
             S   +    TVA+I         LG ++              + + +  +  ++FW++
Sbjct: 207 LCSPSLATGGGTVADIISPEMVPLILGMWSAGAVAAPVLAPLLGAAMVDAKNWRFIFWLL 266

Query: 244 TIIVGVNFMLHVLFVPET 261
             +    F+L     PET
Sbjct: 267 MWLSAATFILLAFLFPET 284

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y FS I++GL Y+   VG +        L+ +++    K   G + PE  L + +    S
Sbjct: 369 YHFSLIEVGLAYMGFCVGCVFAYGLFAFLNIRIIVPRFKN--GTFTPEAFLIVAMCVCWS 426

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+A+ H  WI P I
Sbjct: 427 LPLSLFLFGWTARVH--WILPVI 447

>Suva_8.322 Chr8 complement(573995..575953) [1959 bp, 652 aa] {ON}
           YOR273C (REAL)
          Length = 652

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 78/195 (40%), Gaps = 12/195 (6%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRS----LSDISYLVXXX 127
           +P NWP W++  A       C V    +S+  +    L   +H S    LS +++ +   
Sbjct: 75  NPHNWPSWKKWYATMSSALLCLVVTMGSSLYVSSVPELVARYHVSRTLALSGLTFYL--- 131

Query: 128 XXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVS 186
                  ++I +P + +FG++ VYL              +S  +   +L  R +SG+  S
Sbjct: 132 ---LGLATVIGAPLSEVFGRKPVYLFSLPASMLFTMGVGLSNGHMRIILPLRFLSGVFAS 188

Query: 187 TIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTII 246
              S+ S T+ +I+   + +  + ++              A F  E     W  WI  +I
Sbjct: 189 PALSVGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWI-QLI 247

Query: 247 VGVNFMLHVLFVPET 261
            G   +  +  +PET
Sbjct: 248 AGGMVLPFIATMPET 262

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 44/107 (41%), Gaps = 15/107 (14%)

Query: 469 LGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSY--KCY----AQEALV 522
           +GL    W+A+A   W+AP       GFG  L     I F+V  Y   CY        L 
Sbjct: 430 IGLFWQAWTARADVHWMAPVAAGVPFGFGLIL-----IFFSVLMYFSTCYPPLTVASCLA 484

Query: 523 TLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPL 569
             N+L+ VM   F  F  +   K   K    ++     ++C+  IP+
Sbjct: 485 ANNLLRYVMSSVFPLFTIQMYTKMKIKWASTLFA----LLCVVMIPI 527

>AER339C Chr5 complement(1259842..1261563) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR273C
           (TPO4)
          Length = 573

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 74/191 (38%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP+W++ +   V    C      +S+       L  E+   ++             
Sbjct: 64  NPHNWPLWKKWSTAMVSALLCLAVTMGSSLYMGAVPTLVKEY--GVNQTLACAGLSLYLL 121

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYES-LLASRIVSGLGVSTIES 190
              +++ +P + +FG++ VYL+             +S    + +L  R+ SG+  S   S
Sbjct: 122 GLATVVGAPLSEVFGRKPVYLISLPISLLFSLGVGLSNGRMAVILPMRLFSGIFASPALS 181

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   E +  +  +                +  E     W+ WI  I  GV 
Sbjct: 182 VASGTIVDIFDVDEVSVAMSLFCMAPFLGPVISPIMGGYAAENGGWRWVVWIRLISGGV- 240

Query: 251 FMLHVLFVPET 261
            M  ++ +PET
Sbjct: 241 LMPMLIVMPET 251

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 55/155 (35%), Gaps = 2/155 (1%)

Query: 453 PEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDS 512
           PE  L +     L+  + L   GWSA+    WI P +     GFG  L   + + +   +
Sbjct: 401 PEMFLTVTKFGSLALPVALFWLGWSARPSVHWIVPALAGIPFGFGMILIFFSVLMYFTTT 460

Query: 513 YKCY-AQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYH 571
           Y       A    N+L+ V    F  F  +     G      V+G + L +         
Sbjct: 461 YPVLVVSSAFAANNLLRYVTSCVFPLFTIQMYENLGIGWASSVFGFISLALVPVPWIFER 520

Query: 572 YGKRARRWTDSKGLLDFSYVKKNHSRGSTGDRHME 606
           YGK A R     G    +  ++     S G   ++
Sbjct: 521 YGK-AMRHKSVFGYNAMATARQQEENASEGQLKLD 554

>TBLA0A08520 Chr1 (2101458..2103356) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/211 (16%), Positives = 88/211 (41%), Gaps = 2/211 (0%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VX 125
           +  K  P NW +  +     ++   C      +SI A G   ++ E +  ++ ++ L + 
Sbjct: 177 ADDKLHPFNWSMKEKTITCAILCLDCITITLGSSIFAPGVTQIS-EQYDIITVVAILGIT 235

Query: 126 XXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                     ++ +P + I+G++++ ++            A ++N ++++  R  SGL  
Sbjct: 236 LYVLGFAASPVLYAPLSEIYGRKLILVISGFGFALFQFAVATAENLQTIMICRFFSGLIG 295

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTI 245
               ++  A  A+++  + R   +  ++              S++ ++    WL ++V  
Sbjct: 296 GAPMAVVPAVFADMFDTNFRGKAICLFSAFVFIGPILGPIMGSYIVQHTSWRWLNYVVGC 355

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
           +  + F+L  +FV E+      V   R +R+
Sbjct: 356 LASLVFVLLCVFVKESHHATILVNKARKMRK 386

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 35/229 (15%)

Query: 367 RPFVL-FCYPAVL----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           +P VL F  P +L    + +F+Y   I++L++ A  I  + G   Y  + +   L Y++ 
Sbjct: 414 KPIVLLFTEPVLLVISLYNSFVY--GILYLLLEAYPIVFIQG---YGLT-VNGYLPYLAL 467

Query: 422 FVGSILGSLCAGPL---SDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSA 478
            VG I+   CAG +        +  AK+   +  PE RL+ ++ +G+   +G++ F W+ 
Sbjct: 468 IVGIII---CAGMIWYADTDYSQQVAKQKKLL--PERRLYPIIISGIVFPIGILWFCWTG 522

Query: 479 QAHDA--WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFS 536
              +   WI PTI    +GFG        + + ++SY   A  A+     +++  G  F 
Sbjct: 523 AYPEKIHWICPTIAGSFIGFGLIGIFLPCLNYIIESYLFIAASAVAANTFMRSTFGAVFP 582

Query: 537 FFNTKFNVKSGYKTTFIVYGCVELIVCLFA---IP----LYHYGKRARR 578
            F       +GY    +  G   L++ LFA   IP    L  YG   R 
Sbjct: 583 LF-------AGYMFKGMGTGWAGLLIGLFAAAMIPVPFLLLKYGPTIRE 624

>Suva_10.43 Chr10 (89159..90922) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 102/226 (45%), Gaps = 27/226 (11%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           +M+ + P +LF     ++ +F+Y   I++L++ A  +  V G   Y F+     L Y++ 
Sbjct: 372 VMLFVEPLLLF---VTIYNSFVY--GILYLLLEAYPLVFVEG---YGFTE-NGELPYIAL 422

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ-A 480
            +G ++ +     + +  +R    K  G   PE RL+ ++ AG    +G++ F W+    
Sbjct: 423 IIGMVVCAAFIWYMDNDYLRRCKAK--GGLVPEARLYAMIIAGTIFPIGILWFCWTGYYP 480

Query: 481 HDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
           H   W+ PT+    +GFG        + + ++SY   A  A+     +++  G  F  F 
Sbjct: 481 HKIHWMVPTVGGSFIGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRSGFGACFPLF- 539

Query: 540 TKFNVKSGYKTTFIVYGCVELIVCLFA-----IPL--YHYGKRARR 578
                 +GY    +  G   L++ LF+     +PL    YG+  RR
Sbjct: 540 ------AGYMFRGMGIGWAGLLLGLFSAAMIPVPLLFLKYGETIRR 579

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/207 (17%), Positives = 81/207 (39%), Gaps = 2/207 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+ ++    FV+   C      +SI A+    +  E +  +  ++ L +       
Sbjct: 138 PFNWPMKKKVLLCFVLCLDCIAIAMCSSIFASAVPQIC-EIYHVIEVVAILGITLFVLGF 196

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               II +P + ++G++ V ++            A ++N +++   R   G   +   ++
Sbjct: 197 AASPIIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMAV 256

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
             A  A+++  + R   +  +               S++ +     WL ++V     + F
Sbjct: 257 VPAAFADMFDTNVRGKAIALFALGVFVGPILAPVMGSYIAQRTTWRWLEYVVGCFASLVF 316

Query: 252 MLHVLFVPETFWDRTPVPNERSIRETA 278
           +L  LF  ET      V   + +R+ +
Sbjct: 317 VLIALFFEETHHPTILVNKAKQMRKQS 343

>TBLA0A08510 Chr1 (2095273..2097174) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 81/205 (39%), Gaps = 2/205 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NW   R+     ++   C      +SI A G   L  ++H         +        
Sbjct: 184 PFNWSKKRKFLTCLILCIDCITISWGSSIYAPGVTQLCEQYHVIQVVAILGITLYVLGFA 243

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG-LGVSTIESL 191
              II +P + ++G++ V +V            A ++N+++++  R  +G +G + +  +
Sbjct: 244 ASPIIYAPLSELYGRKGVLVVSGLGFALFQFAVATAENFQTIMICRFFAGFIGAAPMAIV 303

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
           P A  A+++    R   +  +T              S++ ++    WL ++V       F
Sbjct: 304 P-AVFADMFDTDFRGKAICLFTLGVFVGPILGPVMGSYIVQHTTWRWLNYVVGFQACAVF 362

Query: 252 MLHVLFVPETFWDRTPVPNERSIRE 276
           +  VLFV ET      V   + +R+
Sbjct: 363 VAIVLFVEETHHPTILVNKAKLLRK 387

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 16/141 (11%)

Query: 446 KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLAST 503
           K  G   PE RL+ ++ AG+   +G++ F W+    +   WI PTI    +GFG      
Sbjct: 491 KKEGKLIPEDRLYPMIVAGIIFPIGILWFCWTGAYPEKIHWICPTIAGSFIGFGLMGIFL 550

Query: 504 TAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVC 563
             + + ++SY      A+     +++  G  F  F       +GY    +  G   L++ 
Sbjct: 551 PCLNYIIESYLLLTASAVAANTFMRSAFGAVFPLF-------AGYMFKGMGIGWAGLLIG 603

Query: 564 LFA---IPL----YHYGKRAR 577
           LFA   IP+      YGK  R
Sbjct: 604 LFAAAMIPVPFLFLKYGKTIR 624

>CAGL0H06039g Chr8 complement(592526..594295) [1770 bp, 589 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008c FLR1
          Length = 589

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 89/224 (39%), Gaps = 25/224 (11%)

Query: 363 MVMLRPFVLF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVS 420
           M+ L P +L    Y A+ +GAF Y     + I+ A I         Y F+ +++GL ++ 
Sbjct: 373 MIALEPIILAFDVYIALCYGAF-YLFFEAFPIVFAGI---------YHFTLVEVGLAFLG 422

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQA 480
             VG +          +K++R   K   G + PE  L + +  G      L  FGW+A+ 
Sbjct: 423 FCVGCVFAYTALIIFQEKVIRK--KFLEGKFRPELFLILAMCLGWCLPFSLFFFGWTARI 480

Query: 481 HDAWIAPTIFLGVVGFGSSLASTTAITFTVDS--YKCYAQEALVTLNVLKNVMGFAFSFF 538
           H  WI P I    + F  S+ +    TF+  +  Y  Y         + +     AF  F
Sbjct: 481 H--WILPII--AELFFVLSVFNLFQATFSYLAVCYPEYVASVFAGNGLCRGAFAAAFPLF 536

Query: 539 NTKFNVKSGYKTTFIVYGC-----VELIVCLFAIPLYHYGKRAR 577
                 +   K   + +G      + +++ L    LY YG   R
Sbjct: 537 GKAMYDRLSTKKYPVAWGSTLIGFITVVLSLIPFVLYKYGPALR 580

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/233 (19%), Positives = 83/233 (35%), Gaps = 8/233 (3%)

Query: 37  AMMGGPG------DDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGW 90
           AM GG G      DD+ +            ++        R P NW   ++   +  +  
Sbjct: 92  AMSGGQGVFGTEEDDSSTKDASKPEEADPFLVEFLGEDDPRKPWNWSFSKKTFVIVQLMV 151

Query: 91  HCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVI--FGKR 148
              +    +SI   G + +  EFH      +  +           II SP + +   G+ 
Sbjct: 152 LTCINYMGSSIYTPGQEQIQHEFHVGHVVGTLNLSMYVLGYAIGPIIFSPLSEVSSIGRM 211

Query: 149 IVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYR 208
            +YL            CA+ +N   L+  R ++G+  S + +   A+V ++ F       
Sbjct: 212 PLYLWTFILFTILQVACALVRNIAGLVILRFITGILCSPVLATGGASVGDVCFPRYVPRF 271

Query: 209 LGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
           LG +               + +    D  W+FW++  + G   +  + F PET
Sbjct: 272 LGAWAVGAVAAPVMAPILGAAMVVAKDWRWIFWLMLFMCGATLLSIIFFFPET 324

>Kwal_26.8985 s26 complement(1029923..1031665) [1743 bp, 580 aa]
           {ON} YOR273C (TPO4) -  [contig 68] FULL
          Length = 580

