Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11616g6.5ON74074037160.0
Kwal_56.223296.5ON77675527930.0
SAKL0E00748g6.5ON77471325430.0
KLLA0D00748g6.5ON78970623440.0
Ecym_30076.5ON76968623060.0
ACR022W6.5ON75459622170.0
TDEL0G046606.5ON73965621730.0
ZYRO0F00396g6.5ON73262921410.0
TPHA0J002206.5ON74064221260.0
CAGL0A01133g6.5ON80161421080.0
Kpol_1045.836.5ON74861520990.0
YPL270W (MDL2)6.5ON77362820920.0
Smik_6.4786.5ON77363520800.0
Suva_16.356.5ON76772920770.0
Skud_16.76.5ON77361820640.0
TBLA0A071906.5ON79465620600.0
NDAI0I027306.5ON83262320500.0
NCAS0D022106.5ON77366620320.0
KNAG0E028006.5ON74166019080.0
KAFR0B064806.5ON75160517770.0
TPHA0B046201.67ON72061114980.0
TDEL0C063501.67ON69360514650.0
KLLA0C01991g1.67ON70665414540.0
ZYRO0F17050g1.67ON71464114540.0
NCAS0B087001.67ON71560614490.0
Kpol_2000.791.67ON70761014440.0
Ecym_10721.67ON68360814390.0
NDAI0A005601.67ON71462814310.0
SAKL0C02244g1.67ON71261314290.0
Skud_12.2531.67ON69262613960.0
YLR188W (MDL1)1.67ON69561613830.0
AFR683C1.67ON67760513651e-179
Suva_10.2841.67ON69362313671e-179
Smik_12.2481.67ON69659813661e-179
KLTH0F02024g1.67ON73462613681e-179
Kwal_33.133081.67ON70669313581e-178
CAGL0E00385g1.67ON60860113231e-174
TBLA0A053001.67ON70762213001e-169
SAKL0H00968g5.20ON7005845313e-57
KLLA0A10131g5.20ON7206485131e-54
KNAG0E013205.20ON6953875112e-54
Skud_13.4755.20ON6913985032e-53
Kwal_26.94805.20ON7193825023e-53
Smik_13.5185.20ON6875944987e-53
TBLA0B100701.527ON12965505071e-52
NCAS0D024305.20ON7023474962e-52
Suva_13.4915.20ON6935624934e-52
KLTH0B09482g5.20ON6944044925e-52
YMR301C (ATM1)5.20ON6904204891e-51
CAGL0M13739g5.20ON7275294902e-51
YKL209C (STE6)1.527ON12905814927e-51
AGL335W5.20ON6913934802e-50
Kpol_513.235.20ON7083264793e-50
KAFR0E002301.527ON12705574856e-50
NDAI0I024405.20ON7304014761e-49
TDEL0G004305.20ON6963994741e-49
SAKL0A10208g1.527ON13105924822e-49
KAFR0I025805.20ON7093424732e-49
KNAG0G001901.527ON12755784794e-49
TDEL0F003401.527ON12575414794e-49
Skud_11.111.527ON12955384776e-49
NDAI0D015401.527ON12934394751e-48
TBLA0C070005.20ON7253274681e-48
Kpol_1018.1851.527ON12765734714e-48
Suva_11.111.527ON12905214696e-48
ZYRO0G02244g1.527ON12735344671e-47
Ecym_56495.20ON6963214493e-46
TPHA0L022705.20ON7113764484e-46
TPHA0O001601.527ON12535234521e-45
ZYRO0D07106g5.20ON7093934413e-45
NCAS0G035101.527ON12885294385e-44
KLLA0B14256g1.527ON12715984376e-44
Ecym_36121.527ON13155334377e-44
Smik_11.141.527ON13166264351e-43
TDEL0E056104.52ON15355494351e-43
AFR432W1.527ON12845104351e-43
KLTH0B01100g1.527ON12983794233e-42
Ecym_42658.303ON15055384182e-41
ZYRO0G07612g4.6ON16955564155e-41
CAGL0K00363g1.527ON12275294083e-40
CAGL0C03289g4.6ON16485684031e-39
KNAG0J027304.52ON15375563986e-39
YHL035C (VMR1)4.6ON15925493932e-38
Kwal_33.155611.527ON12976033932e-38
Smik_12.484.52ON15575353914e-38
Suva_8.164.6ON15996553905e-38
KNAG0E011204.6ON17175413905e-38
KLLA0E00529g4.6ON16505583871e-37
NCAS0J00160singletonON16545333862e-37
Skud_7.6145.10ON14775553843e-37
SAKL0H26026g4.6ON16535503834e-37
KLTH0H16038g4.6ON16495693817e-37
Ecym_84184.6ON16785543817e-37
Suva_10.234.6ON16615303818e-37
NCAS0C059304.6ON16575633809e-37
Kwal_34.157704.6ON14365203809e-37
YGR281W (YOR1)5.10ON14775563782e-36
NCAS0B034708.303ON15125363772e-36
NCAS0E041605.10ON15065503763e-36
CAGL0E03355g4.52ON15355483763e-36
CAGL0E03982g4.6ON16595523753e-36
YLL048C (YBT1)4.6ON16615313701e-35
CAGL0G00242g5.10ON14775663702e-35
NDAI0B006405.10ON14915503702e-35
Kpol_311.34.6ON16575183673e-35
Suva_7.5775.10ON14785543664e-35
TPHA0C009608.303ON15235433665e-35
KLTH0C09240gna 1ON15465403665e-35
Skud_12.524.52ON15615423648e-35
Kpol_1060.75.10ON14605543648e-35
Smik_8.64.6ON15855483621e-34
Kwal_56.22747na 1ON15385523612e-34
NDAI0J011508.303ON15175263603e-34
TDEL0G018504.6ON16425383593e-34
SAKL0H00704g5.10ON14395633584e-34
Skud_4.3958.303ON15165213551e-33
Smik_12.114.6ON16615303551e-33
Skud_12.224.6ON16615343541e-33
ZYRO0D06160g8.303ON15255413522e-33
Kpol_1033.288.303ON15315453522e-33
KAFR0L001904.6ON16535653523e-33
Smik_16.275.10ON14775603513e-33
NDAI0H001904.6ON16825723513e-33
TPHA0F001804.6ON16465113513e-33
TPHA0K023104.6ON16495283495e-33
Suva_2.2978.303ON15165263495e-33
Smik_4.3808.303ON15165233487e-33
KAFR0I013004.52ON15365553487e-33
Skud_8.94.6ON15875733487e-33
Kwal_56.238448.303ON14944913452e-32
TBLA0G007104.6ON16915553452e-32
YDR135C (YCF1)8.303ON15155253443e-32
KLLA0D04059g4.52ON15685423415e-32
KNAG0K001705.10ON14425513415e-32
ZYRO0G22176g4.52ON15705043416e-32
KAFR0B056308.303ON15154853406e-32
ACL072C4.6ON16275673408e-32
KNAG0I009908.303ON15355373399e-32
SAKL0H16016g8.303ON14995293399e-32
KLTH0G12716g8.303ON15004863362e-31
AGR047W8.303ON14925003353e-31
Kwal_26.95325.10ON14715453344e-31
Kpol_YGOB_1041.454.52ON15685733335e-31
Suva_10.594.52ON15615363335e-31
CAGL0L06402g8.303ON15355393326e-31
KAFR0C065105.10ON14575383326e-31
Kpol_1041.45singletonOFF15965733326e-31
Suva_10.60singletonON9905363317e-31
KLLA0C14234g5.10ON14545413291e-30
TPHA0A056205.10ON14775593282e-30
TDEL0F043008.303ON15145403282e-30
KLLA0F20075g8.303ON15165363263e-30
Skud_18.2singletonON15805373254e-30
Smik_11.367na 2ON15955393221e-29
YLL015W (BPT1)4.52ON15595453193e-29
TBLA0C06400singletonON13775483166e-29
Zrou_YGOB_Anc_5.105.10ON9926393156e-29
TBLA0C071005.10ON14855523166e-29
KLTH0B09724g5.10ON14865473158e-29
SAKL0H23958g4.52ON15585603112e-28
TPHA0F004104.52ON15705683085e-28
TDEL0G003305.10ON14655473076e-28
KLTH0B00396gsingletonON15072272933e-26
YKR104WsingletonON3062802774e-26
AGL346W5.10ON14002392891e-25
TBLA0A06840singletonON10582672872e-25
TBLA0A038008.303ON15464462353e-19
Ecym_56605.10ON15362542131e-16
YKR103W (NFT1)na 2ON12182061988e-15
Kwal_26.87308.661ON8312781862e-13
Kpol_175.1singletonON13772631852e-13
YOL075C3.133ON12942631817e-13
SAKL0F01606g3.534ON6081741771e-12
KLTH0D10890g8.661ON8302551781e-12
YER036C (ARB1)3.534ON6102311743e-12
Skud_5.1453.534ON6102241734e-12
Suva_5.1343.534ON6101771735e-12
Smik_5.1593.534ON6101881735e-12
Ecym_11943.534ON6092351725e-12
AFR232C3.534ON6071741701e-11
ZYRO0E04092g1.427ON10622801692e-11
KAFR0A037908.661ON8762151692e-11
SAKL0H21010gsingletonON14472491682e-11
TPHA0A058903.534ON6101881673e-11
SAKL0D10208g1.366ON7522361664e-11
TBLA0I033303.534ON6101771655e-11
ACR128C8.661ON8272441646e-11
TPHA0D011708.661ON9152151647e-11
TDEL0D060203.534ON6101771638e-11
Suva_15.913.133ON13022321649e-11
NCAS0E004803.534ON6101771621e-10
CAGL0K10472g1.366ON7522111611e-10
Kwal_47.191163.534ON6071771611e-10
CAGL0C02343g3.534ON7201901611e-10
Kwal_0.3271.427ON10192571612e-10
TBLA0G028203.220ON15112341612e-10
KAFR0C012003.133ON12732361612e-10
ZYRO0E08800g3.534ON6102431602e-10
ZYRO0D11880g5.500ON14982231602e-10
Smik_15.843.133ON12952331593e-10
KAFR0C045401.366ON7522501583e-10
Skud_4.6805.500ON14452431593e-10
Skud_4.681na 3ON14452431593e-10
SAKL0D09394g1.427ON10272551593e-10
KLLA0A01452g3.534ON6072241583e-10
YDR406W (PDR15)5.500ON15292401584e-10
KLTH0H12760g1.427ON10202661584e-10
KLLA0D03432g3.220ON14832711585e-10
KAFR0C00820na 4ON15172381575e-10
TBLA0D043501.427ON11192541575e-10
YPL147W (PXA1)8.661ON8702091575e-10
KAFR0C05210na 3ON14932661575e-10
KLTH0G01452g3.534ON6072311565e-10
KNAG0B038705.500ON15132401575e-10
KNAG0C019601.366ON7522331566e-10
NDAI0I030203.534ON6091771556e-10
KNAG0K009503.133ON12843421566e-10
KNAG0I005301.427ON10472511567e-10
Smik_6.3448.661ON8702091557e-10
Smik_4.6785.500ON15332361568e-10
Suva_2.5835.500ON15372391568e-10
TDEL0B057601.427ON10362461558e-10
Suva_16.1638.661ON8702091549e-10
TPHA0A023101.366ON7522111549e-10
Smik_7.3131.366ON7522321549e-10
Kpol_1049.234.6ON110941391e-09
YFR009W (GCN20)1.366ON7522321531e-09
ZYRO0G01144g1.366ON7522341531e-09
KAFR0C052205.500ON14992581541e-09
NCAS0A085701.427ON10602701541e-09
Suva_3.371.427ON10533101531e-09
YNR070W (PDR18)na 5ON13332331531e-09
TDEL0D040403.220ON15002341531e-09
ZYRO0B05588g3.133ON12702321531e-09
KNAG0A029808.661ON8711981522e-09
Skud_14.404na 5ON14242331532e-09
Kpol_1043.431.366ON7522401522e-09
YDR011W (SNQ2)3.220ON15012401532e-09
Smik_3.971.427ON10492421522e-09
TBLA0D01820singletonON15512481522e-09
KLTH0H13442g1.366ON7522401512e-09
Kpol_1050.263.534ON6101771512e-09
ZYRO0F07018g8.661ON8611981512e-09
TPHA0D04700singletonON15102321522e-09
KLLA0A10857g1.366ON7522111512e-09
Kpol_1053.483.133ON12882461512e-09
Skud_16.1358.661ON8702091512e-09
Smik_15.3335.500ON15102441513e-09
ZYRO0A04114g3.220ON15182331513e-09
Kpol_1012.108.661ON8551531503e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11616g
         (740 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...  1436   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...  1080   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   984   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   907   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   892   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   858   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   841   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   829   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   823   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   816   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   813   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   810   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   805   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   804   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   799   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   798   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   794   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      787   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   739   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   689   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   581   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   568   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   564   0.0  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   564   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   562   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   560   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   558   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   555   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   555   0.0  
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   542   0.0  
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   537   0.0  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   530   e-179
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   531   e-179
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   530   e-179
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   531   e-179
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   527   e-178
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   514   e-174
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   505   e-169
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   209   3e-57
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   202   1e-54
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   201   2e-54
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   198   2e-53
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   197   3e-53
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   196   7e-53
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   199   1e-52
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     195   2e-52
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   194   4e-52
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   194   5e-52
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   192   1e-51
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   193   2e-51
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   194   7e-51
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   189   2e-50
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   189   3e-50
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   191   6e-50
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   187   1e-49
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   187   1e-49
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   190   2e-49
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   186   2e-49
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   189   4e-49
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   189   4e-49
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   188   6e-49
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   187   1e-48
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   184   1e-48
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   186   4e-48
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   185   6e-48
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   184   1e-47
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   177   3e-46
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   177   4e-46
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   178   1e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   174   3e-45
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   173   5e-44
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   172   6e-44
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   172   7e-44
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   172   1e-43
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   172   1e-43
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   172   1e-43
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   167   3e-42
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   165   2e-41
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   164   5e-41
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   161   3e-40
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   159   1e-39
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   157   6e-39
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   155   2e-38
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   155   2e-38
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   155   4e-38
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   154   5e-38
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   154   5e-38
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   153   1e-37
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   153   2e-37
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   152   3e-37
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   152   4e-37
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   151   7e-37
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   151   7e-37
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   151   8e-37
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   150   9e-37
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   150   9e-37
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   150   2e-36
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   149   2e-36
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    149   3e-36
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   149   3e-36
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   149   3e-36
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   147   1e-35
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   147   2e-35
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    147   2e-35
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   145   3e-35
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   145   4e-35
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   145   5e-35
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   145   5e-35
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   144   8e-35
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   144   8e-35
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   144   1e-34
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   143   2e-34
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   143   3e-34
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   142   3e-34
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   142   4e-34
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   141   1e-33
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   141   1e-33
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   140   1e-33
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   140   2e-33
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   140   2e-33
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   140   3e-33
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   139   3e-33
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   139   3e-33
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   139   3e-33
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   139   5e-33
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   139   5e-33
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   138   7e-33
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   138   7e-33
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   138   7e-33
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   137   2e-32
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   137   2e-32
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   137   3e-32
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   135   5e-32
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   135   5e-32
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   135   6e-32
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   135   6e-32
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   135   8e-32
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   135   9e-32
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   135   9e-32
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   134   2e-31
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   133   3e-31
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   133   4e-31
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   132   5e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   132   5e-31
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   132   6e-31
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   132   6e-31
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   132   6e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   132   7e-31
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   131   1e-30
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   130   2e-30
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   130   2e-30
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   130   3e-30
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   129   4e-30
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   128   1e-29
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   127   3e-29
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   126   6e-29
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   125   6e-29
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           126   6e-29
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   125   8e-29
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   124   2e-28
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   123   5e-28
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   122   6e-28
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   117   3e-26
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   111   4e-26
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   115   1e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   115   2e-25
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...    95   3e-19
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    87   1e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    81   8e-15
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    76   2e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    76   2e-13
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    74   7e-13
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    73   1e-12
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    73   1e-12
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    72   3e-12
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    71   4e-12
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    71   5e-12
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    71   5e-12
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    71   5e-12
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    70   1e-11
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    70   2e-11
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    70   2e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    69   2e-11
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    69   3e-11
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    69   4e-11
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    68   5e-11
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    68   6e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    68   7e-11
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    67   8e-11
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    68   9e-11
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 67   1e-10
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    67   1e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    67   1e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    67   1e-10
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    67   2e-10
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    67   2e-10
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    67   2e-10
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    66   2e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    66   2e-10