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 83/220 (37%), Gaps = 8/220 (3%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP WR+  A       C V    +S+   G   + LE+    S    L        
Sbjct: 27  NPHNWPTWRKWFATMTSAMLCLVVTMGSSLYVNGVPRMVLEY--GYSQTLALAGLTFYLL 84

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQ-NYESLLASRIVSGLGVSTIES 190
              ++I +P + I+G++ VY +            A+S      +L  R  SG+  S   S
Sbjct: 85  GLSTVIGAPLSEIYGRKPVYAISLPLSMLFSMGVALSNGKMRIILPMRFFSGVFASPALS 144

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   E +  +  +              A F  E     W  +I  +  G  
Sbjct: 145 VASGTIVDIWDMDEISIAMSLFCLAPFLGPVISPVIAGFATEKQGWRWATYI-QLFAGGL 203

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRETA--IARAADGARD 288
            M  ++ + ET   +T +  +R+ +     I  +A   +D
Sbjct: 204 IMPFIVLMSET--HKTVILTKRAQKRNVNLIKPSAQDKKD 241

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 66/171 (38%), Gaps = 20/171 (11%)

Query: 452 EPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVD 511
           +PE  L +     ++  + L   GW+++A   W+AP       GFG  L   + I +   
Sbjct: 363 KPEKLLDICKIGSIALPISLFWLGWTSKASVHWMAPMAAGVPFGFGLILIFFSVIMYFSS 422

Query: 512 SY-KCYAQEALVTLNVLKNVMGFAFSFFNTKF--NVKSGYKTTFIVYGCVELIVCLFAIP 568
            Y   +   AL   N+L+ V    F  F  +    +K G+ ++   + CV +I   +   
Sbjct: 423 CYPPLFVASALAANNLLRYVTSCVFPLFTIQMYEKMKIGWASSLFGFICVAMIPLPWI-- 480

Query: 569 LYHYGKRARRWTDSKGLLDFSYVKK-----------NHSRGSTGDRHMEDS 608
              YG+  R+    K    F  V+            +H R S      ED+
Sbjct: 481 FERYGETMRQ----KSTFGFDVVQHEIEDDDRRESMSHKRISDDKHEYEDT 527

>TBLA0D01160 Chr4 (296153..298081) [1929 bp, 642 aa] {ON} Anc_8.723
           YOR273C
          Length = 642

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 75/191 (39%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NW   ++ +   +    C V    +S+   G   + L++H   S    L        
Sbjct: 63  NPHNWSTLKKWSCTMIAAILCLVVTMGSSLYVTGVPEMVLQYH--YSQTLALAGLTFYLF 120

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYES-LLASRIVSGLGVSTIES 190
              + + +P + +FG++ VY++            A+S   +  +L  R  SG+  S   S
Sbjct: 121 GLSTTMGAPLSEVFGRKPVYVISLPLSMLFAMGVALSGGKQRIILPLRFFSGVFASPALS 180

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           +   T+ +++   E +  + F+              ASF  E     W  +I  I  GV 
Sbjct: 181 VAGGTIMDVFDIDEVSVSMTFFCLAPFLGPVISPVMASFATEKKGWRWATYIQLIAGGV- 239

Query: 251 FMLHVLFVPET 261
            M  ++ +PET
Sbjct: 240 IMPFLILMPET 250

>TBLA0E03790 Chr5 (953931..955583) [1653 bp, 550 aa] {ON} Anc_2.242
           YNL065W
          Length = 550

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 87/239 (36%), Gaps = 17/239 (7%)

Query: 42  PGDDAPSTGGVVQTTKKGIILNPQPSKSKRD----PLNWPVWRRDTALFVVGWHCFVGGG 97
           P DD     G    T  G+      ++ + D    P +W   +++ A  VV   C   G 
Sbjct: 55  PTDDDDDEEGNHHDTTNGMYKTKSQNRDEPDIDSPPYSW-FDKKEKAFLVV--QCAFTGL 111

Query: 98  QTSILAAGS------KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVY 151
            +S+  AGS        L ++FH +   I+  V            +    A   G+R V 
Sbjct: 112 LSSL--AGSIYYPVLSVLEVKFHITEEQINISVVVYYVFQAVSPTLMGGLADSLGRRPVI 169

Query: 152 LVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGF 211
           +             A   NY  L+  R +   G+S + ++ S  + ++    ER   +G 
Sbjct: 170 ITSVFLYFCACIGLACCNNYSQLIGLRCLQATGISPVIAVNSGLMGDVTTKAERGGYMGL 229

Query: 212 YTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPN 270
            +              + +F       +FW + I  GV  +L +  +PET   RT V N
Sbjct: 230 VSGTQVLGTAFGALIGAALFSRWGWRSIFWFLVIGSGVCLVLSLFILPET--KRTVVGN 286

>Suva_8.420 Chr8 (755472..757112) [1641 bp, 546 aa] {ON} YBR008C
           (REAL)
          Length = 546

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 74/193 (38%), Gaps = 2/193 (1%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +P NWP+ ++   +  +     V    +SI   G + +  EF+      +  +      
Sbjct: 91  ENPQNWPLLKKSVVVAQIMVLTCVTYMGSSIYTPGQEAIQSEFNVGHVVATLNLSMYVLG 150

Query: 131 XXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                II SP + I  +G+  +Y++           CA   N   L+  R +SG+  S  
Sbjct: 151 YGLGPIIFSPLSEIARYGRLYIYMITLFFFTIFQIGCATVHNIGGLIVMRFISGILCSPS 210

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            +    TVA+I         LG ++              + + +  +  ++FW++  +  
Sbjct: 211 LATGGGTVADIISPEIVPLVLGMWSAGAVAAPVLAPLLGAAMIDAKNWRYIFWLLMWLSA 270

Query: 249 VNFMLHVLFVPET 261
              ++ V F PET
Sbjct: 271 ATLIVLVFFFPET 283

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 72/178 (40%), Gaps = 13/178 (7%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y+F+ +++G+ Y+   VG +   +    LS +++    K   G + PE  L + +     
Sbjct: 368 YNFTLVEVGVAYMGFCVGCVFAYILFAILSMRIIVPRFKN--GTFTPEAFLIVAMSVCWC 425

Query: 467 TALGLMGFGWSAQAHDAWIAPTI--FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTL 524
             L L  FGW+A+ H  WI P I     V+   +   +T A  +    Y  Y        
Sbjct: 426 LPLSLFLFGWTAKVH--WILPIISEVFFVIAVFNIFQATFA--YLATCYPKYVASVFAGN 481

Query: 525 NVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVEL---IVCLFAIP--LYHYGKRAR 577
           +  + V   AF  F      K   K   + +G   +    + L AIP  LY YG   R
Sbjct: 482 SFCRAVFACAFPLFGKAMYDKLATKNYPVAWGSSLVGFFTLALAAIPFVLYKYGPALR 539

>YLL028W Chr12 (84804..86564) [1761 bp, 586 aa] {ON}  TPO1Polyamine
           transporter that recognizes spermine, putrescine, and
           spermidine; catalyzes uptake of polyamines at alkaline
           pH and excretion at acidic pH; phosphorylation enhances
           activity and sorting to the plasma membrane
          Length = 586

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 103/228 (45%), Gaps = 31/228 (13%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           IM+ + P +LF     ++ +F+Y   I++L++ A  +  V G   Y F+  + G +   P
Sbjct: 371 IMLFVEPLLLF---VTIYNSFVY--GILYLLLEAYPLVFVEG---YGFT--ENGEL---P 417

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKK--SCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ 479
           ++  I+G +        M   + K+  + G   PE RL+ ++ AG    +G++ F W+  
Sbjct: 418 YIALIIGMMVCAAFIWYMDNDYLKRCRAKGKLVPEARLYAMVIAGTVFPIGILWFCWTGY 477

Query: 480 -AHDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSF 537
             H   W+ PT+    +GFG        + + ++SY   A  A+     +++  G  F  
Sbjct: 478 YPHKIHWMVPTVGGAFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPL 537

Query: 538 FNTKFNVKSGYKTTFIVYGCVELIVCLFA-----IPL--YHYGKRARR 578
           F       +GY    +  G   L++ LFA     +PL    YG+  R+
Sbjct: 538 F-------AGYMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGESIRK 578

>SAKL0H05412g Chr8 (486897..488639) [1743 bp, 580 aa] {ON} similar
           to uniprot|Q12256 Saccharomyces cerevisiae YOR273C TPO4
           Polyamine transport protein
          Length = 580

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 75/191 (39%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NW   ++  A  V    C V    +S+  AG   L + +   +++   L        
Sbjct: 32  NPHNWSSLKKWYATMVAALLCLVVTMGSSLYVAGVPELVVSY--GVNETLALAGLTFYLL 89

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVS-QNYESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ +Y+              +S      +L  R  SG+  S   S
Sbjct: 90  GLSTVIGAPLSEVFGRKPIYVASLPLSMLFTMGVGLSGGKMRVILPLRFFSGVFASPALS 149

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   E +  + F+              A F  +     W  WI  +I G  
Sbjct: 150 VASGTIVDIWDMDEVSIAMAFFCLAPFLGPVISPVMAGFAAQSKGWRWPSWI-QLIAGGI 208

Query: 251 FMLHVLFVPET 261
            +  ++F+PET
Sbjct: 209 ILPFIVFMPET 219

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 57/134 (42%), Gaps = 13/134 (9%)

Query: 452 EPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVD 511
           +PE  L +     +S  +GL   GWSA+A   W+AP       GFG  L   + + +   
Sbjct: 368 KPERFLLICKVGAISLPIGLFWLGWSAKASVHWMAPVSAGVPFGFGLILIFFSVMMYFSA 427

Query: 512 SY-KCYAQEALVTLNVLKNVMGFAFSFFNTKF--NVKSGYKTTFIVYGCVELIVCLFAIP 568
           SY   +   AL   N+L+ +    F  F  +    +   + T+   +      VCL  +P
Sbjct: 428 SYPPLFVASALAANNLLRYITCCIFPLFTLQMYERLHIDWATSLFAF------VCLGMLP 481

Query: 569 L----YHYGKRARR 578
           L      YG+R R+
Sbjct: 482 LPWIFERYGERLRK 495

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 61/155 (39%)

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
           + L  EF  S   ++  V            + S  A  +G+R V L+            A
Sbjct: 94  RNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIVSSIGIA 153

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            S ++  ++A R +   G+S I ++ S  V +     ER   +G  +             
Sbjct: 154 CSNSFALVIALRCIQSSGISPIIAINSGVVGDFTLKSERGTFIGAVSGLTLLGQAFGSLI 213

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
            + +    +   +FW +TI  GV F+ + LF+PET
Sbjct: 214 GASLTAAYNWRAVFWFMTIGCGVCFLANFLFLPET 248

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 79/198 (39%), Gaps = 24/198 (12%)

Query: 406 PYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKK-------SCGIYEP----E 454
           PY++    +GL Y+   +  +LGS   G L D   R+FA +       S G   P    E
Sbjct: 339 PYNYPLTTVGLCYLPSGICGLLGSFLTGKLIDIWYRYFADRFQRRSANSSGPSAPFNVLE 398

Query: 455 FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYK 514
            R+   LP    + +  + FGWS Q       P +  GV  F      +T+ T  +D Y 
Sbjct: 399 ARIVAGLPQNFISVMAFIIFGWSIQGGWHISVPLVASGVGTFCVMSTLSTSSTLLIDLYP 458

Query: 515 CYAQEALVTLNVLKNVMG--FAFSFFNTKFNVKSGYKTTFIVYGCVELIV--CLFAIPLY 570
             A  A    N ++  +   F   F   K ++  G   TF+   C  + V  C    P+ 
Sbjct: 459 NRASTASSCYNFIRCTLSALFLAVFARMKASMTIGGTFTFL---CSLIFVGNCALIFPM- 514

Query: 571 HYG-----KRARRWTDSK 583
            YG     +R RR  ++ 
Sbjct: 515 KYGMTWRDRRLRRAAEAS 532

>Smik_12.27 Chr12 (69102..70865) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 104/227 (45%), Gaps = 29/227 (12%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIG-LVYVS 420
           IM+ + P +LF     ++ +F+Y   I++L++ A  +  V G   Y F  ++ G L Y++
Sbjct: 372 IMLFVEPLLLF---VTIYNSFVY--GILYLLLEAYPLVFVEG---YGF--VENGELPYIA 421

Query: 421 PFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ- 479
             +G I+ +     + +  +R    K  G   PE RL+ ++ AG    +G++ F W+   
Sbjct: 422 LIIGMIVCAAFIWYMDNDYLRRCKAK--GKLVPEARLYAMVVAGTIFPIGILWFCWTGYY 479

Query: 480 AHDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
            H   W+ PT+    +GFG        + + ++SY   A  A+     +++  G  F  F
Sbjct: 480 PHKIHWMVPTVGGAFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPLF 539

Query: 539 NTKFNVKSGYKTTFIVYGCVELIVCLFA-----IPL--YHYGKRARR 578
                  +GY    +  G   L++ LFA     +PL    YG+  R+
Sbjct: 540 -------AGYMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGESIRK 579

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 33/207 (15%), Positives = 79/207 (38%), Gaps = 2/207 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP+ ++     V+   C      +SI A+    +  E +  +  ++ L +       
Sbjct: 138 PFNWPMKKKVLICLVLCLDCIAIAMCSSIFASAVPQIC-EIYHVIEVVAILGITLFVLGF 196

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESL 191
               ++ +P + ++G++ V ++            A ++N +++   R   G   +   ++
Sbjct: 197 AASPVVYAPLSELYGRKGVLVLSAFGFAIFQFAVATAENLQTIFICRFFGGFIGAAPMAV 256

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
             A  A+++  + R   +  +               S++ +     WL ++V       F
Sbjct: 257 VPAAFADMFDTNIRGKAIALFALGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAVF 316

Query: 252 MLHVLFVPETFWDRTPVPNERSIRETA 278
           +  VLF  ET      V   + +R+ +
Sbjct: 317 VAIVLFFEETHHPTILVNKAKQMRKQS 343

>Skud_2.121 Chr2 complement(233273..234913) [1641 bp, 546 aa] {ON}
           YBR008C (REAL)
          Length = 546

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 73/193 (37%), Gaps = 2/193 (1%)

Query: 71  RDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXX 130
            +P NWP+ ++   +  +     V    +SI   G + +  EF       +  +      
Sbjct: 91  ENPQNWPLVKKSWVVAQIMLLTCVTYMGSSIYTPGQEYIQEEFRVGHVVATLNLSVYVLG 150

Query: 131 XXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTI 188
                II SP + I  +G+  +Y+V           CA   N   L+  R +SG+  S  
Sbjct: 151 YGLGPIIFSPLSEIARYGRLNLYMVTLFFFMIFQIGCATVHNIGGLIVMRFISGVLCSPS 210

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            +    TVA+I         LG ++              + + E  +  ++FW++  +  
Sbjct: 211 LATGGGTVADIISPEMVPLVLGMWSAGAVAAPILAPLLGAAMVEAKNWRFIFWLLMWLSA 270

Query: 249 VNFMLHVLFVPET 261
             F+L   F PET
Sbjct: 271 ATFVLLAFFFPET 283

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y FS I++GL Y+   VG +      G L+ +++    +   G + PE  L + +     
Sbjct: 368 YHFSLIEVGLAYMGFCVGCVFAYGLFGILNMRII--VPRFRNGTFTPEAFLIVAMSVCWC 425

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
               L  FGW+A+ H  WI P I
Sbjct: 426 LPFSLFLFGWTAKVH--WILPVI 446

>ZYRO0E09966g Chr5 (793128..794813) [1686 bp, 561 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 561

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 109/583 (18%), Positives = 200/583 (34%), Gaps = 83/583 (14%)

Query: 7   IQQPKTNDDSGSTGKNSQSKAP--VIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNP 64
           + +  T+ D  +    +  K P  V+  TG  ++ GG G+      G  +      ++  
Sbjct: 43  LSKDSTSKDESNVDLEALEKQPSAVLANTGG-SVSGGDGNSGELKDG--KDATDPYLVQF 99

Query: 65  QPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLV 124
           + +K    P NW  +++   +  +     V    ++I   G + +  EF       +  +
Sbjct: 100 RGTKDPDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGVGHVVGTLNL 159

Query: 125 XXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG 182
                      ++ SP +   ++G++ +Y++           CA+  N   L+  R ++G
Sbjct: 160 SMYVLGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRFITG 219

Query: 183 LGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWI 242
           +  S   +  +A++ +I         +G ++              + +    +  W+FW+
Sbjct: 220 ILCSPSLATGAASIGDIVKPELVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWRWIFWL 279

Query: 243 VTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGE 302
           +  +     +L V F PET  D         IR                      K  G+
Sbjct: 280 LMWMSAALLILLVFFFPETGEDNILYRRCMRIR----------------------KITGD 317

Query: 303 EDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWI 362
           +                   + + + +R   K+   +IA   L     I      V + I
Sbjct: 318 D-------------------RYYTFKAREEAKLTFKDIAVVALYRPFEII-----VKEPI 353

Query: 363 MVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPF 422
           ++ L  ++  CY    F  F  +  IV+                Y F+ I++GL Y+   
Sbjct: 354 VLALDIYIALCYGT--FYLFFEAFPIVF-------------AGVYHFTLIELGLAYMGFC 398

Query: 423 VGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHD 482
           VG +     +     +     AKK+   + PE  L + +       L L  FGW+A  H 
Sbjct: 399 VGCVFAYAISLIFLTQYAARQAKKNK--FTPETFLVLAMGVCWCLPLALFLFGWAASVH- 455

Query: 483 AWIAPT---IFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
            W  P    IF  +  F    A+     +   SY  Y         V++     AF  F 
Sbjct: 456 -WTLPMLAEIFFVICVFNLFQAT---FAYLAMSYPKYMASVFAGNGVMRAGFACAFPLFG 511

Query: 540 TKFNVKSGYKTTFIVYGCVEL---IVCLFAIP--LYHYGKRAR 577
                    K   + +G   L    + L AIP  LY YG   R
Sbjct: 512 KAMYDNLAIKGYPVAWGSSLLGFFSIGLAAIPFLLYKYGPYLR 554

>TPHA0A00130 Chr1 complement(10942..12645) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/263 (19%), Positives = 94/263 (35%), Gaps = 15/263 (5%)

Query: 7   IQQPKTNDDSGSTGKNS------QSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGI 60
           ++  K ND+  S   +S       ++ P++ +        G  D+       V+     +
Sbjct: 49  VETKKENDEQESFQVSSDFESLNNAEKPIVDIEA------GSADEESQKQKTVEERDPFL 102

Query: 61  ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI 120
           +    PS     P+NW   +R   L  +     V    +SI   G   +  EF       
Sbjct: 103 LEWDDPSDPDF-PVNWSKKKRGAILLQIMLLTSVTYMGSSIYTPGQLQIQSEFGVGHVVA 161

Query: 121 SYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASR 178
           +  +           +I SP +   + G++ +Y V           CA   N+  L+  R
Sbjct: 162 TLNLSLYVLGYGLGPLIFSPLSEFSLLGRQHLYTVTLFIFTILQIGCATVHNFGGLVVLR 221

Query: 179 IVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW 238
            +SG+  S   S   A++++I         LG +               + +    D  W
Sbjct: 222 FLSGVFCSPSLSTGGASISDILAPEVVPLFLGLWAVGAISAPVLAPLLGAAMVVAEDWRW 281

Query: 239 LFWIVTIIVGVNFMLHVLFVPET 261
           +FW +  +     +L +LF+PET
Sbjct: 282 IFWFLLWLCAFTLVLLMLFMPET 304

>Kwal_23.4803 s23 complement(875449..877074) [1626 bp, 541 aa] {ON}
           YBR008C (FLR1) - Major Facilitator Transporter [contig
           5] FULL
          Length = 541

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 63/344 (18%), Positives = 119/344 (34%), Gaps = 65/344 (18%)

Query: 146 GKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHER 205
           G++ +Y+V            A   N   L+  R +SG+  S   +  + ++ +       
Sbjct: 163 GRQHIYIVTLFLFMLFQIGAATVHNIGGLIVIRFISGVLCSPALATGAGSMGDFIVPERV 222

Query: 206 AYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDR 265
              +G +               + +    +  W+FW++  +V    ++ V F PET   +
Sbjct: 223 PIFIGLWAVGAVAAPVMAPLLGAAITVAKNWRWIFWLLMWLVAATLLVLVAFFPET--HQ 280

Query: 266 TPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQSH 325
           + + + R++R   I R    +R           +  EE                      
Sbjct: 281 SNILHRRAVR---IRRETGDSR----------YYTKEE---------------------- 305

Query: 326 RYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFLYS 385
               R+  ++K  +     L     I      + + I++    ++  CY     GAF   
Sbjct: 306 ----RIEDQVKFKDFLSDTLYRPFAII-----IHEPIVLAFDIYIALCY-----GAFYLF 351

Query: 386 LAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAK 445
                L+ V            Y+F+ +++GL Y+   VG ++  +       K +    K
Sbjct: 352 FEAFPLVFVGI----------YNFTLVEVGLAYLGFCVGCVIAYIVLMVFLAKSIA--PK 399

Query: 446 KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
                + PE  L + +    S  L L  FGW+A  H  WI P I
Sbjct: 400 FKNNTFTPEAFLKLAMAVCWSLPLSLFLFGWTAHVH--WILPII 441

>Skud_12.38 Chr12 (75867..77630) [1764 bp, 587 aa] {ON} YLL028W
           (REAL)
          Length = 587

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 102/226 (45%), Gaps = 27/226 (11%)

Query: 362 IMVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           IM+ + P +LF     ++ +F+Y   I++L++ A  +  V G   Y F+     L Y++ 
Sbjct: 372 IMLFVEPLLLF---VTIYNSFVY--GILYLLLEAYPLVFVEG---YGFTE-NGELPYIAL 422

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ-A 480
            +G ++ +     + +  +R    K  G   PE RL+ ++ AG    +G++ F W+    
Sbjct: 423 IIGMMVCAAFIWYMDNDYLRRCKAK--GKLVPEARLYAMVVAGTIFPIGILWFCWTGYYP 480

Query: 481 HDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
           H   W+ PT+    +GFG        + + ++SY   A  A+     +++  G  F  F 
Sbjct: 481 HKIHWMVPTVGGSFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPLF- 539

Query: 540 TKFNVKSGYKTTFIVYGCVELIVCLFA-----IPL--YHYGKRARR 578
                 +GY    +  G   L++ LFA     +PL    YG+  R+
Sbjct: 540 ------AGYMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGEAIRK 579

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 43/245 (17%), Positives = 89/245 (36%), Gaps = 11/245 (4%)

Query: 37  AMMGGPGDDAPSTGG--VVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFV 94
           A MGG     PS  G  + + T  G             P NWP+ ++     V+   C  
Sbjct: 107 APMGGDRPYPPSLPGRDLFEVTFDG-------PNDPLHPFNWPMKKKVLICLVLCLDCIA 159

Query: 95  GGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXXXXXSIIASPCAVIFGKRIVYLV 153
               +SI A+    +  E +  +  ++ L +           +I +P + ++G++ V ++
Sbjct: 160 IAMCSSIFASAVPQIC-EIYHVIEVVAILGITLFVLGFAASPVIYAPLSELYGRKGVLVL 218

Query: 154 XXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYT 213
                       A ++N +++   R   G   +   ++  A  A+++    R   +  + 
Sbjct: 219 SAFGFALFQFAVATAENLQTIFICRFFGGFIGAAPMAVVPAAFADMFDTDVRGKAIALFA 278

Query: 214 XXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERS 273
                         S++ +     WL ++V       F+  VLF  ET      V   + 
Sbjct: 279 LGVFVGPILSPVMGSYIAQRTTWRWLEYVVGCFASAVFVAIVLFFEETHHPTILVNKAKQ 338

Query: 274 IRETA 278
           +R+ +
Sbjct: 339 MRKES 343

>TBLA0B03550 Chr2 (824481..825134) [654 bp, 217 aa] {ON} Anc_8.723
           YOR273C
          Length = 217

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 74/171 (43%), Gaps = 16/171 (9%)

Query: 52  VVQTTKKGIILNPQ-----PSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGS 106
           V  + +K  ++NP+      S    +P NW VW++           F+    +S+  +  
Sbjct: 43  VKYSNEKTRVINPEYLEWDGSDDLDNPHNWSVWKKWYVTLTAAALGFICTMGSSLYVSDI 102

Query: 107 KGLALEF----HRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXX 162
             +  EF      SLS +++ +          ++I +P + IFG+++VYLV         
Sbjct: 103 SSMKEEFGYGEEISLSGLTFYLIGLS------TVICAPLSKIFGRKLVYLVSLPLCMRCT 156

Query: 163 XXCAVSQNY-ESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFY 212
               +S  + + +L  R + G+  S   S+ S T+ +I+   E +  + F+
Sbjct: 157 MGIVLSHGHMKIILPLRYLGGMFASPPLSVGSGTIIDIFDNDETSIAMTFF 207

>NCAS0B00490 Chr2 complement(71160..73154) [1995 bp, 664 aa] {ON}
           Anc_8.723
          Length = 664

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 71/191 (37%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NWP W++     V    C      +S   +    L   +   ++    L        
Sbjct: 72  NPHNWPSWKKWYTTMVAALLCLAVTMGSSTYVSSVPELVARY--GINQTLALAGLTFYLL 129

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ +YL              +S  +   +L  R  SG+  S   S
Sbjct: 130 GLSTVIGAPLSEVFGRKPIYLFSLPISMLFTMGVGLSNGHMRIILPLRFFSGVFGSPCLS 189

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   + +  + F+              A F  EY    W  WI  +  G  
Sbjct: 190 IGSGTIMDIFDVDQVSVAMTFFCLSPFLGPVISPFIAGFATEYQGWRWAEWI-QLFAGGL 248

Query: 251 FMLHVLFVPET 261
            +  ++ +PET
Sbjct: 249 ILPFIVLMPET 259

>TBLA0C07220 Chr3 (1750032..1751870) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 91/486 (18%), Positives = 168/486 (34%), Gaps = 77/486 (15%)

Query: 9   QPKTNDDSGSTGKNSQSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGIILNPQPSK 68
           +   +DD  S  K+   ++ V  V    +++    +   ST     + K   ++      
Sbjct: 99  ENDNDDDVISQNKSDACQSFVQEVDSKNSIINENKESLSST----YSMKDPFLVTWHGPD 154

Query: 69  SKRDPLNWPVWRRDTALF-VVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXX 127
              +P+NW    +    F ++   C    G T I   G + +  EFH      +  +   
Sbjct: 155 DPDNPMNWSFAMKFFMTFQIMTLTCVTYMGST-IHTPGQEQIQEEFHVGHVVGTLNLSVY 213