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    66   3e-10
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    65   3e-10
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    66   3e-10
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    66   3e-10
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    66   3e-10
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    65   3e-10
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    65   4e-10
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    65   4e-10
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    65   5e-10
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              65   5e-10
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    65   5e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    65   5e-10
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            65   5e-10
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    65   5e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    65   5e-10
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    65   6e-10
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    64   6e-10
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    65   6e-10
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    65   7e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    64   7e-10
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    65   8e-10
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    65   8e-10
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    64   8e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    64   9e-10
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    64   9e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    64   9e-10
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    58   1e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    64   1e-09
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    64   1e-09
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    64   1e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    64   1e-09
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    64   1e-09
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    64   1e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    63   2e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    64   2e-09
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    63   2e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    64   2e-09
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    63   2e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              63   2e-09
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    63   2e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    63   2e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    63   2e-09
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            63   2e-09
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    63   2e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    63   2e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    63   2e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    63   3e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    63   3e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    62   3e-09
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    62   3e-09
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    62   3e-09
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    62   3e-09
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    62   3e-09
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    62   4e-09
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    62   4e-09
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    62   4e-09
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    62   4e-09
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    62   4e-09
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    62   4e-09
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    62   4e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    62   4e-09
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    62   5e-09
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    62   5e-09
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    62   5e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    62   5e-09
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    62   5e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    62   5e-09
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    62   5e-09
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    62   5e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    62   5e-09
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    62   6e-09
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    62   6e-09
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    62   6e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    62   6e-09
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    62   6e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    62   7e-09
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    62   7e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    61   8e-09
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    61   8e-09
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    61   8e-09
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     61   9e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    61   1e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    60   1e-08
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    61   1e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    61   1e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    61   1e-08
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    60   1e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    60   1e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    60   1e-08
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    60   2e-08
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    60   2e-08
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    58   2e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    60   2e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    60   2e-08
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    60   2e-08
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    60   2e-08
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    60   2e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    60   2e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    60   2e-08
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    60   3e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    60   3e-08
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    59   3e-08
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    59   3e-08
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    59   3e-08
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    59   3e-08
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    59   4e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    59   4e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   4e-08
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    59   4e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       59   5e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    59   5e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             59   6e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   6e-08
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    58   6e-08
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     58   6e-08
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    58   7e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    58   7e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                58   7e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    58   8e-08
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    58   8e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    58   8e-08
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    57   1e-07
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    57   1e-07
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    57   1e-07
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    55   1e-07
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     57   1e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    57   1e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    57   2e-07
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    57   2e-07
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    55   2e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    57   2e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    57   2e-07
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    57   2e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    57   2e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    57   2e-07
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    57   2e-07
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    57   2e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    57   2e-07
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    56   3e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    56   3e-07
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    56   3e-07
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    54   4e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    56   4e-07
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    55   5e-07
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    55   5e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    55   5e-07
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    55   5e-07
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    55   6e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    55   7e-07
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    54   1e-06
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    54   1e-06
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    54   1e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    54   1e-06
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    54   2e-06
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    53   3e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    53   3e-06
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    53   3e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    53   3e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    52   4e-06
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    52   4e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    52   5e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    52   5e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    52   5e-06
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    52   6e-06
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    52   6e-06
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              52   6e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    52   7e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    52   7e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    52   7e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    51   7e-06
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    52   8e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    52   8e-06
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    51   9e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    51   9e-06
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    51   9e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    51   1e-05
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    50   1e-05
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    51   1e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    51   1e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    51   1e-05
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              50   2e-05
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    49   2e-05
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    50   2e-05
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    50   2e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    50   2e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    49   2e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    50   2e-05
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    50   2e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    50   3e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    49   3e-05
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    48   3e-05
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    48   4e-05
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    49   6e-05
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    47   6e-05
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    47   8e-05
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    48   1e-04
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    47   1e-04
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    47   1e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    46   1e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    47   2e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    47   2e-04
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    47   2e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    46   2e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    47   2e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    46   2e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    47   2e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    47   3e-04
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    47   3e-04
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    46   3e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    46   3e-04
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    46   3e-04
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    46   3e-04
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    46   3e-04
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    46   3e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    46   3e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    46   3e-04
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    46   4e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    46   4e-04
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    46   4e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    46   4e-04
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             45   5e-04
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    45   5e-04
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    45   5e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    45   6e-04
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    45   6e-04
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    45   6e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    45   7e-04
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    45   7e-04
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    45   7e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    45   8e-04
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    45   8e-04
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    45   8e-04
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    45   9e-04
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    44   9e-04
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    44   9e-04
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    45   9e-04
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   0.001
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    44   0.001
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    44   0.001
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    44   0.001
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    44   0.002
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    44   0.002
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    44   0.002
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    43   0.002
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    44   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    44   0.002
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    44   0.002
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    44   0.002
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    43   0.002
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    44   0.002
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    44   0.002
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.002
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    44   0.002
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    43   0.002
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    44   0.002
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.002
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    43   0.003
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    43   0.003
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    43   0.003
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    43   0.003
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    43   0.003
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    43   0.003
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    43   0.003
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    43   0.004
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.004
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    42   0.005
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.005
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    42   0.005
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    42   0.006
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    42   0.006
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    42   0.007
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    42   0.007
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    42   0.007
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    42   0.007
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    42   0.007
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    42   0.008
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    41   0.008
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.008
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    42   0.008
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    42   0.009
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    41   0.009
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.009
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    41   0.014
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    41   0.014
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    40   0.018
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.023
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    40   0.031
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    39   0.036
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    39   0.040
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    39   0.043
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    39   0.045
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    39   0.052
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    39   0.053
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    39   0.065
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    38   0.077
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    38   0.084
TBLA0C01250 Chr3 complement(272280..273713) [1434 bp, 477 aa] {O...    38   0.11 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    38   0.12 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    38   0.12 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    37   0.14 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    37   0.15 
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    37   0.17 
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    37   0.23 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.28 
AAL013W Chr1 (318501..319973) [1473 bp, 490 aa] {ON} Syntenic ho...    36   0.35 
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    35   0.52 
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    35   0.67 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   0.68 
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    35   0.69 
KAFR0I02210 Chr9 complement(450996..452486) [1491 bp, 496 aa] {O...    35   0.73 
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    35   1.1  
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    34   1.2  
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   1.3  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.5  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    34   1.6  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    34   1.6  
TDEL0B06010 Chr2 complement(1062021..1063511) [1491 bp, 496 aa] ...    34   1.7  
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    33   2.6  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   2.7  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   2.7  
KNAG0C01270 Chr3 (245114..257437) [12324 bp, 4107 aa] {ON} Anc_1...    33   3.3  
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    33   3.9  
KLLA0D03366g Chr4 (281588..282556) [969 bp, 322 aa] {ON} weakly ...    32   6.2  
TPHA0A03200 Chr1 (700189..703593) [3405 bp, 1134 aa] {ON} Anc_7....    32   8.5  
NCAS0A13840 Chr1 complement(2715649..2719053) [3405 bp, 1134 aa]...    32   9.8  