Query: 128 XXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                   +  SP +     G++ +Y++           CA+  N   L+  R  SG+  
Sbjct: 214 VLGYGVGPMFFSPLSEFARLGRQQIYILTFMIFGLFQVGCALVDNIYGLIILRFFSGVVS 273

Query: 186 STIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTI 245
           S   +   AT+A+     +  Y LG +               + + + +D  W FW++  
Sbjct: 274 SPALTTGGATLADYINEEKLTYFLGLWAIAAFAAPIIGPIVGAAMVDAVDWRWQFWLLLF 333

Query: 246 IVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDA 305
           + G       L V   F+  T   N    R   + +     R   I        + EE+ 
Sbjct: 334 VTGA-----CLLVLAPFFPETQAENILFRRALRLRKITGDKRYYTI--------ESEEEK 380

Query: 306 XXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVM 365
                           T     ++ +    +              IF+      + I V 
Sbjct: 381 KL--------------TTKEFLINSLYKPFRI-------------IFY------EPIAVA 407

Query: 366 LRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGS 425
              ++  CY   LF  F  +  IV++ +             Y F+ +++GL Y+   V  
Sbjct: 408 FDLYLAVCY--ALFYLFFEAFPIVFVGL-------------YDFTLVELGLAYLGFIVTD 452

Query: 426 ILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTAL--GLMGFGWSAQAHDA 483
           I   L     + K++    +   G + PE  +F++LP  +S  L   L  FGW+A  H  
Sbjct: 453 IFAYLVLIYFTIKVINPTFQN--GTFTPE--VFLILPMCVSWLLPVALFFFGWTAGVH-- 506

Query: 484 WIAPTI 489
           W+ P +
Sbjct: 507 WMLPIV 512

>KAFR0A04120 Chr1 complement(828182..829957) [1776 bp, 591 aa] {ON}
           Anc_8.723 YOR273C
          Length = 591

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/193 (19%), Positives = 75/193 (38%), Gaps = 8/193 (4%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEF--HRSLSDISYLVXXXXX 129
           +P NWP W++          C V    +S+  +    L + +   R+L+    L      
Sbjct: 30  NPHNWPTWKKWYTTMASACMCLVVTMGSSLYVSSVTELVMRYGIDRTLA----LSGLTFY 85

Query: 130 XXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTI 188
                ++I +P + +FG++ +YL+             +S  +   +L  R ++G+  S  
Sbjct: 86  LLGLSTVIGAPLSEVFGRKPIYLISLPLSCLCTMGVGLSNGHMRIILPLRFLAGVFASPA 145

Query: 189 ESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVG 248
            S+ S T+ +I+   E +  + F+                F        W  WI  +  G
Sbjct: 146 LSIGSGTILDIFDVDEVSVAMTFFCLAPFMGPVLAPIMGDFACAARGWRWGSWIQLLASG 205

Query: 249 VNFMLHVLFVPET 261
           + +   ++ +PET
Sbjct: 206 LVYPF-IILMPET 217

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 67/166 (40%), Gaps = 26/166 (15%)

Query: 453 PEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGV-VGFGSSLASTTAITFTVD 511
           PE  L       ++  + L    W+A+    W+AP I  GV  GFG  L     I F+V 
Sbjct: 367 PEQLLLPCKIGAVALPVALFWQAWTARTDVHWMAP-IAAGVPFGFGLIL-----IFFSVI 420

Query: 512 SY--KCY----AQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLF 565
            Y   CY        L   N+L+ VM   F  F  +   K   K    ++     ++C+ 
Sbjct: 421 MYFSACYPPLVVASTLAANNLLRYVMSSIFPLFTIQMYEKMKIKWASTLFA----LICIV 476

Query: 566 AIPL----YHYGKRARRWTDSKGLLDFSYVKKNHSRGST-GDRHME 606
            +P+      YGK+ RR    + +  ++ + K   +  T GD   E
Sbjct: 477 MVPIPWIFERYGKKLRR----RSMFGYAAMMKTEEKADTNGDDSQE 518

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A+SQNY  ++  R +   G+S + ++ S    +I    E
Sbjct: 163 LGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGICGDITTRAE 222

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G+ +              + +        +FW +TI  G+  M+ ++ +PET   
Sbjct: 223 RGAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWFLTIGSGICLMISIIVLPET--K 280

Query: 265 RTPVPNERSIR 275
           RT V N  SIR
Sbjct: 281 RTLVGNG-SIR 290

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 48/120 (40%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A  FG+R + L             A + +Y  ++  R +  +G+S   ++ S  V +   
Sbjct: 160 ADCFGRRPIILAGMLIYVIASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTL 219

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
            HER   +G  +              + +    D   +FW +TI  G  F++  L +PET
Sbjct: 220 KHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPET 279

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 57/127 (44%), Gaps = 20/127 (15%)

Query: 363 MVMLRPFVLFCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPF 422
           +++L   +L  +P+ L  A       +W +M++ I ++     PY++  + IG+ Y+   
Sbjct: 335 ILVLPEIILSLFPSGLLFA-------MWTLMLSSI-SSGLSVAPYNYHLVIIGVCYLPGG 386

Query: 423 VGSILGSLCAGPLSD----KMVRHFAKKSCGIYEPE--------FRLFMVLPAGLSTALG 470
           +G ++GS   G + D    + ++ F +       P+         RL  +LP      + 
Sbjct: 387 IGGLMGSFFTGRIIDMYFKRKIKKFEQDKANGLIPQDAEINMFKVRLVCLLPQNFLAVVA 446

Query: 471 LMGFGWS 477
            + FGWS
Sbjct: 447 YLLFGWS 453

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 91/209 (43%), Gaps = 17/209 (8%)

Query: 390 WLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMVRHFAK 445
           W +M++ I ++     PY++    IG+ Y+   +G +LGSL  G + D    + +R F +
Sbjct: 346 WTLMLSAI-SSELSTAPYNYKLTIIGVCYLPAGIGGLLGSLITGRVIDYYYKRSLRKFEE 404

Query: 446 -KSCGI--YEPEF-----RLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFG 497
            K  GI   + EF     RL   LP  L + +  + FGW     +   +  I      F 
Sbjct: 405 DKMNGIIPMDAEFNAIKIRLTASLPQILLSVIVYIIFGWCLGEGEPVESMLIVSFFCSFC 464

Query: 498 SSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAF--SFFNTKFNVKSGYKTTFIVY 555
           +    +T+ T  VD Y   +  A    N ++  +   F   F + K  +  G   TF+  
Sbjct: 465 TMSTLSTSSTLLVDLYPGKSSTATSCFNFIRCSLSAMFMGCFADMKAAMTLGGTFTFLS- 523

Query: 556 GCVELIVCLFAIPLYHYGK-RARRWTDSK 583
           G V + + L   P+YH  + R RR   S+
Sbjct: 524 GIVCISIGLLYFPMYHGMEWRNRRALKSE 552

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 54/134 (40%), Gaps = 3/134 (2%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A +FG+R V L             A S +Y  ++  R +   G+S   S+ S  V +   
Sbjct: 151 ADLFGRRPVILTGMLIYTVASIGLACSNSYGVIVFLRCLQSAGISPTISISSGAVGDFTV 210

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
             ER   +G  +              + +    +   +FW +TI  GV+ M+    +PET
Sbjct: 211 KSERGTFVGAVSGLVLLGQAFGSLIGAALAASFNWRAIFWFLTIGCGVSMMVAFFVLPET 270

Query: 262 FWDRTPVPNERSIR 275
              RT V N  SIR
Sbjct: 271 --KRTIVGN-LSIR 281

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 48/120 (40%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A  FG+R + L             A + +Y  ++  R +  +G+S   ++ S  V +   
Sbjct: 159 ADCFGRRPIILAGMLIYVVASIGLACAPSYGVIIFLRCIQSIGISPTIAISSGVVGDFTL 218

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
            HER   +G  +              + +    D   +FW +TI  G  F++  L +PET
Sbjct: 219 KHERGTFVGATSGFVLLGQCFGSLIGAVLTARWDWRSIFWFLTIGCGSCFLIAFLILPET 278

>TPHA0O02010 Chr15 complement(410334..412022) [1689 bp, 562 aa] {ON}
           
          Length = 562

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 53/278 (19%), Positives = 96/278 (34%), Gaps = 15/278 (5%)

Query: 7   IQQPKTNDDSGSTGKNS------QSKAPVIGVTGTFAMMGGPGDDAPSTGGVVQTTKKGI 60
           ++  K ND   S   +S       ++ P++ +        G  D        V+     +
Sbjct: 44  VETKKENDVQESFQVSSDFESLNNAEKPIVDIEA------GSADQESQKQKTVEERNPFL 97

Query: 61  ILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDI 120
           +    PS     P+NW   +R   L  +     V    +SI   G   +  EF       
Sbjct: 98  LEWDDPSDPDF-PVNWSKKKRGAILLQIMLLTSVTYMGSSIYTPGQLQIQSEFGVGHVVA 156

Query: 121 SYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASR 178
           +  +           +I SP +   + G++ +Y V           CA   N+  L+  R
Sbjct: 157 TLNLSLYVLGYGLGPLIFSPLSEFSLLGRQHLYTVTLFIFTILQIGCATVHNFGGLVVLR 216

Query: 179 IVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW 238
            +SG+  S   S   A++++I         LG +               + +    D  W
Sbjct: 217 FLSGVFCSPSLSTGGASISDILAPEVVPLFLGLWAVGAISAPVLAPLLGAAMVVAEDWRW 276

Query: 239 LFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRE 276
           +FW +  +     +L +LF+PET          R +R+
Sbjct: 277 IFWFLLWLCAFTLVLLMLFMPETHHGNILYRRARRLRK 314

>ZYRO0B00990g Chr2 complement(81433..83211) [1779 bp, 592 aa] {ON}
           similar to uniprot|Q07824 Saccharomyces cerevisiae
           YLL028W TPO1 Proton-motive-force-dependent multidrug
           transporter of the major facilitator superfamily able to
           transport eight different compounds including polyamines
           quinidine cycloheximide and nystatin involved in excess
           spermidine detoxification
          Length = 592

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 114/262 (43%), Gaps = 33/262 (12%)

Query: 329 SRVRTKIKCSNIAQSHLVTGLGIFH-GRHSVDKWI-MVMLRPFVLFCYPAVLFGAFLYSL 386
           S +R K     I  SH    L I    + ++ + I M+ + P + F     L+ +F+Y  
Sbjct: 342 SELRKKSGNWGIRASHEDVELSIAEIAKKTITRPIYMLFVEPILFF---ITLYNSFVY-- 396

Query: 387 AIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGS-LCAGPLSDKMVRHFAK 445
            I++L++ A  I  V G     +   + G +   P++  I+G  +CAG +      +  K
Sbjct: 397 GILYLLLEAYPIIFVEG-----YGLKKNGEL---PYLALIVGMFVCAGYIWYCETAYLRK 448

Query: 446 -KSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLAS 502
            K  G   PE RL+ ++ AG+   +G++ F W+        W  PT+  G++GFG     
Sbjct: 449 CKQHGGLVPEARLYPMVGAGIVFPIGILWFCWTGNYPHKIHWSCPTVAGGLIGFGLLGIF 508

Query: 503 TTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIV 562
              + + ++SY   A  A+     +++  G  F  F       +GY    +      L++
Sbjct: 509 LPCLNYIIESYLMLAASAVAANTFMRSAFGACFPLF-------AGYMFHNMGTNWAGLLI 561

Query: 563 CLFAIPL-------YHYGKRAR 577
            LFA+ L         YGK+ R
Sbjct: 562 GLFAVALIPVPFLFLKYGKKIR 583

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 60/146 (41%), Gaps = 2/146 (1%)

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           I+   A ++G+R V L+            A S +Y  ++  R +   G+S I ++ S  V
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFLRCLQSAGISPIIAINSGVV 200

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVL 256
            +     ER   +G  +              + +    D   +FW +TI  G   +++ L
Sbjct: 201 GDFTVKQERGTFVGAVSGFTLMGQAFGSLIGAALTAAFDWRAIFWFLTIGCGTCMLVNFL 260

Query: 257 FVPETFWDRTPVPNERSIRETAIARA 282
            +PET   R+ V N     ++ + RA
Sbjct: 261 LLPET--KRSIVGNMSIKPKSFVNRA 284

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 85/203 (41%), Gaps = 15/203 (7%)

Query: 389 VWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMVRHF- 443
           +W I +A I ++     PY++    IG+ Y+   +G ++GS   G + D    + VR F 
Sbjct: 340 LWTITLASI-SSQLSVEPYNYKLTIIGVCYLPSGIGGLVGSFVTGKIIDIYYKRAVRRFE 398

Query: 444 AKKSCGIYEPEF-------RLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGF 496
            KK  G+   +        RL+  +P    + +    FGWS +       P I   +  F
Sbjct: 399 EKKEKGLIPADTKFNTLRARLYTSIPQNFLSVIAFTLFGWSVERGWHIAVPLITSCIGSF 458

Query: 497 GSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTF-IVY 555
            +    +++ T  VD Y   +  A    N ++  +   F     K N       TF ++ 
Sbjct: 459 CAMSTLSSSSTLLVDLYPSKSSTATSCYNFIRCSLSAIFMACLAKMNKALTVGGTFTLIS 518

Query: 556 GCVELIVCLFAIPLYHYGKRARR 578
           G V +   +  IP++ YG + R+
Sbjct: 519 GFVFIGNFITFIPMF-YGMQWRQ 540

>CAGL0G03927g Chr7 complement(372896..374599) [1704 bp, 567 aa] {ON}
           highly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028w TPO1 polyamine transport protein
          Length = 567