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score = 1436 bits (3716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/740 (95%), Positives = 710/740 (95%)

Query: 1   MLLARFSRQQGGARLPLGVQLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQRPTQLD 60
           MLLARFSRQQGGARLPLGVQLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQRPTQLD
Sbjct: 1   MLLARFSRQQGGARLPLGVQLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQRPTQLD 60

Query: 61  LRNPVSSSFIRYHXXXXXXXXXXXXXXXXGGKANNESTEEKSKTNYREILRLIRLARHDW 120
           LRNPVSSSFIRYH                GGKANNESTEEKSKTNYREILRLIRLARHDW
Sbjct: 61  LRNPVSSSFIRYHSQNSPNSSTPSSSNDSGGKANNESTEEKSKTNYREILRLIRLARHDW 120

Query: 121 KLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFL 180
           KLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFL
Sbjct: 121 KLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFL 180

Query: 181 AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRL 240
           AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRL
Sbjct: 181 AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRL 240

Query: 241 SSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKK 300
           SSDAYVVSRSMTQNVSDGFKA              SASLTSALFLFAPPLLVGALIYGKK
Sbjct: 241 SSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASLTSALFLFAPPLLVGALIYGKK 300

Query: 301 IRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN 360
           IRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN
Sbjct: 301 IRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN 360

Query: 361 ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420
           ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL
Sbjct: 361 ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420

Query: 421 MKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI 480
           MKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI
Sbjct: 421 MKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI 480

Query: 481 EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540
           EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP
Sbjct: 481 EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540

Query: 541 MLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQK 600
           MLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQK
Sbjct: 541 MLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQK 600

Query: 601 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRR 660
           QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRR
Sbjct: 601 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRR 660

Query: 661 SENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ 720
           SENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ
Sbjct: 661 SENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ 720

Query: 721 VLEQVANDFNLDQKSSKLTP 740
           VLEQVANDFNLDQKSSKLTP
Sbjct: 721 VLEQVANDFNLDQKSSKLTP 740

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/755 (72%), Positives = 620/755 (82%), Gaps = 21/755 (2%)

Query: 1   MLLARFSR--QQGG--ARL--PLGVQLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQ 54
           MLL+ FSR  + GG  +RL  PL  +    +RG  G+ AF H   +     T+R L    
Sbjct: 28  MLLSSFSRPLRLGGTLSRLKSPLCAEFSQLKRGTFGISAF-HCQASH----TNRTLTPRI 82

Query: 55  RPTQ-----LDLRNPVSSSFIRYHXXXXXXXXXXXXXXXXGGKANNESTEEKSKTNYREI 109
           + T+     L L  P +    R +                  K+     EE     Y+E+
Sbjct: 83  QETRFETHSLRLSVPRTLQLTRLYSQKTVESQAKTPADKESQKSGTMEDEESPNMGYKEV 142

Query: 110 LRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPP 169
           +RL +LA HDWKLL+ AIGLL ISS +GM+IPKVIG+VLDA+KN     +GP+ L+DLPP
Sbjct: 143 IRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSATGPVGLDDLPP 202

Query: 170 IIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD 229
           I+  L M++FL IFAG LV GT+ANFGRIVLLRVLGEKLVARLRSNVI+KIIHQDAEFFD
Sbjct: 203 IVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDAEFFD 262

Query: 230 RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
           RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKA              S SLTSAL +FAPP
Sbjct: 263 RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLMFAPP 322

Query: 290 LLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
           LL+GALIYGK+IRMISR+LQESTGNLT+VSEEQLSGVKTIQ+FVAEGKEL RYN AIRKV
Sbjct: 323 LLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTAIRKV 382

Query: 350 FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409
           F +GKKEALTNATFFSST +LGDLSFLIVLAYGSHLVLQGGL+VGDLTAFMLYTEYTGSA
Sbjct: 383 FLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEYTGSA 442

Query: 410 VFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469
           VFGLSNFYSELMKGAGAASRLFEMTDH   IKP++GKPYVP  G+I F+DVSFSYPTRPG
Sbjct: 443 VFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYPTRPG 502

Query: 470 NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSL 529
           NQIFNKLNFTIEPGSNVC+VGPSGRGKSTI SLLLRYY+P+SG+I ID Q+IS+LSCKSL
Sbjct: 503 NQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLSCKSL 562

Query: 530 RRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIG 589
           RRHLGVVQQEPMLMSGSI+YNLTYG+ SEV+MDEIRSVAKKCFCHGF+TKFP GY+T+IG
Sbjct: 563 RRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYDTIIG 622

Query: 590 PRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTII 649
           PRGASLSGGQKQRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG+LM+S+ELTII
Sbjct: 623 PRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTII 682

Query: 650 SIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK---KPT-QLQSQ 705
           SIAHRLSTIRRSENVIVLGNDGSVVE+GKFK+LYA+ QSEL+KLLNDK   KPT ++QS 
Sbjct: 683 SIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTPRVQSD 742

Query: 706 SRNSVETKENEVDDQVLEQVANDFNLDQKSSKLTP 740
                E +E+++D+QV EQVANDFNLDQKSSKLTP
Sbjct: 743 PEKDRE-QEHQIDNQVREQVANDFNLDQKSSKLTP 776

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/713 (69%), Positives = 564/713 (79%), Gaps = 24/713 (3%)

Query: 52  LLQRPTQLDL-------RNPVSSSFIR-YHXXXXXXXXXXXXXXXXGGKANNESTEEKSK 103
           LL  P+Q  L       ++P+S +F R Y                   K   EST   S 
Sbjct: 62  LLGYPSQNKLCDQQCFTKSPISYNFKRSYSTTEEKSTATTTSTPTPEQKKEQESTSGNSG 121

Query: 104 TNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMT 163
             Y+EI RL RLARHDWKLL VAI LLTIS ++GM +PKVIG+VLD  KNA      P  
Sbjct: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKD 181

Query: 164 LEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQ 223
           L DLPP+++GLG++DFLA+FAG LV  T ANFGR+VLLR+LGEKLVARLRSNVIKK IHQ
Sbjct: 182 LRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQ 241

Query: 224 DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSAL 283
           DAEFFDRNKVGDLISRLSSDAYVVSRSMTQN+SDGFKA              S++L +AL
Sbjct: 242 DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATAL 301

Query: 284 FLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
           FLFAPPLLVGA IYG+KIR ISR+LQ+STGNLTKV+EEQLSGVKT+Q+FVAE KE+ RYN
Sbjct: 302 FLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYN 361

Query: 344 NAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYT 403
           +AIRKVF  GK+EALTNATFFSST +LGD SFLIVLAYGSHLVLQG LS+GDLTAFMLYT
Sbjct: 362 HAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYT 421

Query: 404 EYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFS 463
           EY+GSAVFGLSNFYSELMKGAGAASRLFE+TDH   I  + G PYVP  GEIKFE+VSFS
Sbjct: 422 EYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFS 481

Query: 464 YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
           YPTR  NQIFN LNFTI+ GSNVCVVGPSGRGKSTIASLLL+YY+P SGRI IDGQ+ISK
Sbjct: 482 YPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISK 541

Query: 524 LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEG 583
           +S KSLRRHLGVVQQEP+LMSGSIR N+TYG+    T+DEIRSV+KKCFCH FITKF +G
Sbjct: 542 ISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDG 601

Query: 584 YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
           YETVIGP+GA LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTLG+LM+S
Sbjct: 602 YETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKS 661

Query: 644 RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQ 703
           R++TIISIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYA+ +S+L+KLLN+K      
Sbjct: 662 RDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTS 721

Query: 704 SQSRNSVET----------------KENEVDDQVLEQVANDFNLDQKSSKLTP 740
             +  +VE                 ++  +++QVL QV +D N DQKS+ L P
Sbjct: 722 KMNAETVEKNDPSPKTEKLNDEEKEEQRRIEEQVLNQVLDDMNYDQKSTSLRP 774

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/706 (64%), Positives = 542/706 (76%), Gaps = 55/706 (7%)

Query: 90  GGKANNESTEEKS---KTN---------YREILRLIRLARHDWKLLSVAIGLLTISSTVG 137
           GG   ++  E+K+   KTN           ++ RL  LARHDWK+L +A+ LLT+S T+G
Sbjct: 84  GGNGKHQEGEDKTPDKKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIG 143

Query: 138 MTIPKVIGIVLDAVKNASGGF-----------SGPMTLEDLPPIIYGLGMFDFLAIFAGI 186
           M +PKVIG+VLDA KNA  G            S  +TL+DLPPI+  + ++DF  +F G 
Sbjct: 144 MAVPKVIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGA 203

Query: 187 LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYV 246
           L+ GT+ANFGR+VLL++LGE+LVARLRSNVIKK +H D EF+DRNKVGDL+SRL +DAY+
Sbjct: 204 LLIGTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYI 263

Query: 247 VSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISR 306
           VSRSMTQN+SDGFKA              S++L S LFLFAPPLLVGA IYG KIR ISR
Sbjct: 264 VSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISR 323

Query: 307 ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS 366
           ELQ+++GNLTKV+EEQLSG+KT+Q+FVAEGKE+HRYNNA+R+VF+ GKKEA TNATFFSS
Sbjct: 324 ELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSS 383

Query: 367 TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426
           T +LGD SFL+VLAYGSHLVLQG L++GDLTAFMLYTEYTGSAVFGLS FYSELMKGAGA
Sbjct: 384 TNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGA 443

Query: 427 ASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNV 486
           A+RLFE+ D+   IK ++GK + P  G+++F+ VSFSYPTR  NQIF  LNFTIEPGSNV
Sbjct: 444 ATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNV 503

Query: 487 CVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGS 546
           C+VGPSGRGKSTIASLLLRYY+P SG+I++DGQ+I+KLS KSLRR LGVVQQEP+LMSG+
Sbjct: 504 CIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGT 563

Query: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
           IR N+TYG++ + +M+EIRSVAKKCFCH FI+KFP GYET+IGPRGA LSGGQKQRIAIA
Sbjct: 564 IRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIA 623

Query: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
           RAL+ KPKILILDEATSALDVESEGAINYTLGRLM+S+ELTIISIAHRLSTIRRSENVIV
Sbjct: 624 RALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIV 683

Query: 667 LGNDGSVVEMGKFKELYANDQSELFKLL-------------------------------- 694
           LG DGSVVEMGKFK+LYAN  S L KLL                                
Sbjct: 684 LGIDGSVVEMGKFKDLYANHDSALHKLLTEPSEQQHSQHQQYAPPAITQESEPQTEENGK 743

Query: 695 NDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQKSSKLTP 740
           +D    Q      NS +  E  + ++V+ QV  D + DQK+S L P
Sbjct: 744 DDSGEDQNSDHEENSQDQNEKRLQEEVIHQVLEDISHDQKTSTLRP 789

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/686 (64%), Positives = 536/686 (78%), Gaps = 40/686 (5%)

Query: 94  NNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKN 153
           N+   ++++   +RE+LRL  LA+HDWKLL+VAIGLL++S T+GM +PKVIG+VLDA KN
Sbjct: 85  NDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKN 144

Query: 154 A-------------------SGGFSGPM-TLEDLPPIIYGLGMFDFLAIFAGILVFGTIA 193
                                   +GP+ +L+ LPPI+  L +  F+ IFAG LV G  A
Sbjct: 145 TLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATA 204

Query: 194 NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
           NFGR+VLL+++GE+LV+RLRS VIK+ +H D EFFDRNKVGDLISR  SDAYVVSRSMTQ
Sbjct: 205 NFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQ 264

Query: 254 NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTG 313
           NVSDGFKA              S++LTS + LFAPPLLVGA IYGKKI  ISR+LQ+S+G
Sbjct: 265 NVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSG 324

Query: 314 NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL 373
           NLT+V+EEQL+G++TI++FVAE KE+ RYN+AIR++F  GK+EA TNATFFSST ILGD+
Sbjct: 325 NLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDM 384

Query: 374 SFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 433
           SF+IVL YG++LVLQG LS+GDLTAFMLYTEYTGS+VFGLS FYSELMKGAGAASRLFE+
Sbjct: 385 SFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFEL 444

Query: 434 TDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSG 493
            DH + ++ +      P+ G+I+F DVSFSYPTRP NQIF  ++FTIEPGSNVC+VGPSG
Sbjct: 445 MDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSG 504

Query: 494 RGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553
           +GKSTI SLLLR+YDPN G I+ID  +ISK + KSLRRHLGVVQQEP LMSG+IR N+TY
Sbjct: 505 KGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITY 564

Query: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
           G++   TMDEIR V+K+CFCHGFITKFP+GY+TVIGPRGASLSGGQ+QRIAIARALIKKP
Sbjct: 565 GLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKP 624

Query: 614 KILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSV 673
           KILILDEATSALDVESEGAINYTLG LMRS+ELTIISIAHRLSTIRRSEN+IV+GNDGSV
Sbjct: 625 KILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSV 684

Query: 674 VEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKEN------------------ 715
           VE+GKF +LY N++SELFKLLN+K    L S+S N+ +   +                  
Sbjct: 685 VEVGKFDKLYRNEESELFKLLNEKD-HDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDV 743

Query: 716 -EVDDQVLEQVANDFNLDQKSSKLTP 740
             ++D+V++ V ND   D+ SS L P
Sbjct: 744 ASINDKVVKNVLNDITHDKNSSTLRP 769

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/596 (70%), Positives = 501/596 (84%), Gaps = 5/596 (0%)

Query: 106 YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNA-----SGGFSG 160
           + E+ RL+RL + DWKLL  A+GLLTIS ++GM +PKVIG+VLDA K+A           
Sbjct: 103 WHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGA 162

Query: 161 PMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKI 220
           PM+L D+P II    + D LA FAG L+ G+ ANFGR+ LL++LGE+LVARLR+ VIKK 
Sbjct: 163 PMSLLDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKT 222

Query: 221 IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLT 280
           +H DAEFFDRNKVGDLISRL SDAY+VSRSMT N+SDG KA              S++LT
Sbjct: 223 LHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLT 282

Query: 281 SALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELH 340
           SA+ +FAPPLL+ A IYGK+IR ISRELQ+STGNLT+VSEEQ +G+KTI++FVAEGKE+ 
Sbjct: 283 SAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMR 342

Query: 341 RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFM 400
           RYN A+R++F+  K+E +T+ATFFS T +LGD+SFL+VLAYGSHLVLQG LS+G LTAFM
Sbjct: 343 RYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFM 402

Query: 401 LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDV 460
           LYTEYTGS+VFGLSNFYSELMKGAGAASRLFE+TD+   +  + G+ +VP  G I+F+DV
Sbjct: 403 LYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDV 462

Query: 461 SFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQN 520
           SFSYPTRP +QIF KL  TI PGSNVC+VGPSGRGKSTIASLLLR+YD NSG I+IDGQ+
Sbjct: 463 SFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQD 522

Query: 521 ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF 580
           ISK+S KSLR+HLGVVQQEP+LMSG+IR N+TYG++   +MDEIR+VAKKCFCH FITKF
Sbjct: 523 ISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582

Query: 581 PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640
           P+GY+TVIGPRGA LSGGQ+QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL
Sbjct: 583 PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 642

Query: 641 MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
           MRS+E+TI+SIAHRLSTIRRSEN++VLGNDGSV+E GKF +LY ++ SELFKLLN+
Sbjct: 643 MRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/656 (62%), Positives = 513/656 (78%), Gaps = 15/656 (2%)

Query: 99  EEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNA---S 155
           E + K+  ++++RL+ LA+ DWKLL +AI LLT+S  +GMTIPKVIG++LD +K     +
Sbjct: 84  EAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETN 143

Query: 156 GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN 215
            G  GP+++ D+PPI  G  +++FL  FA ++VFG +AN+GRIVLLR+L E++VARLR+N
Sbjct: 144 EGKDGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRAN 203

Query: 216 VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 275
           VIKK IHQD+EFFDR+KVGDLISRL SDAYVVSRSMTQ VSDGFKA              
Sbjct: 204 VIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSI 263

Query: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
           S  L+  L LF PP+L  A I+G+KIR  S +LQE+TG LT+VSEEQLSGV+T+Q+FVAE
Sbjct: 264 SPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAE 323

Query: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395
            KE+HRY++AIR +F+ GK+ A  NA FF++T  LGD+SFL+VLAYGS+LVLQGGL++GD
Sbjct: 324 QKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGD 383

Query: 396 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEI 455
           LTAFMLYTEYTGS+VFGL++FYSELM+G GAA+RLFE+TD    IKP++GK +VP  GEI
Sbjct: 384 LTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEI 443

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            F+DV+FSYPTRPGN IF  ++  I  GSNVCVVGPSGRGKSTIA LLLR+Y+P+SG+I 
Sbjct: 444 VFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIF 503

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575
           IDGQ+ISKL+ KSLRRH+G+VQQEP+LMSG++R N+TYG+    + +EIR VAK+CFCH 
Sbjct: 504 IDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHN 563

Query: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
           FI KFP GY+TVIGP+GA LSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINY
Sbjct: 564 FIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINY 623

Query: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           T G+LM+S+ +TI+SIAHRLSTIRRSEN+IVLGNDGSVVE GKFKEL+A+  SEL KLLN
Sbjct: 624 TFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLN 683

Query: 696 DKKPTQL------------QSQSRNSVETKENEVDDQVLEQVANDFNLDQKSSKLT 739
           +K                 Q +   + +    E  D  +E++  D   + K  K++
Sbjct: 684 EKSSRSENSSSSYSPNASEQPEDEANQKNAPEEAHDDSVEEILKDVTAEGKPIKIS 739

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/629 (63%), Positives = 504/629 (80%), Gaps = 5/629 (0%)

Query: 100 EKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV-KNASGGF 158
           +K +++Y++ +RL  LA+ DW+LL  AI LLTIS  +GM+IPKVIG+VLD + K   G  
Sbjct: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130

Query: 159 SGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK 218
              + ++DL PI +GL ++ FL +FAG+L+ GT ANF RIV+LR+L E++VARLRS V+ 
Sbjct: 131 LQNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMN 190

Query: 219 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSAS 278
           K +HQD+EF+D +KVGDLISRL SDAYVVSRSMTQ VSDGFKA              S  
Sbjct: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250

Query: 279 LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338
           L+  L  FAPP+L  A ++GKKIR  S++LQE+TG LT+V+EEQLSGVKT+Q+FVAE +E
Sbjct: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310

Query: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398
           LHRYN AIR +++ G+K A  NA FF+ST +LGD+SF++VL YGS+LVLQG L++GDLTA
Sbjct: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370