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 96/221 (43%), Gaps = 19/221 (8%)

Query: 367 RPF-VLFCYPAVL----FGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSP 421
           RP  +LF  P +L    + +F+Y   I++L++ A  I  V G   Y F +    L Y++ 
Sbjct: 349 RPIKMLFTEPLLLIITIYNSFVY--GILYLMLEAYPIVFVEG---YGFEA-NGELPYIAL 402

Query: 422 FVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQ-A 480
            +G ++ +       +  ++   K   G   PE RL  ++ AG+   +G++ F W+    
Sbjct: 403 IIGMLVCTAFLWYFENDYLKRIQKA--GKLVPEARLIPMVYAGVIFPIGILWFCWTGYYP 460

Query: 481 HDA-WIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFFN 539
           H   W+ PT+    +GFG        + + ++SY   A  A+     +++  G  F  F 
Sbjct: 461 HKIHWMCPTVAGSFIGFGLMGIFLPCLNYIIESYLPLAASAVAANTFMRSAFGAVFPLFA 520

Query: 540 TKFNVKSGYKTTFIVYGCVELIVCLFAIPLY--HYGKRARR 578
               +  G  T +           L  +PL+   YG+R R+
Sbjct: 521 GY--MFHGMGTGWAGLLLGLFAAALIPVPLFFLKYGERIRK 559

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 34/205 (16%), Positives = 74/205 (36%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NW +  +     V+  +C      +SI A+G   +   +H         V        
Sbjct: 118 PFNWSMKTKTIICIVLCLNCICISMGSSIFASGVPQICKIYHVIPVVAILGVTLYVFGFA 177

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLP 192
              +I +P + ++G+R V ++            A S++ +S++  R   GL  +   ++ 
Sbjct: 178 ASPVIYAPLSEVYGRRGVLVISAFGFAVFQFAVATSKDLQSIMICRFFGGLIGAAPMAVV 237

Query: 193 SATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFM 252
            A  A+++    R   +  ++              S++ +     WL ++        F+
Sbjct: 238 PAAFADMFDVRVRGKAICLFSLGVFVGPILSPVMGSYIAQRTTWRWLEYVTGCFASALFV 297

Query: 253 LHVLFVPETFWDRTPVPNERSIRET 277
              L   ET      V   + +R++
Sbjct: 298 AVALTFKETHHPTILVQKAKEMRKS 322

>Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028W
           (TPO1) - polyamine transport protein [contig 140] FULL
          Length = 613

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 2/88 (2%)

Query: 453 PEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLASTTAITFTV 510
           PE RL  ++ +G+   +G++ F WS    D   ++ PT+    +GFG          + +
Sbjct: 478 PEERLKTMIISGIVFPIGILWFCWSGNYPDKVHYMVPTVAGSFIGFGLIGIFLPCFNYLI 537

Query: 511 DSYKCYAQEALVTLNVLKNVMGFAFSFF 538
           DSY   A  A+     +++  G AF  F
Sbjct: 538 DSYLILAASAIAGNTFMRSAFGAAFPLF 565

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/206 (17%), Positives = 79/206 (38%), Gaps = 4/206 (1%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL-VXXXXXXX 131
           P NWP  +R     ++G +       +SI A+    +  E +     +  L V       
Sbjct: 163 PYNWPARKRSFLCLLLGLNAVTVAMGSSIFASAVPQVC-EIYGVAQVVGVLGVTLYVFGF 221

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG-LGVSTIES 190
               +I +P + ++G++ + ++            A ++N ++++  R  +G +G + +  
Sbjct: 222 AASPVIYAPLSELYGRQRLLIISSFGFVLFMFATATAENLQTIMICRFFAGFVGAAPLAI 281

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           +P A   ++Y    R   +  +               S++ ++    W  ++V I     
Sbjct: 282 VP-ACFFDMYDNENRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYVVAIFGSCV 340

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRE 276
            +L  +F  ET      V   R +RE
Sbjct: 341 TVLLAVFYEETHHPTILVHKARRMRE 366

>KAFR0B00180 Chr2 complement(43943..45535) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 35/197 (17%), Positives = 73/197 (37%), Gaps = 2/197 (1%)

Query: 67  SKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXX 126
           +    +P NW   +++  +F V          +SI   G  G+  +FH      +  +  
Sbjct: 71  NDDPDNPQNWSDLKKNLIVFEVILLTCTNYMGSSIYTPGQDGIQNDFHVGQVTATLNLSL 130

Query: 127 XXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLG 184
                    +  SP + +   G++ +Y+V           CA  QN E L+  R+++G+ 
Sbjct: 131 YVLGCGLGQVFFSPLSEVAKIGRQQIYIVTFPIFMLIQIGCATVQNIEGLIILRLLTGIL 190

Query: 185 VSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVT 244
            S   S   A++A++    +    +  +               + +    +  W FW++ 
Sbjct: 191 CSPPLSTGGASIADVIHPGKLTTYIALWAVGTLAAPIIGPLLGASMVVAKNWRWTFWLLL 250

Query: 245 IIVGVNFMLHVLFVPET 261
            +     +  + F PET
Sbjct: 251 WLSIPCLICCIFFFPET 267

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 1/121 (0%)

Query: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYL 152
           F+     +I+      +A EF+  LS IS++             +    + IFG+R + +
Sbjct: 72  FLAALDNTIVTTLLSHIASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLII 130

Query: 153 VXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFY 212
           +           C +S+N  +L+A R ++G+G   + SL S T ++I     RA   G +
Sbjct: 131 ISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRALYQGIF 190

Query: 213 T 213
            
Sbjct: 191 N 191

>KLTH0E00528g Chr5 complement(54185..55843) [1659 bp, 552 aa] {ON}
           similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008C FLR1 Plasma membrane multidrug transporter
           member of the major facilitator superfamily involved in
           efflux of fluconazole diazaborine benomyl methotrexate
           and other drugs
          Length = 552

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 102/532 (19%), Positives = 178/532 (33%), Gaps = 80/532 (15%)

Query: 57  KKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRS 116
           K   +++    K   +PLNW   ++   +F V           SI   G + +  EF   
Sbjct: 83  KDTFLVDWNGPKDCENPLNWSRLKKGFVVFQVMLLTCATYMGASIYTPGQEYIQHEFGVG 142

Query: 117 LSDISYLVXXXXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESL 174
               +  +           I+ SP + +   G++ +Y+V            A  +N   L
Sbjct: 143 HVVGTLNLSLYVLGYGLGPIVFSPLSEVASVGRQQIYIVTLFFFMLFQVGAATVKNIGGL 202

Query: 175 LASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYL 234
           L  R +SG+  S   +    T+ +I      +  +G +               + + +  
Sbjct: 203 LVIRFISGVLCSPSLATGGGTMGDIIKPEIVSVFIGLWAIGAVAAPVVAPLLGAAMVQAK 262

Query: 235 DRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGY 294
              + FW++  I     +L V+F PET          ++I      R      D+     
Sbjct: 263 GWRYDFWLLMWISAATLILLVVFFPET--------QHQNILHRHAVRVRKETGDL----- 309

Query: 295 SAPKFQGEEDAXXXXXXXXXXXXXVTPTQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHG 354
                                       + +    RV  +IK ++            F  
Sbjct: 310 ----------------------------RYYTRQERVDAEIKATS------------FMK 329

Query: 355 RHSVDKWIMVMLRPFVLF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSI 412
              V  ++++ L P VL    Y AV +GAF        L+ +            Y+F+ +
Sbjct: 330 ELFVRPFLIMALEPAVLAFDIYIAVCYGAFYLFFEAFPLVFIGI----------YNFTLV 379

Query: 413 QIGLVYVSPFVGSILGSLCA-GPLSDKMVRHFAKK-SCGIYEPEFRLFMVLPAGLSTALG 470
           ++GL     F+G  +G L A   L   + ++   K     + PE  L + +    +  L 
Sbjct: 380 EMGLA----FLGFCIGCLLAYAALLVYLAKYIGPKFKNNTFTPEDFLPLSMAVCWALPLS 435

Query: 471 LMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNV 530
           L  FGW+A+ H  WI P I              +A  +    Y  Y      +    ++V
Sbjct: 436 LFMFGWTARVH--WILPIIAEVFFVINVFNLFQSAFAYLAFCYPRYLASVFASNGFCRSV 493

Query: 531 MGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVC---LFAIP--LYHYGKRAR 577
              AF  F      K G +   + +G   +  C   L  IP   Y +G R R
Sbjct: 494 FACAFPLFGRAMYEKLGSEEYPVAWGSSLIGFCSIGLAVIPFFFYKFGPRMR 545

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 57/155 (36%)

Query: 107 KGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCA 166
           + L  EF+   + I+  V            +    A  FG+R + L             A
Sbjct: 125 RQLEKEFNVDENMINITVVVYLMFQGIAPTVCGGLADCFGRRPIILGGMLVYVVASVGLA 184

Query: 167 VSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXX 226
            + +Y  ++  R V  +G+S   ++ S  V +    HER   +G  +             
Sbjct: 185 CAPSYGVIIFLRCVQSIGISPTIAISSGVVGDFTLKHERGTFVGATSGFVLLGQCFGSLI 244

Query: 227 ASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
            + +    D   +FW +TI  G  F++    +PET
Sbjct: 245 GAVLTARWDWRSIFWFLTIGCGTCFLIAFFILPET 279

>Smik_3.205 Chr3 complement(303229..303807) [579 bp, 192 aa] {ON}
           YBR008C (REAL)
          Length = 192

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 54/135 (40%), Gaps = 4/135 (2%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y FS +++G+ Y+    G I G L       K +    K     +EPEF L + +  G  
Sbjct: 23  YHFSLVEMGVAYMGFTAGCIFGYLALYIFQTKFID--PKFDSDAFEPEFLLPLNMVLGWI 80

Query: 467 TALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNV 526
             L L  FGW+A     W+   + L +  F   +    + ++    Y C+         +
Sbjct: 81  FPLSLFLFGWAASV--PWMLVELSLFLFMFAVFILFQISFSYLAMCYLCHVASVFAGSAL 138

Query: 527 LKNVMGFAFSFFNTK 541
            +++   AF  F T 
Sbjct: 139 TRSLFACAFPLFGTA 153

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 37.7 bits (86), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 17/154 (11%)

Query: 389 VWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSD----KMVRHFA 444
           +W +M++ I + +    PY++    +G+ Y+   +G + GS   G + D    ++VR F 
Sbjct: 367 MWTLMLSCIASQL-SIAPYNYHLTIVGVCYLPAGIGGLCGSFFTGRIIDLYYRRVVRKFQ 425

Query: 445 KKSCGIYEPE--------FRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG--VV 494
           +       PE         RL  VLP      +  + FGWS      W  P   +   V 
Sbjct: 426 QDKAEGKIPENQVFNIFRVRLMCVLPQNFIAVVSFLLFGWSVD--KGWKIPAALITSCVS 483

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLK 528
            + +    +T  T  VD Y   +  A    N ++
Sbjct: 484 SYCAMSTLSTMTTLLVDLYPKKSSTASSCFNFVR 517

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 46/229 (20%), Positives = 83/229 (36%), Gaps = 4/229 (1%)

Query: 43  GDDAPSTGGVVQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHC-FVGGGQTSI 101
           GD++ S  G+ Q   +      QP +    P     + +   +  V   C F     + I
Sbjct: 74  GDESGSPSGIKQDGHESED-EGQPEEVSTAPYTLLSYSQKWGMVAVLTMCGFWSSLGSPI 132

Query: 102 LAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXX 161
                + L  EFH + S ++  V             +   A  +G+R + L         
Sbjct: 133 YYPALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVA 192

Query: 162 XXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXX 221
               A + +Y  ++  RIV  +G+S   ++ S  V++     ER   +G  +        
Sbjct: 193 SIGLARAPSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERGTFVGATSGFVLIGQG 252

Query: 222 XXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPN 270
                 + +    D   +FW + I  G + ++    +PET   RT V N
Sbjct: 253 IGPLLGAVIAARWDWRAIFWFLVIGCGTSMLIAFFLLPET--KRTIVGN 299

>YOR273C Chr15 complement(834452..836431) [1980 bp, 659 aa] {ON}
           TPO4Polyamine transport protein, recognizes spermine,
           putrescine, and spermidine; localizes to the plasma
           membrane; member of the major facilitator superfamily
          Length = 659

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 38/191 (19%), Positives = 72/191 (37%), Gaps = 4/191 (2%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NW   ++        + C V    +S+  +    L   +H  +S    L        
Sbjct: 82  NPHNWSSLKKWYTTMTSAFLCLVVTMGSSLYVSSVPELVERYH--VSQTLALAGLTFYLL 139

Query: 132 XXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNY-ESLLASRIVSGLGVSTIES 190
              ++I +P + +FG++ VYL              +S  +   +L  R +SG+  S   S
Sbjct: 140 GLSTVIGAPLSEVFGRKPVYLFSLPVSMLFTMGVGLSNGHMRIILPLRFLSGVFASPALS 199

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
           + S T+ +I+   + +  + ++              A F  E     W  WI  +I G  
Sbjct: 200 VGSGTILDIFDVDQVSVAMTYFVLSPFLGPVLSPIMAGFATEAKGWRWSEWI-QLIAGGL 258

Query: 251 FMLHVLFVPET 261
            +  +  +PET
Sbjct: 259 ILPFIALMPET 269

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 44/107 (41%), Gaps = 15/107 (14%)

Query: 469 LGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSY--KCY----AQEALV 522
           +GL    W+A++   W+AP       GFG  L     I F+V  Y   CY        L 
Sbjct: 437 IGLFWQAWTARSDVHWMAPVAAGVPFGFGLIL-----IFFSVLMYFSTCYPPLTVASCLA 491

Query: 523 TLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPL 569
             N+L+ VM   F  F  +   K   K    ++     +VC+  IP+
Sbjct: 492 ANNLLRYVMSSVFPLFTIQMYTKMKIKWASTLFA----LVCVVMIPI 534

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 48/121 (39%), Gaps = 8/121 (6%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L+            A +Q Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 146 LGRRPVVLIAIIIYFGACVGLACTQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 205

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW +TI  G+ F+  +L +PE
Sbjct: 206 R----GGYVGYAAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLTIGSGICFLASLLILPE 261

Query: 261 T 261
           T
Sbjct: 262 T 262

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 66/161 (40%), Gaps = 17/161 (10%)

Query: 389 VWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR------H 442
           +W +M++ I ++     PY++S   IG+ Y+   +G + GS+  G + D   R       
Sbjct: 344 MWTLMLSSI-SSELSVAPYNYSLTIIGVCYLPAGIGGLAGSMLTGRVIDLYYRRSLQKFQ 402

Query: 443 FAKKSCGIYEP------EFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLG--VV 494
             K+S  I E       + RL  VLP         + FGWS      W  P++ +   V 
Sbjct: 403 EDKESGKISEDTPFNNFKVRLACVLPQCFIAICSFILFGWSVDK--GWKIPSVLITSFVC 460

Query: 495 GFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGFAF 535
            + +  + +   T  VD Y   +  A    N ++  +   F
Sbjct: 461 SYCTMSSLSVMTTLLVDLYPTKSSTASSCFNFVRCSLSTIF 501

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 57/146 (39%), Gaps = 2/146 (1%)

Query: 137 IASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATV 196
           I+   A ++G+R V L             A + +Y  ++  R +  +G+S   ++ S  V
Sbjct: 145 ISGGLADVYGRRPVILGGMLIFVVASIGIAKAPSYGVIVFLRCIQSIGISPTIAISSGVV 204

Query: 197 AEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVL 256
           ++     ER   +G  +              + +   L    +FW +TI  G   ++   
Sbjct: 205 SDFTVKRERGTFVGATSGLVLIGQGIGPLLGAVITAALHWRAVFWFLTIGCGSCMIIGFF 264

Query: 257 FVPETFWDRTPVPNERSIRETAIARA 282
            +PET   RT V N     +  I RA
Sbjct: 265 LLPET--KRTIVGNLSIKPKNIINRA 288

>Suva_9.71 Chr9 (129275..130960) [1686 bp, 561 aa] {ON} YIL121W
           (REAL)
          Length = 561

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 51/130 (39%), Gaps = 10/130 (7%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
           FG+R V L             A S NY  +LA R +   G+S + ++ S  + ++    E
Sbjct: 128 FGRRPVVLWAVLTYCCACIGLASSHNYAQILALRCLQAAGISPVIAINSGIMGDVTTKVE 187

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  G+  ++  L +PE
Sbjct: 188 R----GGYVGLVSGFQVVGTAFGALIGAGLSSRWGWRAIFWFLAIGSGICLVVSALLLPE 243

Query: 261 TFWDRTPVPN 270
           T   RT V N
Sbjct: 244 T--KRTLVGN 251

>Kpol_358.7 s358 complement(24674..26041) [1368 bp, 455 aa] {ON}
           complement(24674..26041) [1368 nt, 456 aa]
          Length = 455

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/206 (18%), Positives = 73/206 (35%), Gaps = 2/206 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           PLNW V ++   +  +          +SI   G   +  EF       +  +        
Sbjct: 2   PLNWSVPKKAIMMIQITLLTMFTYMGSSIYTPGQDAIQEEFKIGHVAATLNLSVYVIGYG 61

Query: 133 XXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIES 190
              I  SP +     G++ +Y++            A   N   ++  R +SG+  S   +
Sbjct: 62  IGPIFFSPLSEFATLGRQNIYIITLFCFCMLQIGTATVDNLGGMVVIRFLSGIFCSPSLA 121

Query: 191 LPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVN 250
              AT++++      +  L  +               + + E     W+FW++  +    
Sbjct: 122 TGGATISDMISVENVSTLLVIWAAGSFASPVLAPLLGAAMLEAKGWRWIFWLLLWMCTAI 181

Query: 251 FMLHVLFVPETFWDRTPVPNERSIRE 276
           F+L + F PET  D   V   R +R+
Sbjct: 182 FILMIFFFPETHHDNILVRRARRLRK 207

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y+F+ +++GL ++   VG +L          K ++   K     + PE  + + +    +
Sbjct: 277 YNFTPVELGLSFMGFQVGDVLSYAIYLLFEKKYIK--PKFKNNTFVPEDLMVLAMFVSWT 334

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L +  FGW+A  H  WI P +
Sbjct: 335 LPLSMFFFGWTAGIH--WILPMV 355

>KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 614

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 445 KKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDA--WIAPTIFLGVVGFGSSLAS 502
           +++ G   PE RL  ++ AG+   +G++ F W+    D   ++ PT+    +GFG     
Sbjct: 471 RENSGKPLPEERLKTMILAGIVFPIGILWFCWTGNYSDKVHFMVPTVAGSFIGFGLIGIF 530

Query: 503 TTAITFTVDSYKCYAQEALVTLNVLKNVMGFAFSFF 538
                + +DSY   +  A+     +++  G AF  F
Sbjct: 531 LPCFNYIIDSYLFLSASAIAGNTFMRSSFGAAFPLF 566

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/207 (14%), Positives = 81/207 (39%), Gaps = 2/207 (0%)

Query: 73  PLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXX 132
           P NWP+ +R     ++G +       +SI A+    +  ++H +       V        
Sbjct: 164 PYNWPMRKRAFLCLLLGLNAVTVAMGSSIFASAVPQICAKYHVAQVVGVLGVTLYVFGFA 223

Query: 133 XXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSG-LGVSTIESL 191
              +I +P + ++G++ + ++            A +++ ++++  R  +G +G + +  +
Sbjct: 224 ASPVIYAPLSELYGRQKLLIISSFGFVLFMFATATAKDLQTIMICRFFAGFIGAAPLAIV 283

Query: 192 PSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNF 251
           P A   +++    R   +  +               S++ ++    W  + V +   +  
Sbjct: 284 P-ACFFDMFDNETRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYCVGMFAALVT 342

Query: 252 MLHVLFVPETFWDRTPVPNERSIRETA 278
           +L  +F  ET      V   R +R+ +
Sbjct: 343 ILLAIFYEETHHPTILVNKARRMRQIS 369

>Skud_3.178 Chr3 complement(290523..291692) [1170 bp, 389 aa] {ON}
           YBR008C (REAL)
          Length = 389

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/159 (18%), Positives = 60/159 (37%), Gaps = 12/159 (7%)

Query: 146 GKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHER 205
           G++ +Y++           CA   N   L+  R +SG+  S   S  +A++ ++    ++
Sbjct: 133 GRQTIYIITLFVFIMFQIGCATVDNVGGLIVMRFISGVLSSPALSTGAASIGDVISDEKK 192

Query: 206 A-YRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
               +G ++              + +       ++FW++T +   N ++   F+PET  D
Sbjct: 193 VPLVIGLWSIGAVLAPIVAPLLGASMMVAKGWRYIFWLLTWMATANLVMLFFFLPETLAD 252

Query: 265 RTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEE 303
                  R I++              I  Y   K Q EE
Sbjct: 253 NVLYRRCRRIKKMT-----------GIDAYCTLKQQDEE 280

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/125 (20%), Positives = 48/125 (38%)

Query: 118 SDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLAS 177
           S I +L+          +++    AVIFG +   +V            AVS + + ++  
Sbjct: 55  SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGG 114

Query: 178 RIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRH 237
           R+++G G S I++L  A    +   H R   +   +                + EY+   
Sbjct: 115 RVIAGCGASGIQTLVFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYVTWR 174

Query: 238 WLFWI 242
           W F+I
Sbjct: 175 WCFYI 179

>TDEL0D06500 Chr4 (1166063..1167691) [1629 bp, 542 aa] {ON} 
          Length = 542

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 70/185 (37%), Gaps = 13/185 (7%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y F+ I+IGL ++   VG ++          K+V   AK     + PE  + + +   L 
Sbjct: 364 YHFTLIEIGLAFMGFCVGCVIAYAICIVFLMKVVAKKAKNDK--FTPETFMILAMATCLC 421

Query: 467 TALGLMGFGWSAQAHDAWIAPTI--FLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTL 524
             L L  FGW+A  H  WI P I     V+G  +   ++ A  +   SY  Y        
Sbjct: 422 LPLSLFLFGWAAGVH--WILPIIAELFFVIGLFNLFQASFA--YLAISYPKYLASVFAGN 477

Query: 525 NVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVEL---IVCLFAIP--LYHYGKRARRW 579
            V +     AF  F              + +G   L    + L AIP  LY YG   R  
Sbjct: 478 GVCRAGFACAFPLFGKAMYDNLAIDGYPVAWGSSILGFFSIALAAIPFLLYKYGPYLRSK 537

Query: 580 TDSKG 584
           +   G
Sbjct: 538 SKFTG 542

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 42/225 (18%), Positives = 80/225 (35%), Gaps = 4/225 (1%)

Query: 53  VQTTKKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALE 112
           V   K   ++          P NW   +R   +  V     V    +SI   G + +  E
Sbjct: 69  VSQEKDPFLVEFSGPDDPEHPHNWSTGKRTAVIIQVMLLTSVTYMGSSIYTPGQEQIQQE 128

Query: 113 FHRSLSDISYLVXXXXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQN 170
           F+      +  +           I  SP +     G++ +Y++            A+ +N
Sbjct: 129 FNVGHVVGTLNLSMYVLGYGLGPIFFSPLSEFAKIGRQPLYIITFFLFAMLQIGTALVKN 188

Query: 171 YESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFV 230
              L+  R ++G+  S   +   ATV +I         +G ++              + +
Sbjct: 189 IAGLVILRFITGILCSPSLATGGATVGDIVPPDYVPLFIGLWSVGAVSAPVVGPLLGAAM 248

Query: 231 FEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWDRTPVPNERSIR 275
            +  D  W+FW++  +     ++ V F PET  D   +   R+IR
Sbjct: 249 VDAKDWRWIFWLLMWLASATLIVLVFFFPETSEDS--ILYRRAIR 291

>NDAI0A07730 Chr1 complement(1777435..1779102) [1668 bp, 555 aa]
           {ON} 
          Length = 555

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 65/178 (36%), Gaps = 24/178 (13%)

Query: 322 TQSHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPF----------VL 371
           T ++  LSR  ++I+     +S+      +     +    I    RPF          VL
Sbjct: 292 TSANNILSRRASRIRNKTGDKSYYTVQEKLDSDTTTERFLINTFYRPFKLIAKEPMILVL 351

Query: 372 FCYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLC 431
             Y A+ +GAF        ++ V            Y F+ I+ GL Y    VG  +    
Sbjct: 352 DVYLALCYGAFYLFFEAFPIVFVGI----------YHFTLIETGLAYFGFCVGCCIAFPA 401

Query: 432 AGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
                 K+VR   +     + PE  L + +    S    L  FGW+A  H  WI P I
Sbjct: 402 LMVFLHKVVR--PRFENNTFTPEVFLILAMCVSWSLPTSLFLFGWAASTH--WIVPII 455

>TBLA0A08515 Chr1 (2098421..2100319) [1899 bp, 632 aa] {ON} possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 632

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 74/172 (43%), Gaps = 17/172 (9%)

Query: 416 LVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFG 475
           L Y+S  VG I+ S+          ++ AK+   + E      M++ AGL+  +G++ F 
Sbjct: 461 LPYLSLIVGIIICSIMIWYADADYSQNVAKQWKLLPERRLXXPMII-AGLAYPIGILWFC 519

Query: 476 WSA--QAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMGF 533
           W+        W+ PTI  G  GFG        + + ++SY  +   + V  N       F
Sbjct: 520 WTGYYPKDIHWVVPTIAGGFTGFGLLDIFLPCLNYIIESY-LFITTSAVAANT------F 572

Query: 534 AFSFFNTKFNVKSGYKTTFIVYGCVELIVCLF---AIP----LYHYGKRARR 578
             S F  +F + +GY    +  G V L++ L    AIP    L  YG   R+
Sbjct: 573 MRSGFGARFPLFAGYMFHNMGTGWVGLLIGLLAVGAIPVPFLLLKYGPSIRK 624

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 52/130 (40%), Gaps = 10/130 (7%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R + ++            A SQ+Y  ++A R +   G+S + ++ S  + ++    E
Sbjct: 133 LGRRPIVILSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINSGIMGDVTTRAE 192

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  G   +  VLF+PE
Sbjct: 193 R----GGYVGYVSGCQVVGSAFGALIGAGLSSRWGWRSIFWFLAIGSGACLVATVLFLPE 248

Query: 261 TFWDRTPVPN 270
           T   RT V N
Sbjct: 249 T--KRTVVGN 256

>KLTH0H09856g Chr8 (848950..850599) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 549

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y+F+ I++GL ++   VG ++  +       K++    K     + PE  L + +    S
Sbjct: 371 YNFTLIELGLAFLGFCVGCVIAYIAFLTFLAKVI--MPKFKNNTFTPESFLLLAMSVCWS 428

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+A  H  WI P I
Sbjct: 429 LPLSLFLFGWAAGVH--WILPMI 449