Query: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFE 458
           FMLYTEYTGS+VFGL+ FYSELM+G GAASRLF++TDH S I P+ G+ Y+P  G+I+F+
Sbjct: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430

Query: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
           +VSFSYPTRP NQIF  +N  + PGSNVC+VGPSGRGKSTIA LLLRYY+P +G+I++DG
Sbjct: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490

Query: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578
           Q+ISK++CK+LRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FIT
Sbjct: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550

Query: 579 KFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638
           KFP+GY+T+IG +GA LSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYT G
Sbjct: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610

Query: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698
           +LM+S  +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+AN  SEL KLL +K 
Sbjct: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670

Query: 699 PTQLQSQSRNSV-ETKENEVDDQVLEQVA 726
               +S   +S+     N   D+V+EQ+A
Sbjct: 671 S---RSDGNDSLPPPPPNATQDKVVEQIA 696

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/642 (62%), Positives = 498/642 (77%), Gaps = 8/642 (1%)

Query: 101 KSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGF-- 158
           KS+ +  +I RL+ LA+ DWKLL +A+GLLT+S T+GM++PKVIG+VLD +KNA      
Sbjct: 69  KSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSED 128

Query: 159 ----SGPMTLE--DLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARL 212
               S  +++E  +LPPI +GL +++FL      L+ GT ANFGR+VLLRVL E++VARL
Sbjct: 129 AELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARL 188

Query: 213 RSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXX 272
           RS VIKK IHQDAEFFD NKVGDLISRL SDAYVVSRSMTQ VSDGFKA           
Sbjct: 189 RSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMM 248

Query: 273 XXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAF 332
              S  L++ L  F PP+++ ++ +G+ IR  SR+LQE+TG LT+VSEEQ SGVKT+QAF
Sbjct: 249 VSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAF 308

Query: 333 VAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLS 392
           VAE +E+ RYNN I+ V++ GK+ A  NA  F+ T  LGD+SFL+VLAYGS+LVL GGLS
Sbjct: 309 VAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLS 368

Query: 393 VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSW 452
           +GDLTA+M+YTE TGSAVFGLS+FYSE+M+G GAASRLFE+TD    I P++GK Y+P  
Sbjct: 369 IGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGK 428

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
           GEI+F++VSF+YPTRPG+QIF  LNF IEPGSNVC+VGPSGRGKSTIASLLL+YY P +G
Sbjct: 429 GEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAG 488

Query: 513 RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCF 572
            I +DGQ+ISKL+ KSLRRH+G+VQQEP+LMSGSIR N+TYG+  E T +EIR V K+CF
Sbjct: 489 TITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCF 548

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632
           CH FITKFP+ Y+T++GP G  LSGGQKQRIAIARAL+KKP +LILDEATSALDVESE A
Sbjct: 549 CHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESA 608

Query: 633 INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
           INYT G+LM+ +E+TIISIAHRLSTIRRSE VIVLGNDGSVVE+GKFK L+ N  SEL +
Sbjct: 609 INYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQ 668

Query: 693 LLNDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQK 734
           LLN+K     ++ +    ET E E       +   D  L+++
Sbjct: 669 LLNEKSTINERNPNEKPAETPEQESQKNAANESIVDVVLEEE 710

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/614 (64%), Positives = 489/614 (79%), Gaps = 8/614 (1%)

Query: 92  KANNESTEEKSKT-----NYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGI 146
           K + +  EE+S+T      +R+I+RL+ L R DWKLL  A+GLLTIS ++GMTIPKVIG+
Sbjct: 98  KYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGL 157

Query: 147 VLDAVKNASGGFS---GPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRV 203
           +LD +KNA    S    P++++ LPPI++GL  ++FL  FA  L+ G  AN+GRI+LLRV
Sbjct: 158 ILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRV 217

Query: 204 LGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXX 263
           L E+LVARLR+ VIKK IHQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDGFKA  
Sbjct: 218 LSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI 277

Query: 264 XXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQL 323
                       S  L+  L +F PP+++ A ++GK+I   SRELQE+TG+LTKV+EEQL
Sbjct: 278 CGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQL 337

Query: 324 SGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGS 383
           SG+KT+Q+FVAE +E++RYN AIR +F+ GKK A+ NA FFSST  +GDLSFL VL +GS
Sbjct: 338 SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGS 397

Query: 384 HLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPS 443
           +LVLQ  L++GDLTAFM+YTEYTG+++FGLS FYSE+M+GAGAASRLFE+TD    I  +
Sbjct: 398 YLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTT 457

Query: 444 SGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL 503
            G  Y P  GEI+F++VSF+YPTRP N IF  LNF IE GSNVC+VGPSGRGKST+A LL
Sbjct: 458 KGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLL 517

Query: 504 LRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDE 563
            +YY P+SG I+IDGQNI+ L+ KSLRRH+G+VQQEP+LMSG+IR N+ YG+    T DE
Sbjct: 518 EKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE 577

Query: 564 IRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATS 623
           IR VAK+CFCH FIT+F   Y+TVIGP G  LSGGQKQRIAIARALIKKP+ILILDEATS
Sbjct: 578 IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATS 637

Query: 624 ALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
           ALDVESEGAINYT G+LM+ +E+TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKEL+
Sbjct: 638 ALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW 697

Query: 684 ANDQSELFKLLNDK 697
            +  SEL +LLN+K
Sbjct: 698 DDPTSELSQLLNEK 711

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/615 (63%), Positives = 493/615 (80%), Gaps = 6/615 (0%)

Query: 108 EILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGP-MTLED 166
           ++ RL RLA+ DWKLL  AI LL++S  +GM++PK+IGIVLD +K      S P  T++D
Sbjct: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQI---MSNPDFTVDD 157

Query: 167 LPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAE 226
           +P I +GL +++F+++    L+ GT AN+GR++LLRVL E++VARLR+NVIKK +HQDAE
Sbjct: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217

Query: 227 FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF 286
           FFD NKVGDLISRLSSDAYVVSRS+TQ VSDGFKA              S  L++ L   
Sbjct: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277

Query: 287 APPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346
            PP+++ A  +G+ IR  SR+LQE+TG+LTKV+EEQ SG+KT+Q+FVAE KE+ RYN+AI
Sbjct: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337

Query: 347 RKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYT 406
           R +F+ GK+ A  NA FFS T +LGD+SFL+VLAYGS+LVL G LS+GDLTA+M+YTEYT
Sbjct: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397

Query: 407 GSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPT 466
           GS++FGLS FYSE+M+GAGAASRLFE+TD    I P+ GK +VP+ GEI+F++VSFSYPT
Sbjct: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457

Query: 467 RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC 526
           R  NQIF  L+F I+ GSNVC+VGPSGRGKSTIASLLLRYY+P +G+I +DGQ+ISK+S 
Sbjct: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517

Query: 527 KSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYET 586
           KSLRRH+ +VQQEP+LMSG+IR N+TYG+  + T DE+RS+ KKCFCH FITKFP  Y+T
Sbjct: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
           ++GP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LM+S+ +
Sbjct: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637

Query: 647 TIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQS 706
           TIISIAHRLSTIRRSENVIVLGNDGSV E+GKFKELYA+  SEL KLL++K     + Q 
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ- 696

Query: 707 RNSVETKENEVDDQV 721
            N+ E +E + ++ +
Sbjct: 697 -NTAEDQEIDPEETI 710

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/628 (65%), Positives = 489/628 (77%), Gaps = 9/628 (1%)

Query: 91  GKANNESTEEKSKTN-YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLD 149
           G A +   +E+SKT+ Y++I+RL  LA+ DWKLL  AI LLTIS ++GM+IPKVIGIVLD
Sbjct: 86  GSARSAHAKEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLD 145

Query: 150 AVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLV 209
            +K +SG         DL   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++V
Sbjct: 146 TLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVV 200

Query: 210 ARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXX 269
           ARLR+NVIKK +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA        
Sbjct: 201 ARLRANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGV 260

Query: 270 XXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTI 329
                 S  L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+
Sbjct: 261 GMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTV 320

Query: 330 QAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQG 389
           Q+FVAEG EL RYN AIR +F  GK  A TNA FF++T +LGDLSFL VLAYGS+LVLQ 
Sbjct: 321 QSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQS 380

Query: 390 GLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYV 449
            LS+GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P+ G  Y 
Sbjct: 381 QLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYK 440

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P  G I+F+DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P
Sbjct: 441 PDRGVIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNP 500

Query: 510 NSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
            +G I ID Q+ISKL+CKSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK
Sbjct: 501 TTGTITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAK 560

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
           +CFCH FITKFP  Y+TVIGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVES
Sbjct: 561 QCFCHNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVES 620

Query: 630 EGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSE 689
           EGAINYT G+LM+S+ +TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYAN  S 
Sbjct: 621 EGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSA 680

Query: 690 LFKLLNDKK---PTQLQSQSRNSVETKE 714
           L +LLN+K    P+  Q Q    +E ++
Sbjct: 681 LSQLLNEKAAPGPSDQQLQIEKVIEKED 708

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/635 (64%), Positives = 488/635 (76%), Gaps = 11/635 (1%)

Query: 96  ESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNAS 155
            STE+    +Y++I+RL  LA+ DWKLL  AI LLTIS ++GM+IPKVIGIVLD +K +S
Sbjct: 92  HSTEQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSS 151

Query: 156 GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN 215
           G         DL   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++VARLR++
Sbjct: 152 GS-----DFFDLKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAH 206

Query: 216 VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 275
           VIKK +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA              
Sbjct: 207 VIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSL 266

Query: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
           S  L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+Q+FVAE
Sbjct: 267 SPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAE 326

Query: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395
           G EL RYN AIR +F  GK  A TNA FF++T +LGDLSFL VLAYGS+LVLQ  LS+GD
Sbjct: 327 GNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGD 386

Query: 396 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEI 455
           LTAFMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P+ G  Y P  G I
Sbjct: 387 LTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVI 446

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
           +F+DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P +G IM
Sbjct: 447 EFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIM 506

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575
           ID Q+I+KL+CKSLRR +G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH 
Sbjct: 507 IDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHN 566

Query: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
           FITKFP  Y+TVIGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINY
Sbjct: 567 FITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINY 626

Query: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           T G+LM+S+ +TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKELYAN  S L +LLN
Sbjct: 627 TFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLN 686

Query: 696 DKK---PTQLQSQSRNSVE---TKENEVDDQVLEQ 724
           ++    P+  Q Q     E   T E E  DQ  +Q
Sbjct: 687 ERAAPGPSDQQLQIEKVEEKEDTNEGEKHDQQNKQ 721