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 55/118 (46%), Gaps = 1/118 (0%)

Query: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYL 152
           F+     +I++  S  +A EF++ LS +S++             +    + IFG++ + +
Sbjct: 122 FLAAIDNTIVSTTSAHVASEFNQ-LSKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLV 180

Query: 153 VXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLG 210
                       C +S+++  L+ +R V+G+G   + S+ S T+ ++    ERA   G
Sbjct: 181 FTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRERAMYQG 238

>SAKL0B12628g Chr2 complement(1091243..1092856) [1614 bp, 537 aa]
           {ON} similar to uniprot|P38124 Saccharomyces cerevisiae
           YBR008C FLR1 Plasma membrane multidrug transporter
           member of the major facilitator superfamily involved in
           efflux of fluconazole diazaborine benomyl methotrexate
           and other drugs
          Length = 537

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y F+ +++G  Y+   VG I+  +       K++R   K     + PE  L + +    S
Sbjct: 359 YHFTLVEMGFAYLGFCVGCIVAYVVLLVFLAKVIR--PKFQNNNFTPEAFLLLAMGVCWS 416

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+A  H  WI P I
Sbjct: 417 LPLSLFLFGWTAGVH--WILPII 437

>KLTH0G09350g Chr7 (778062..779753) [1692 bp, 563 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 563

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 437 DKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGF 496
           DK++      +  I+     + M +P  LS   G MGFGW   AH   +A  +F G    
Sbjct: 376 DKILSTDISYTFNIFRARLEI-MFVPLLLSGG-GFMGFGWCLDAHTPLVAVLVFSGFASL 433

Query: 497 GSSLASTTAITFTVDSYKCYAQEALVTLNVLKNVMG 532
            S+     A T  VD Y   +  A   +N  + V+ 
Sbjct: 434 FSNCVIACATTLVVDLYPQKSSTATGCVNFSRCVLA 469

>KNAG0A05220 Chr1 complement(768621..770351) [1731 bp, 576 aa] {ON}
           Anc_2.363 YMR155W
          Length = 576

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 59/123 (47%), Gaps = 20/123 (16%)

Query: 357 SVDK--WIMVMLRPFVLFCY-PAVLFG---AFLYSLAIVWLIMVAQIINTVYGNPP-YSF 409
           SVDK  W  +    F+ +C   A L G    ++YS   V  I+ AQI +  Y  PP ++ 
Sbjct: 335 SVDKPVWDCIKSPIFIAYCIIVATLQGIGQTYIYS---VGFILQAQINSMGYKLPPNFNA 391

Query: 410 SSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLSTAL 469
           + +Q   V +  F  S LG L +GP+SD +V+ +  +         RL+ +  A L  A 
Sbjct: 392 TKLQASHVALISF-ASFLGRLSSGPISDMLVKRYNSQ---------RLWNIFSASLLFAF 441

Query: 470 GLM 472
           G M
Sbjct: 442 GAM 444

>KNAG0E01160 Chr5 (228323..230041) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 50/126 (39%), Gaps = 2/126 (1%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A S NY  ++A R +   G+S + ++ S  + ++    E
Sbjct: 143 LGRRPVILCSVIIYFCACIGLACSNNYAQVIALRCLQAAGISPVIAINSGMMGDVTTKAE 202

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G+ +              + +        +FW + I  G   ++ +L +PET   
Sbjct: 203 RGGYVGYVSGFQVVGTATGAVFGALLSSRWGWRSIFWFLAIGSGACSIVSLLLLPET--K 260

Query: 265 RTPVPN 270
           RT V N
Sbjct: 261 RTIVGN 266

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 51/133 (38%), Gaps = 10/133 (7%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A  FG+R + L             A + NY  +LA R +   G+S + ++ S  + ++  
Sbjct: 129 ADTFGRRPIVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVIAINSGIMGDVTT 188

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLF 257
             ER    G Y               + +   L   W    +FW + I  G+  +   L 
Sbjct: 189 KVER----GGYVGLVAGFQVVGTAFGALIGAGLSSKWGWRAIFWFLAIGSGICLVFSTLL 244

Query: 258 VPETFWDRTPVPN 270
           +PET   RT V N
Sbjct: 245 MPET--KRTLVGN 255

>ZYRO0E09922g Chr5 (788952..790643) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 563

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 62/346 (17%), Positives = 122/346 (35%), Gaps = 65/346 (18%)

Query: 144 IFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAH 203
           ++G++ +Y++           CA+  N   L+  R ++G+  S   +  +A++ +I    
Sbjct: 183 MYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRFITGILCSPSLATGAASIGDIVTPQ 242

Query: 204 ERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFW 263
                +G ++              + +    +  W+FW++  +     ++ + F PET  
Sbjct: 243 WVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWRWIFWLLMWMSAALLIVLIFFFPETGE 302

Query: 264 DRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXXXXXXXVTPTQ 323
           D   +   R +R                      K  G++                   +
Sbjct: 303 DN--ILYRRCVR--------------------IRKITGDD-------------------R 321

Query: 324 SHRYLSRVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFVLFCYPAVLFGAFL 383
            + + +R   K+   +IA   L     I      V + I++ L  ++  CY    F  F 
Sbjct: 322 YYTFKAREEAKLTFKDIAVVALYRPFEII-----VKEPIVLALDIYIALCYGT--FYLFF 374

Query: 384 YSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHF 443
            +  IV+                Y F+ I++GL Y+   VG +     +     +     
Sbjct: 375 EAFPIVF-------------AGVYHFTLIELGLAYMGFCVGCVFAYAISLIFLSQYGARQ 421

Query: 444 AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTI 489
           AKK+   + PE  L + +       L L  FGW+A  H  W  P +
Sbjct: 422 AKKN--RFTPETFLVLAMGVCWCLPLALFLFGWAASVH--WTLPML 463

>Suva_9.70 Chr9 (127105..128802) [1698 bp, 565 aa] {ON} YIL120W
           (REAL)
          Length = 565

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 47/121 (38%), Gaps = 8/121 (6%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V LV            A +Q Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 124 LGRRPVVLVAILIYLGACVGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 183

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  GV F+  +L +PE
Sbjct: 184 R----GGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGVCFLGSLLVLPE 239

Query: 261 T 261
           T
Sbjct: 240 T 240

>NCAS0A03120 Chr1 (611490..613124) [1635 bp, 544 aa] {ON}
          Length = 544

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 407 YSFSSIQIGLVYVSPFVG-SILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGL 465
           Y FS I++GL ++   VG +I  S+    L   +V  F   +   ++PE  L + +    
Sbjct: 366 YHFSMIELGLSFLGFQVGCAIAYSIFLFFLMKYLVPKFKNNT---FQPEDFLVLSMSVCW 422

Query: 466 STALGLMGFGWSAQAHDAWIAPTI 489
           +  L L  FGW+A  H  WI P I
Sbjct: 423 ALPLALFFFGWTASVH--WILPII 444

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 36/207 (17%), Positives = 74/207 (35%), Gaps = 2/207 (0%)

Query: 57  KKGIILNPQPSKSKRDPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRS 116
           K   +++        +P NW   ++   +  V     V    +SI   G + L  EFH  
Sbjct: 75  KDPFLVDWNGDNDPDNPQNWSTSKKTFMVIQVMLLTSVTYMGSSIYTPGQEALQKEFHVG 134

Query: 117 LSDISYLVXXXXXXXXXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESL 174
               +  +           I+ SP +   + G++ +Y++            A   N   +
Sbjct: 135 HVAATLNLSIYVLGYGLGPIMLSPFSEFALLGRQHIYIITLFCFCMFQIGAATVHNLGGM 194

Query: 175 LASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYL 234
           +  R  SG+  S   +   AT+++I         +G ++              + +    
Sbjct: 195 IVIRFFSGIFCSPALTTGGATISDIINPQMVPVVIGLWSVAAVAAPALGPLIGAAMQVAE 254

Query: 235 DRHWLFWIVTIIVGVNFMLHVLFVPET 261
              W+FW++  +     +L ++F PET
Sbjct: 255 GWRWIFWLLLWMCAATLILLIIFFPET 281

>KAFR0D05140 Chr4 (1010805..1012529) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 71/361 (19%), Positives = 120/361 (33%), Gaps = 81/361 (22%)

Query: 136 IIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPS 193
           +I SP +   + G++++Y +            A  QN   L+  R ++G+  S   +   
Sbjct: 184 VIFSPFSEVAMVGRQVIYTLTFFVFTMFQIGAATVQNIGGLIVLRFLTGIVCSPALATGG 243

Query: 194 ATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFML 253
           ATV +I         L  +               + +    +  W+FW +T I G   + 
Sbjct: 244 ATVGDIITPKNLPLCLSIWDLGPTFAPIIGPLLGASMMVAKNWRWIFWFMTWISGFTLIT 303

Query: 254 HVLFVPETFWDRTPVPNERSIRETAIARAADGARDVAISGYSAPKFQGEEDAXXXXXXXX 313
            +   PET  D       + +R+                                     
Sbjct: 304 MIFLFPETSPDNILYRRAKRLRKQ------------------------------------ 327

Query: 314 XXXXXVTPTQSHRYLS---RVRTKIKCSNIAQSHLVTGLGIFHGRHSVDKWIMVMLRPFV 370
                   T  +RY +   R+ ++IK S+            F  R     + +++  P V
Sbjct: 328 --------TGDNRYYTKQERIDSQIKISD------------FLVRTLYKPFKIIVQEPIV 367

Query: 371 LF--CYPAVLFGAFLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILG 428
           L    Y ++ +GAF        L+           N  Y+FS I+ GL Y    +G  +G
Sbjct: 368 LVFNIYLSLAYGAFYLFFEAFPLVF----------NGIYNFSPIETGLSY----MGFAVG 413

Query: 429 SLCAGPLSDKMVRHF--AKKSCGIYEPEFRLFMVLPAGLSTALGLMGFGWSAQAHDAWIA 486
           SL   PL    +      +       PE  L + +  G +    L  FGW A  H  W+ 
Sbjct: 414 SLICFPLLYLFLTKVLNPRIENNTATPETFLILAMWVGWALPASLFIFGWGAGVH--WML 471

Query: 487 P 487
           P
Sbjct: 472 P 472

>ZYRO0E09900g Chr5 (786545..788164) [1620 bp, 539 aa] {ON} similar
           to uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 539

 Score = 34.7 bits (78), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 75/200 (37%), Gaps = 8/200 (4%)

Query: 67  SKSKRDPLNWPVWRRD---TALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYL 123
           S     PLNWP  +     T + V+    ++G   +SI   G + +  +FH      +  
Sbjct: 80  SDDPEHPLNWPNSKTTLVITEIMVLTCVTYMG---SSIYTPGQEEIQHDFHVGHVVGTLN 136

Query: 124 VXXXXXXXXXXSIIASPCAVI--FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVS 181
           +           +I SP +     G++ +Y++           CA+ QN   L+  R ++
Sbjct: 137 LSLYVLGYGLGPLIFSPLSEFAKIGRQRLYIITLFLFCMLQIGCALVQNIAGLVILRFIT 196

Query: 182 GLGVSTIESLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFW 241
           G   S   +   A++ +I         +G +               + +       W+FW
Sbjct: 197 GFLCSPSLATGGASIGDIVRPEIVPIFIGLWGVGAVAAPVTGPLLGASMVVANGWRWIFW 256

Query: 242 IVTIIVGVNFMLHVLFVPET 261
           ++  + G   ++ V F PET
Sbjct: 257 LMVWMSGGILIILVFFFPET 276

>TPHA0I03320 Chr9 (737136..738824) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 45/118 (38%)

Query: 144 IFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAH 203
           + G++ +Y V           CA   N+  L   R  SG+  S   S   A++A+I    
Sbjct: 182 LLGRQHLYTVTLFIFAMLQIGCATVHNFGGLAVLRFFSGVFCSPSLSTGGASIADILAPE 241

Query: 204 ERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
                LG +               + +    D  W+FW+   +     ++ +LF+PET
Sbjct: 242 VVPVFLGLWAVAAFSSPVLAPLLGAVMVVAEDWRWIFWLQLWLSTFTLIVLLLFMPET 299

>TBLA0A04260 Chr1 (1055087..1056790) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 45/115 (39%)

Query: 147 KRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERA 206
           ++I+Y +           CA   N   L+  R ++G   S   +   AT+A+   A   A
Sbjct: 190 RQIIYSLTLLFYSIFQIGCATVNNIGGLIVIRFITGFLSSQALATTGATMADFLDARYYA 249

Query: 207 YRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPET 261
           Y LG ++              + +    +  W+FW +  +     ++ + F PET
Sbjct: 250 YLLGLWSVGAIAAPILAPLLGACMVVAKNWRWIFWFLCWLSATITLITMFFYPET 304

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 71/179 (39%), Gaps = 15/179 (8%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGI--YEPEFRLFMVLPAG 464
           Y F+ I++GL Y+    G  +G+  + PL    +  +      +  ++PE  L ++L   
Sbjct: 389 YHFTLIELGLSYM----GFAVGTAISYPLFAWFIYKYISPKLDLPRFQPESFLVIILYLC 444

Query: 465 LSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKCYAQEALVTL 524
               + L  FGW+A  H  W  P +   V             T+   SY  +        
Sbjct: 445 WLFPIALFMFGWTAGVH--WSLPMVSEIVFCIFQFTFFQIIFTYLALSYPTHVASVFAGN 502