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/729 (58%), Positives = 529/729 (72%), Gaps = 24/729 (3%)

Query: 14  RLPLGVQLLSWRRGLSGVQAFIHLSPARYHG-----ATHR-PLG-LLQRPTQLDLRNPVS 66
           RLPL  +L  +R  LS  +  + L P R+       ++H  P+  L  RP  +     + 
Sbjct: 5   RLPL-FRLGVYRNVLSRSR-LVKLPPIRFRSLATTSSSHLIPIHHLCTRPAPIS--KSLL 60

Query: 67  SSFIRYHXXXXXXXXXXXXXXXXGGKANNESTEEKSKTNYREILRLIRLARHDWKLLSVA 126
           S F+R++                  +    + + KS  +Y++I+RL  LA+ DWKLL  A
Sbjct: 61  SQFVRFNSTKTQQDIPPLPSTSASKQPAKPAYQSKSD-DYKDIIRLFMLAKRDWKLLLTA 119

Query: 127 IGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGI 186
           I LLTIS ++GM+IPKVIGIVLD +K +SG         DL   I+ L +++FL+ F   
Sbjct: 120 ILLLTISCSIGMSIPKVIGIVLDTLKTSSGS-----DFFDLKIPIFSLPLYEFLSFFTVA 174

Query: 187 LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYV 246
           L+ G +ANFGR +LLR+L E++VARLR++VIKK +HQDAEFFD +KVGDLISRL SDAYV
Sbjct: 175 LLIGCVANFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYV 234

Query: 247 VSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISR 306
           VSRSMTQ VSDG KA              S  L+  L  F PP+L  A ++GK+IR  S+
Sbjct: 235 VSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSK 294

Query: 307 ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS 366
           +LQE+TG LT+V+EEQLSG+KT+Q+FVAEG EL RYN AIR +F  GK  A TNA FF++
Sbjct: 295 DLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTT 354

Query: 367 TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426
           T +LGDLSFL VLAYGS+LVLQ  LS+GDLTAFMLYTEYTG+AVFGLS FYSE+M+GAGA
Sbjct: 355 TSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGA 414

Query: 427 ASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNV 486
           ASRLFE+TD    I P+ G  Y P  G I+F+DVSFSYPTRP  QIF  LNF I PGS+V
Sbjct: 415 ASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSV 474

Query: 487 CVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGS 546
           C+VGPSGRGKSTIA LLLRYY+P +G IMID Q+I+K++CKSLRRH+G+VQQEP+LMSG+
Sbjct: 475 CIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGT 534

Query: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
           IR N+TYG+    T +EIRSVAK+CFCH FITKFP  Y+TVIGP G  LSGGQKQRIAIA
Sbjct: 535 IRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIA 594

Query: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
           RALIKKP +LILDEATSALDVESEGAINYT G+LM+S+ +TI+SIAHRLSTIRRSENVIV
Sbjct: 595 RALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIV 654

Query: 667 LGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQVLEQVA 726
           LG+DGSVVEMGKFKELY+N  S L +LLN++    + S+ +  VE K+NE      E+  
Sbjct: 655 LGHDGSVVEMGKFKELYSNPTSALSQLLNERT-APVPSEQQQQVE-KDNEK-----EEPN 707

Query: 727 NDFNLDQKS 735
            D N DQ++
Sbjct: 708 EDENHDQRN 716

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/618 (65%), Positives = 485/618 (78%), Gaps = 6/618 (0%)

Query: 100 EKSKTN-YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGF 158
           ++SKT+ Y++I+RL  LA+ DWKLL  AI LLTIS ++GM+IPKVIGIVLD +K +SG  
Sbjct: 95  QRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGS- 153

Query: 159 SGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK 218
                  +L   I+ L +++FL+ F   L+ G  ANFGR +LLR+L E++VARLR++VIK
Sbjct: 154 ----DFFELKIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209

Query: 219 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSAS 278
           K +HQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDG KA              S  
Sbjct: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269

Query: 279 LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338
           L+  L  F PP+L  A ++GK+IR  S++LQE+TG LT+V+EEQLSG+KT+Q+FVAEG E
Sbjct: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329

Query: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398
           L RYN AIR +F  GK  A TNA FF++T +LGDLSFL VLAYGS+LVLQ  LS+GDLTA
Sbjct: 330 LSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389

Query: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFE 458
           FMLYTEYTG+AVFGLS FYSE+M+GAGAASRLFE+TD    I P++G  Y P  G ++F+
Sbjct: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFK 449

Query: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
           DVSFSYPTRP  QIF  LNF I PGS+VC+VGPSGRGKSTIA LLLRYY+P++G IMID 
Sbjct: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDD 509

Query: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578
           Q+I+K++CKSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FIT
Sbjct: 510 QDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569

Query: 579 KFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638
           KFP  Y+TVIG RG  LSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G
Sbjct: 570 KFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629

Query: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698
            LM+S+ +TIISIAHRLSTIRRSENVIVLG+DGSVVEMGKFK+LYAN  S L +LLN++ 
Sbjct: 630 HLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERA 689

Query: 699 PTQLQSQSRNSVETKENE 716
                 Q +   +  ENE
Sbjct: 690 APGPSDQQQQIEKDNENE 707

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/656 (61%), Positives = 501/656 (76%), Gaps = 19/656 (2%)

Query: 92  KANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV 151
           K N     E  K    E+ RL+ +   DWKLL +AI LLTIS ++GM IPKVIG+VLDA+
Sbjct: 131 KTNYSPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDAL 190

Query: 152 KNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR 211
           KN        +   DLPPI +GL ++ FL  FAG LV GT+ N+GR +LLR+L E++VAR
Sbjct: 191 KNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVAR 250

Query: 212 LRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXX 271
           LRS+VIKK +HQDAEFFD+NKVGDLISRL SDAYVVSRS+TQ VSDGFKA          
Sbjct: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGM 310

Query: 272 XXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQA 331
               S  L+S L +FAP +++ A I+GKKIR IS  LQE+TG LT+VSEEQL+GVKT+Q+
Sbjct: 311 MISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQS 370

Query: 332 FVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGL 391
           FVAE KE+ RYNNAIR +++ GK  A+ N+ F +ST ++GD+SFL+VLAYGS+LVL G L
Sbjct: 371 FVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL 430

Query: 392 SVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS 451
           ++GDLTAFMLYT+YT +++FGLSNFYSE+M+G GAA RLF++TD    I+P+ G+ ++P 
Sbjct: 431 TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPG 490

Query: 452 WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            G I+F ++ F+YPTRP NQ+F  LNF IEPG++VC+VGPSGRGKSTIA LLLRYY+P+S
Sbjct: 491 DGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSS 550

Query: 512 GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
           G+I+ID Q+I KL+ KSLR+++G+VQQEP+LMSGSIR N+TYG+  E T DEIR V+K+C
Sbjct: 551 GQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610

Query: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
           FCH FITKFP+ YET+IGP G  LSGGQKQRIAIARALIKKPKILILDEATSALDVESEG
Sbjct: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670

Query: 632 AINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
           AINYT G+LM+S+ +TI+SIAHRLSTIRRSE +IVLGNDGSVVE GKFKELYA+  SEL 
Sbjct: 671 AINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELS 730

Query: 692 KLLNDKK--------PTQLQSQSRN-----------SVETKENEVDDQVLEQVAND 728
           KLLN+K+        P   QS   N           S  +  N +   VL++V++D
Sbjct: 731 KLLNEKQSRANKKEAPLPPQSDGENGDDFEGNGTPASPPSLHNNLVTDVLKEVSDD 786

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/623 (61%), Positives = 491/623 (78%), Gaps = 17/623 (2%)

Query: 95  NESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNA 154
           NE   ++ ++N++++ RL  L + D+KLL V++ LLTIS T+GM IPK+IG++LDA+K+ 
Sbjct: 149 NEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSV 208

Query: 155 S----GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVA 210
           +    GG S P      P I++GL +++FL  F+  L  G  AN+GR++LLR+L E+LVA
Sbjct: 209 ATTPDGGSSPP------PTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVA 262

Query: 211 RLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 270
           RLRS V+K  +HQD+EFFD +KVGDLISRL +D+Y+VSRS+TQ +SDG K+         
Sbjct: 263 RLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIG 322

Query: 271 XXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQ 330
                S  L+S L  F  P+++ A I+GK+IR+ SRELQ++TG LT+VSEEQL+GV+T+Q
Sbjct: 323 MMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQ 382

Query: 331 AFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGG 390
           +FVAE +E+ R+N++IR++F  GK+ A  NA FF+ST ++GDLSFL VL YGS+LVL G 
Sbjct: 383 SFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGS 442

Query: 391 LSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP 450
           L++GDLTAFMLYTEYTG+A+FGLS FYSE+M+GAGAASRLFE+TD    I+P+ GK Y P
Sbjct: 443 LTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTP 502

Query: 451 SWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
             GEI+F++VSF+YPTRP NQIF  LNF I+PGSNVC+VGPSG+GKSTIA LLL YY+P 
Sbjct: 503 GKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPT 562

Query: 511 SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
           SG+I+IDGQ+I+KL+ KSLRR + VVQQEP+LMSG+IR N+TYG+  E T +EIR+VAK+
Sbjct: 563 SGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQ 622

Query: 571 CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 630
           CFCH FI KFP  Y+T IGP G  LSGGQKQRIAIARALIKKP ILILDEATSALDVESE
Sbjct: 623 CFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESE 682

Query: 631 GAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSEL 690
           GAINYT G+LM+S+ +TI+SIAHRLSTIRRSEN+IVLGNDGSVVEMGKFKEL+A+  SEL
Sbjct: 683 GAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSEL 742

Query: 691 FKLLNDKKPTQLQSQSRNSVETK 713
            KLLN+K        SR  V TK
Sbjct: 743 SKLLNEK-------SSRKKVVTK 758

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/666 (59%), Positives = 506/666 (75%), Gaps = 25/666 (3%)

Query: 92  KANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV 151
           + N  ST E+ K+N+ +++RL  L + DWKLL VA+ LLTIS  +GM IPKVIGI+LD++
Sbjct: 110 QGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSL 169

Query: 152 K----NASGGFSGPMTLEDLPPII-YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGE 206
           K      S G   P      PPI+ +GL +++FL  F+  L+ G +ANFGR++LLR+L E
Sbjct: 170 KVQTATQSEGEEAP------PPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSE 223

Query: 207 KLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXX 266
           +LVARLRS VIK+ IHQDA+F+D +K GDLISRL +DAY+VSRS+TQ +SDGFK+     
Sbjct: 224 RLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGG 283