Query: 525 NVLKNVMGFAFSFF-NTKFNVKSGYKTTFIVYGC-----VELIVCLFAIPLYHYGKRAR 577
            V+++ +  AF  F +  FN  +  K   + +GC     + L +C     +Y +G   R
Sbjct: 503 GVVRSCLAGAFPLFGDILFNNLATPKFP-VAWGCSVLGFIALAMCTIPFLIYKFGAYLR 560

>YIL121W Chr9 (132244..133872) [1629 bp, 542 aa] {ON}  QDR2Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin; may have a role in potassium uptake
          Length = 542

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 46/121 (38%), Gaps = 8/121 (6%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V LV            A +Q Y  ++  R +   G+S + ++ S  + ++    E
Sbjct: 124 LGRRPVVLVAIVIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDVTTRAE 183

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  G+ F+   L +PE
Sbjct: 184 R----GGYVGYVAGFQVLGSAFGALIGAGLSSRWGWRAIFWFLAIGSGICFLASFLILPE 239

Query: 261 T 261
           T
Sbjct: 240 T 240

>NCAS0C03600 Chr3 complement(719502..721220) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 54/138 (39%), Gaps = 2/138 (1%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R + L             A  Q Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 144 MGRRPIVLCSIAVYFCACIGLACCQTYPQIVVLRCLQAAGISPVIAINSGIMGDITTRAE 203

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G+ +              + +        +FW + I  G+  ++  + +PET   
Sbjct: 204 RGGFVGYVSGFQVMGSAFGALIGAGISSTWSWRAIFWFLAIGSGICLIISFIILPET--K 261

Query: 265 RTPVPNERSIRETAIARA 282
           RT V N   I ++ + RA
Sbjct: 262 RTIVGNGSIIPKSKLNRA 279

>KNAG0E01170 Chr5 (230542..232263) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 49/129 (37%), Gaps = 3/129 (2%)

Query: 456 RLFMVLPAGLSTALGLMGFGWSAQAHDAWIAPTIFLGVVGFGSSLASTTAITFTVDSYKC 515
           RL   L   L ++ G + FGW         A  +  G     S+   T ++T  VD +  
Sbjct: 429 RLEPALITLLLSSAGFISFGWCISVKAPLPAVLVMSGFSSLFSNSILTMSMTLIVDLFPA 488

Query: 516 YAQEALVTLNVLKNVMGFAFSFFNTKFNVKSGYKTTFIVYGCVELIVCLFAIPLYHYGKR 575
            A  A   LN+++  +   F    ++   K  +   F   GC+        + L   GKR
Sbjct: 489 RASTATGCLNLVRCALSAIFIACLSRMARKMKFGGLFTFLGCLTACSSCLLLILVKNGKR 548

Query: 576 ---ARRWTD 581
               RR +D
Sbjct: 549 LTFERRRSD 557

>ZYRO0A01474g Chr1 (121026..122642) [1617 bp, 538 aa] {ON} similar
           to uniprot|P40474 Saccharomyces cerevisiae YIL121W QDR2
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 538

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 50/133 (37%), Gaps = 10/133 (7%)

Query: 142 AVIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYF 201
           A   G+R V LV            A    Y  L+  R +   G+S + ++ S  + +I  
Sbjct: 112 ADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIAINSGMMTDITT 171

Query: 202 AHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLF 257
             ER    G Y               + +   L   W    +FW ++I  G+  ++  L 
Sbjct: 172 RAER----GGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSGICLVISTLL 227

Query: 258 VPETFWDRTPVPN 270
           +PET   RT V N
Sbjct: 228 LPET--KRTIVGN 238

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 489 IFLGVVGFGSSLASTTAITFTVDSYKCYAQE--ALVTLNVLKNVMGFAFSFF---NTKFN 543
           + + ++GF  S+ ++ ++  T D      +E  AL ++NV+ ++ G   SF     +K N
Sbjct: 364 VLISLLGFFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGGYGRSKIN 423

Query: 544 VKSGYKTTF--IVYGCVELIVCLFAIPLYHY 572
             SG KT    +  G V LI   + +PL HY
Sbjct: 424 AFSGSKTVMSGVFMGSVTLITIRYLLPLIHY 454

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 23/118 (19%), Positives = 53/118 (44%), Gaps = 1/118 (0%)

Query: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYL 152
           F+     ++++     +A EF+  L  IS++             +    + IFG++ + +
Sbjct: 90  FLAAADGTLVSTIMAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148

Query: 153 VXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLG 210
           +           C ++ ++  L+ +R +SG+G   + S+ S T+++I    +RA   G
Sbjct: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQG 206

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 49/126 (38%), Gaps = 2/126 (1%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A+SQNY  ++  R +   G+S + ++ S  + ++    E
Sbjct: 138 LGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKAE 197

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G+                + +    D   +FW + I  G   ++    +PET   
Sbjct: 198 RGGYVGYVAGFQILGSALGALIGAALSSRWDWRAIFWFLAIGSGACALVSFFVLPET--K 255

Query: 265 RTPVPN 270
           RT V N
Sbjct: 256 RTVVGN 261

>KLTH0G11154g Chr7 complement(940157..941875) [1719 bp, 572 aa] {ON}
           conserved hypothetical protein
          Length = 572

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 38/92 (41%)

Query: 94  VGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYLV 153
           + G   SI++  S G+    H S  + S +           S+I SP    FG++   ++
Sbjct: 112 LSGIDQSIISGASIGMNKALHLSAHEASMVSSLMPLGAMAGSVIMSPLNEWFGRKSSIMI 171

Query: 154 XXXXXXXXXXXCAVSQNYESLLASRIVSGLGV 185
                      CA S ++  + A R + G+GV
Sbjct: 172 SCIWYTVGAILCAASTSHHLMYAGRFILGVGV 203

>TBLA0E02500 Chr5 (628027..629757) [1731 bp, 576 aa] {ON} 
          Length = 576

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 70/192 (36%), Gaps = 2/192 (1%)

Query: 72  DPLNWPVWRRDTALFVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXX 131
           +P NW  W++   +  +     +    +SI   G + +  EFH      +  +       
Sbjct: 122 NPHNWKPWKKYLMMAEIMLLTCINYMGSSIYTPGEEEIQREFHVGHVVATLNLSMYVLGY 181

Query: 132 XXXSIIASPCA--VIFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIE 189
               +I SP +    FG+  +YLV            A  +    L+  R ++G+  S   
Sbjct: 182 GIGPMILSPLSEYARFGRLYIYLVTFFMFGLFQVGSATVKTIGGLVVIRFIAGVLCSPAL 241

Query: 190 SLPSATVAEIYFAHERAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGV 249
           +   A++++        Y LG ++              + +    D  W+FW +  +V  
Sbjct: 242 ATGGASLSDFLSTTSMPYFLGLWSIGAIAAPVLAPLLGACMVVAKDWRWIFWFLLFLVAA 301

Query: 250 NFMLHVLFVPET 261
             ++   F PET
Sbjct: 302 LLLVLSFFFPET 313

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 407 YSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGLS 466
           Y+F+ I++GL ++   VG +           K +    K + G + PE  + + +   + 
Sbjct: 398 YNFTVIELGLAFLGFCVGCVFAYAIWVVFMWKYIS--PKFANGTFVPENMVVLGMYLCMF 455

Query: 467 TALGLMGFGWSAQAHDAWIAPTI 489
             L L  FGW+A+ H  WI P I
Sbjct: 456 LPLTLFFFGWTAKVH--WILPII 476

>KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8.517
            YPL058C
          Length = 1508

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%)

Query: 540  TKFNVKSGYKTTFIVYGCVELIVC--LFAIPLYHYGKRARRWTDSKGLLDFSYVKKNHSR 597
            T+FNVK  Y+  +  +G + + +C  LFA+   +Y  R ++W+  K +LDF    K    
Sbjct: 1429 TQFNVKWSYR--WRNFGFMWIYICFNLFAMLSCYYVMRVKKWS-LKSVLDF----KKWFN 1481

Query: 598  GSTGDRHMEDS 608
            G   DRH +D+
Sbjct: 1482 GPRKDRHEKDT 1492

>Smik_9.49 Chr9 (110073..111698) [1626 bp, 542 aa] {ON} YIL121W
           (REAL)
          Length = 542

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 30/151 (19%), Positives = 55/151 (36%), Gaps = 22/151 (14%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A +Q Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 124 LGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 183

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  G+ F+   L +PE
Sbjct: 184 R----GGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGSGICFLASFLILPE 239

Query: 261 T--------------FWDRTPVPNERSIRET 277
           T              + +R P+    ++R++
Sbjct: 240 TKRNISGNGSVTPRSYLNRAPILALSTVRKS 270

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 53/138 (38%), Gaps = 2/138 (1%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A S  Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 141 MGRRPVVLSSVLVYCCACIGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 200

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHWLFWIVTIIVGVNFMLHVLFVPETFWD 264
           R   +G+ +              + +        +FW + I  GV  +  ++ +PET   
Sbjct: 201 RGGYVGYVSGFQVIGSAFGALIGAGLSATWSWRSIFWFLAIGSGVCLVASIIILPET--K 258

Query: 265 RTPVPNERSIRETAIARA 282
           RT V N   +    I+RA
Sbjct: 259 RTVVGNGSIMPPNRISRA 276

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 49/130 (37%), Gaps = 10/130 (7%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A +Q Y  ++  R +   G+S + ++ S  + ++    E
Sbjct: 144 LGRRPVVLFAVTVYFGACIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAE 203

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  GV  +  ++ +PE
Sbjct: 204 R----GGYVGYISGFQVLGSAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPE 259

Query: 261 TFWDRTPVPN 270
           T   RT V N
Sbjct: 260 T--KRTIVGN 267

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 51/121 (42%), Gaps = 3/121 (2%)

Query: 86  FVVGWHCFVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIF 145
            VVG   F+G    +IL+     +A EF  +L  IS++             +    + IF
Sbjct: 158 LVVG--VFLGSLDGTILSTLLDYIASEFE-ALPYISWIAASYLLSACIFQPLYGKLSDIF 214

Query: 146 GKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHER 205
           G++ + L            C  +     LLA R V+G+G   + S+PS  +++I     R
Sbjct: 215 GRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSR 274

Query: 206 A 206
           A
Sbjct: 275 A 275

>Smik_9.48 Chr9 (110001..111776) [1776 bp, 591 aa] {ON} YIL121W
           (REAL)
          Length = 591

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 45/121 (37%), Gaps = 8/121 (6%)

Query: 145 FGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHE 204
            G+R V L             A +Q Y  ++  R +   G+S + ++ S  + +I    E
Sbjct: 148 LGRRPVVLAAIIIYFGACIGLACAQTYAQIIVLRCLQAAGISPVIAINSGIMGDITTRAE 207

Query: 205 RAYRLGFYTXXXXXXXXXXXXXASFVFEYLDRHW----LFWIVTIIVGVNFMLHVLFVPE 260
           R    G Y               + +   L   W    +FW + I  G+ F+   L +PE
Sbjct: 208 R----GGYVGYAAGFQVLGSAFGALIGAGLSFRWGWRAIFWFLAIGSGICFLASFLILPE 263

Query: 261 T 261
           T
Sbjct: 264 T 264

>KNAG0C04620 Chr3 complement(906275..907915) [1641 bp, 546 aa] {ON}
           Anc_5.469 YDR387C
          Length = 546

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 410 SSIQIGLVYVSPFVGSILGSLCAGPLSDKMVRHFAKKSCGIYEPEFRLFMVLPAGL 465
           +S+    +  S  VGS  GSL A PL+DK  R F   +C +      ++M L + L
Sbjct: 80  TSLNEEFITASTSVGSFFGSLLAFPLADKAGRKFTLAACCVVFVVAAIWMALSSSL 135

>TDEL0G02930 Chr7 complement(559519..561396) [1878 bp, 625 aa] {ON}
           Anc_2.363 YMR155W
          Length = 625

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 382 FLYSLAIVWLIMVAQIINTVYGNPPYSFSSIQIGLVYVSPFVGSILGSLCAGPLSDKMVR 441
           ++YS   V  I+  QI +T  G   ++   IQ   V +   + S  G LCAGP+SD +++
Sbjct: 402 YIYS---VGFIVRTQIASTPGGQESFNAEKIQSLQVSIISLL-SFSGRLCAGPVSDLLIK 457

Query: 442 HFAKK 446
            F  +
Sbjct: 458 KFKAQ 462

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%)

Query: 144 IFGKRIVYLVXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAH 203
           IFG++IV              C  ++++  L+  R +SG+G   I S+ + TV++I    
Sbjct: 156 IFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLR 215

Query: 204 ERAYRLG 210
            RA   G
Sbjct: 216 NRALYQG 222

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 1/118 (0%)

Query: 93  FVGGGQTSILAAGSKGLALEFHRSLSDISYLVXXXXXXXXXXSIIASPCAVIFGKRIVYL 152
           F+     +I++     +A EF+  L  IS++             I    + IFG+++V +
Sbjct: 132 FLAALDNTIVSTLLAHIASEFNE-LPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLI 190

Query: 153 VXXXXXXXXXXXCAVSQNYESLLASRIVSGLGVSTIESLPSATVAEIYFAHERAYRLG 210
                       C +S ++E L+A R ++G+G   I S+ S T ++I     RA   G
Sbjct: 191 FCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQG 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,259,529
Number of extensions: 2237720
Number of successful extensions: 6793
Number of sequences better than 10.0: 270
Number of HSP's gapped: 6622
Number of HSP's successfully gapped: 459
Length of query: 611
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 495
Effective length of database: 40,180,143
Effective search space: 19889170785
Effective search space used: 19889170785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)