Query: 267 XXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGV 326
                    S  L++ L +   P+++ A I+GK+IR+ SRELQ++TG LT+VSEEQL+GV
Sbjct: 284 VGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGV 343

Query: 327 KTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLV 386
           KT+Q+FVAE +E+ R+N AIR +F  GK+ A  NA FF+ST ++GDLSFL VL YGS+LV
Sbjct: 344 KTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLV 403

Query: 387 LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK 446
           L G L++GDLTAFMLYTEYTG+++FGLS FYSE+M+GAGAASRLFE+TD+  +I+P+ GK
Sbjct: 404 LHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGK 463

Query: 447 PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRY 506
            Y+P  GEI+F++VSFSYPTRP NQIF  LNF IEPGSNVC+VGPSG+GKSTIA LLL Y
Sbjct: 464 TYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHY 523

Query: 507 YDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
           Y+P SG+I+IDGQ+I+K++ KSLRR LG+VQQEP+LMSGSIR N+TYG+    T +EIR 
Sbjct: 524 YNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRK 583

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           VAK+CFCH FITKFP  Y+T IGP G  LSGGQKQRIAIARALIKKP ILILDEATSALD
Sbjct: 584 VAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALD 643

Query: 627 VESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAND 686
           VESEGAINYT G+LM+++ +TI+SIAHRLSTIRRSENVIVLGNDGSV+EMGKFKEL+++ 
Sbjct: 644 VESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDP 703

Query: 687 QSELFKLLNDKK-------------PTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQ 733
            SEL KLLN+K              P      +   VE  +  ++D  L  V ND   + 
Sbjct: 704 SSELSKLLNEKSSRKKTKSDPISSAPEVDADATGEPVEPIDPAIED-ALHSVLNDVTSES 762

Query: 734 KSSKLT 739
           K  K++
Sbjct: 763 KPIKMS 768

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/660 (57%), Positives = 481/660 (72%), Gaps = 18/660 (2%)

Query: 41  RYHGATHRPLGLLQRPTQLDLRNPVSSSFIRYHXXXXXXXXXXXXXXXXGGKANNESTEE 100
           R+   +H  +  ++ P     R+P+    + Y                   K  +E T  
Sbjct: 30  RFRAGSHLNVNRVRTPLHFVKRSPLIPRRVLYSTDVTPKEPEKQPAVVVHPKPEDEGT-- 87

Query: 101 KSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGG-FS 159
                Y++I RL  L + DWKLL  A+ LLT+S  +GM IPKVIG VLD++K+  G  FS
Sbjct: 88  -----YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQGKEFS 142

Query: 160 GPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKK 219
             M        I+ + +  F    +G+L+ G  AN+ R++LLR+L E LVA+LR+NVIK 
Sbjct: 143 ELM--------IWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKH 194

Query: 220 IIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASL 279
           IIHQDA+FFD  KVGDLISR+ +DA++VSRS+TQ +SDG KA              S  L
Sbjct: 195 IIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPL 254

Query: 280 T-SALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338
           + S L L   PLL+ A ++GK+IR  S++LQE T NLT+VSEEQ +G+KTIQ+FVAE  E
Sbjct: 255 SCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSE 314

Query: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398
           +H++N +IRK+F+ GK+ A  NA FF++  I+GDLSFL+VL+YGS LV Q  LSVGDLTA
Sbjct: 315 MHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTA 374

Query: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS-WGEIKF 457
           FMLYTEYTG+A+F LS F+SE+M+GAGAASR+FE+TD   +I P+ G  ++P+  GEI+F
Sbjct: 375 FMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEF 434

Query: 458 EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
           ++VSF+YPTRP   IF  LNF IE GSNVC+VGPSG+GKSTIA LLL YY+P+ G+I+ID
Sbjct: 435 KNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILID 494

Query: 518 GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577
           GQ+IS LS KSLRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FI
Sbjct: 495 GQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFI 554

Query: 578 TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
           T+FP+ Y+T IGP G  LSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYT 
Sbjct: 555 TRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTF 614

Query: 638 GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
           G+LM+S+ +TI+SIAHRLSTIRRSENVIVLGNDGSVVE GKFKEL+AN  SEL KLL +K
Sbjct: 615 GQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREK 674

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/605 (58%), Positives = 456/605 (75%), Gaps = 12/605 (1%)

Query: 104 TNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMT 163
           +++R++ RL  L + D KLL +AI LLTIS ++GM IPK+IG +LD ++N     +    
Sbjct: 81  SSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYENLTSLSQ 140

Query: 164 LEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQ 223
           ++     I  + +  FL      L+FG  ANFGR+V+LR++ E+LV+RLRS V+K IIH+
Sbjct: 141 IK-----ILNIPLSTFLMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVKNIIHK 195

Query: 224 DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSAL 283
           D EFFD  KVGDL+SR+ +DA+VVSRS+T  V+DG ++              S  LT AL
Sbjct: 196 DLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRELTGAL 255

Query: 284 FLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
           F   PP++    ++GK+IRM S++LQ+ TG+LT+V+EEQ +G++T+Q FVAE  E+ R+N
Sbjct: 256 FAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNEIKRFN 315

Query: 344 NAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYT 403
           N +R++F  GK+ A  N  FF+S  ++GDL FLIVL YGS+LV+ G +S+GDLTAFMLYT
Sbjct: 316 NVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTAFMLYT 375

Query: 404 EYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG----KPYVPSWG-EIKFE 458
           EYTG+A+FGLS+FYSELM+G GAASR+FE+ D   +IK ++G    KP     G EI+F+
Sbjct: 376 EYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGCEIEFK 435

Query: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
           +VSF YPTRP NQIF  LNF +  GSNVC+VGPSGRGKSTIASLLL +Y+  SG+I+IDG
Sbjct: 436 NVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQILIDG 495

Query: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578
           Q+I+ L+ KSLRR +G+VQQEP+LMSG+IR N+TYG+  E + +EIR VAK+CFCH FIT
Sbjct: 496 QDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFCHNFIT 555

Query: 579 KFPEGYE--TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 636
           KFP+ Y+     G  G SLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT
Sbjct: 556 KFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYT 615

Query: 637 LGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            G++M+S+ +TI+SIAHRLSTIRR E+VIVLGNDGSVVEMGKFKELY N  SEL KLLN+
Sbjct: 616 FGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELSKLLNE 675

Query: 697 KKPTQ 701
           K  T+
Sbjct: 676 KSSTK 680

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/611 (51%), Positives = 408/611 (66%), Gaps = 14/611 (2%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           S+EE + T ++++ RL  LA+ +   + +A+ L+ ISSTV M +P VIG +LD   N S 
Sbjct: 84  SSEESTNTGFKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSN 143

Query: 157 GFSGPM-------TLEDLPP-IIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKL 208
             +G           ED     IYG     F A    + V G IAN GRIV+L+V GEKL
Sbjct: 144 DDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKL 203

Query: 209 VARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXX 268
           VARLR+  +K  + QDA F D N+VGDLISRLSSDA +V++S+T NVSDG +A       
Sbjct: 204 VARLRTRTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVG 263

Query: 269 XXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKT 328
                  S  LTS + L  PPL + AL+YGKKIR +SR+LQ + G LTKV+EEQL+  KT
Sbjct: 264 FSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKT 323

Query: 329 IQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ 388
           IQA+  E KE+ RY + +R VF  G KEA+T+  FF STG++G+ + L +L  G++++  
Sbjct: 324 IQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISS 383

Query: 389 GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY 448
           G L+VGDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    IKP+ GK  
Sbjct: 384 GSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDP 443

Query: 449 VPSWGE-IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
           V   G+ I F+DVSF YPTRP +++FNK++F IEPG ++C VGPSG GKST++ LLLRYY
Sbjct: 444 VTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYY 503

Query: 508 DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVT--MDEIR 565
           D   G I+I   NI  LS +  R+ LGVVQQEPML +G+I  N+ Y +  E+    +++ 
Sbjct: 504 DATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVD 563

Query: 566 SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSAL 625
              KK  C  F+  FP+G  T++GPRG  LSGGQKQRIAIAR+ +  P IL+LDEATSAL
Sbjct: 564 LAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSAL 623

Query: 626 DVESEGAINYTLGRLMRSRE-LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYA 684
           D +SE  I  TL +  R  E LT ISIAHRLSTI+ S  V+VL  +GSVVE GKF EL A
Sbjct: 624 DTQSEDIIAMTLKK--REAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIA 681

Query: 685 NDQSELFKLLN 695
           N  SEL  LL+
Sbjct: 682 NPTSELNLLLS 692

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/605 (49%), Positives = 407/605 (67%), Gaps = 6/605 (0%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           S  + + + +++I RL RLA+ +   +++A+ L+ ISS V MTIP ++G +LD  K+   
Sbjct: 81  SPSDLNGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKDRKD 140

Query: 157 GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNV 216
                   E   P I+G+    F      + + G  AN GRIV+L++ GE+LVARLR+  
Sbjct: 141 ADDTTEDDEG--PKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRT 198

Query: 217 IKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS 276
           +K  + QDA F D N+VGDLIS LSSDA +V++S+TQNVSDG +A              S
Sbjct: 199 MKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYIS 258

Query: 277 ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEG 336
             LTS + L  PPL + A++YG+KIR +SR+LQ S G LTKVSEEQL  VKTIQ++V E 
Sbjct: 259 WQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEK 318

Query: 337 KELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
           KE+HRY   +R VF+ G KEALT+  FF STG++G++S L +L  G++++  G ++VGDL
Sbjct: 319 KEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDL 378

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK-PYVPSWGEI 455
           ++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I P+ G+ P   +   I
Sbjct: 379 SSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTI 438

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
           +FE+VSF+YPTR   +IF+ L+ T+EPG +VC+VGPSG GKST+ASLLLRYYD N GRIM
Sbjct: 439 RFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIM 498

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVT--MDEIRSVAKKCFC 573
           I   NI+  + +  RR LG+VQQEP L +G+I  N+ Y +  E     D I +   +  C
Sbjct: 499 IGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANC 558

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
             F+  FP+G +T++GPRGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 559 SKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIV 618

Query: 634 NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
             TL R+   R LT ISIAHRLSTI+    V+VLG  G VVE G F+EL  N  SEL  L
Sbjct: 619 AQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSIL 677

Query: 694 LNDKK 698
           L+ ++
Sbjct: 678 LSQQQ 682

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/654 (47%), Positives = 410/654 (62%), Gaps = 13/654 (1%)

Query: 49  PLGLLQRPTQLDLRNPV----SSSFIRYHXXXXXXXXXXXXXXXXGGKANNESTEEKSKT 104
           P  +L+ P  L  R+P+    S SF R                    K    S  +   +
Sbjct: 22  PSTILRYPINLGKRSPLISFQSRSFARCSIALQAAKKQGKPSLTATVKGLRLSPHDSKAS 81

Query: 105 NYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTL 164
            +++I RL  LA+ + + + +A+ L+ +SS V M +P VIG +LD  +        P T 
Sbjct: 82  GWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEH---EQPETE 138

Query: 165 EDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQD 224
           ++   +I+GL    F     G+ V G +AN GRIV+L+V GE+LVARLR+  +K  + QD
Sbjct: 139 KET--MIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALEQD 196

Query: 225 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALF 284
           A F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A              S  LT  + 
Sbjct: 197 ATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCVMM 256

Query: 285 LFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNN 344
           L APPL V AL+YGK+IR +SR+LQ S G LTKVSEEQLS  KTIQA+  E KE+HRY +
Sbjct: 257 LLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRYAD 316

Query: 345 AIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTE 404
            +RKVF  G KEALT+  FF  TG +G+++ L +L  G+ ++  G ++VGDL++FM+Y  
Sbjct: 317 EVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMYAV 376

Query: 405 YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK-PYVPSWGEIKFEDVSFS 463
           YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I P+ GK P       I F  V FS
Sbjct: 377 YTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVKFS 436

Query: 464 YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
           YPTRP + IF  LNFT+ PG +VC+VGPSG GKST+ASLLLRYYD  SG I +   NI  
Sbjct: 437 YPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNIRD 496

Query: 524 LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFCHGFITKFP 581
            + +  RR LGVVQQEPML SG+I  N+TY +  E+  DE R      +  C  F+  FP
Sbjct: 497 FNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLANFP 556

Query: 582 EGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
           +G +T +GPRG  LSGGQKQRIA+ARA +  P ILILDEATSALD +SE  +  +L +  
Sbjct: 557 DGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ-R 615

Query: 642 RSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            +R  T ISIAHR+STI+ S  VIVL   G+V E G F +L A   S L KLL+
Sbjct: 616 SARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLS 669

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/641 (48%), Positives = 409/641 (63%), Gaps = 24/641 (3%)

Query: 91  GKANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDA 150
           G+    S+ EK+ + +R+I RL+ LAR +   +  A+ L+ ISSTV M +P VIG +LD 
Sbjct: 75  GQIAELSSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDL 134

Query: 151 VKNAS--------GGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLR 202
            K++S         G       +     IYG     F  I  GI V G  AN GRI++L+
Sbjct: 135 AKSSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILK 194

Query: 203 VLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAX 262
           V GE+LVARLR+  +K  + QD+ F DRN+VGDLISRLSSD+ +V++S+TQNVSDG +A 
Sbjct: 195 VTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAV 254

Query: 263 XXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQ 322
                        S  LT  + L  PP+   A+IYGKKIR +S++LQ S G LTKV+EEQ
Sbjct: 255 IQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQ 314

Query: 323 LSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG 382
           L   KTIQ++V E KE+ RY   +R+VF  G KEALT+  FF STG +G++S L +L  G
Sbjct: 315 LGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSG 374

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKP 442
           + ++  G ++VGDL++FM+Y  YTG ++FGLSNFYSELMKGAGAA+R+FE+ D    I P
Sbjct: 375 ASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAP 434

Query: 443 SSGK-PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIAS 501
           + GK P       I F+DVSF+YPTR   +IFN LN TI+PG ++C+ GPSG GKSTIAS
Sbjct: 435 TLGKGPTSIRNLPISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIAS 494

Query: 502 LLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTM 561
           LL+RYYD + G I I   ++   + +  RR +GVV QEP+L +G+I  N+ Y +   V  
Sbjct: 495 LLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQ 554

Query: 562 DEIRSVAK--KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
           DE R  A   K  C  F++ FP+G ET++GPRGA LSGGQKQR+A+ARA +  P +L+LD
Sbjct: 555 DERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLD 614

Query: 620 EATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKF 679
           EATSALD +SE  +  TL   +R R LT ISIAHR+STI  S  V+VLG DG VVE G F
Sbjct: 615 EATSALDSQSEEIVARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPF 673

Query: 680 KELYANDQSELFKLL------------NDKKPTQLQSQSRN 708
           +EL     SEL  LL            N  +P ++Q  +RN
Sbjct: 674 QELIDRPNSELNYLLSLQQDEREEIKENPSEPREIQPNTRN 714

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/606 (49%), Positives = 408/606 (67%), Gaps = 7/606 (1%)

Query: 98  TEEKSKTN-YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           + E SK+N  ++I RL +LA+ + K + +A+  + ISS+V MTIP +IG +LD  K  + 
Sbjct: 84  SNEVSKSNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADND 143

Query: 157 GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNV 216
              G    +    +I+GL    F     G+ + G IAN  RIV+L+V GE+LVARLR+  
Sbjct: 144 DEDGDNNAKKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRT 203

Query: 217 IKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS 276
           +K  ++QDA F D N+VGDLISRLSSDA +V++++TQNVSDG +A              S
Sbjct: 204 MKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFIS 263

Query: 277 ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEG 336
             LT  + +  PPL V AL+YG+KIR +SR+LQ S G LTKV+EEQL+  +TIQA+  E 
Sbjct: 264 WKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEA 323

Query: 337 KELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
            E+HRY   +RKVF  G KEA+T+  FF STG++G+++ + +L  G+ ++  G L+VGDL
Sbjct: 324 LEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDL 383

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG-KPYVPSWGEI 455
           ++FM+Y  YTGS++FGLS FYSELMKGAGAA+R+FE+ D    IKP+ G  P       I
Sbjct: 384 SSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSI 443

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
           +F++VSF+YPTRP + I N L+ +I+PG +VC+VGPSG GKST++SLLLRYYD ++G I 
Sbjct: 444 EFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIK 503

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD----EIRSVAKKC 571
           IDGQNI + + +  RR LGVVQQEPML +G+I  N+ Y + S+ T+     +++   ++ 
Sbjct: 504 IDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQA 563

Query: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
            C  F+  FPEG  T++GPRG  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE 
Sbjct: 564 NCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEE 623

Query: 632 AINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
            +   L   +    LT ISIAHRLSTI+ S  VIVL   GSVVE G F+EL    +SEL 
Sbjct: 624 IVAKNLSERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELN 682

Query: 692 KLLNDK 697
            LL+ +
Sbjct: 683 MLLSQQ 688

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/610 (48%), Positives = 397/610 (65%), Gaps = 11/610 (1%)

Query: 99  EEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVK------ 152
           +E  ++ ++++ RL  LAR +   +S+A+ L+ ISS V M +P VIG +LD  K      
Sbjct: 90  DESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADE 149

Query: 153 -NASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR 211
            N  G        ED    IYGL    F      +   G +AN GRI++L+V GE+LVAR
Sbjct: 150 ENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVAR 209

Query: 212 LRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXX 271
           LR+  +K  + Q+A F D NKVGDLISRLS+DA +V++S+TQNVSDG +A          
Sbjct: 210 LRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGM 269

Query: 272 XXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQA 331
               S  LTS + L  PPL   A+IYG+KIR +SR+LQ S G LTKV+EEQL+  +TIQA
Sbjct: 270 MSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQA 329

Query: 332 FVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGL 391
           +  E KE+HRY   +R VF  G KEA+T+  FF STG++G+ + L +L  G++++  G L
Sbjct: 330 YGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGAL 389

Query: 392 SVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS 451
           +VG+L++FM+Y  YTGS++FGLS FYSELMKGAGAA+R+FE++D    IKP+ GK  +  
Sbjct: 390 TVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITL 449

Query: 452 WGE-IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
           +G+ ++F++VSF YPTRP  QIF   +  IEPG +VC VGPSG GKST++SLLLRYYD  
Sbjct: 450 FGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVA 509

Query: 511 SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD--EIRSVA 568
            G I++ G++I   S +  RR LGVVQQEPML +G+I  N+ Y +  E+  +   I    
Sbjct: 510 KGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAI 569

Query: 569 KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
           +   C  F+  FP+G  T++GPRG  LSGGQKQRIA+AR  +  P ILILDEATSALD +
Sbjct: 570 ESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQ 629

Query: 629 SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
           SE  I   L +    +  T ISIAHRLSTI+ S  V+VLG +G VVE G F+EL +N  S
Sbjct: 630 SEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSS 688

Query: 689 ELFKLLNDKK 698
            L  LL  ++
Sbjct: 689 GLNILLTQEE 698

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/608 (49%), Positives = 398/608 (65%), Gaps = 7/608 (1%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           S  +  +  ++ + RL +LAR + K L+ A+ L+ IS  V MTIP VIG +LD  K    
Sbjct: 71  SGADSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEA 130

Query: 157 GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNV 216
           G  G    E+    IYGL    F     G+ V G  AN GRIV+L+V GEKLVARLR+  
Sbjct: 131 GGDGD---EEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKT 187

Query: 217 IKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS 276
           +K  + QDA F D N+VGDLISRLSSDA +VS+S+TQN SDG +A              S
Sbjct: 188 MKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYIS 247

Query: 277 ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEG 336
           A LT  + L APPL++ A++YG++IR ++RELQ   G LTKV+EEQL+  +TIQ++  E 
Sbjct: 248 AQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGER 307

Query: 337 KELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
           KE+ RY   +R VF  G +EA+T+  FF +TG++G+++ L +L  G+ ++  G ++VG+L
Sbjct: 308 KEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGEL 367

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK-PYVPSWGEI 455
           ++FM+Y  YTGS++FGLS+FYSELMKGAGAASR+FE+ D    I P+ GK P   +  EI
Sbjct: 368 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEI 427

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
           +F++V FSYP+R  + +F +LN  I PG +VCVVGPSG GKSTI+SLLLR+YD +SG I 
Sbjct: 428 EFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVIT 487

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFC 573
           I GQNI   + +  RR LG+VQQEP+L +GSI+ N+ Y +   +  D+ R     +   C
Sbjct: 488 IGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANC 547

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
             FI+ FP+G +T++GPRG  LSGGQKQRIAIARA I  P ILILDEATSALD +SE  I
Sbjct: 548 TRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDII 607

Query: 634 NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
              L     S ++T ISIAHR+STI  S  VIVL  +G V E G F +L     S L KL
Sbjct: 608 AQALRARSESGKIT-ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKL 666

Query: 694 LNDKKPTQ 701
           L+ +   Q
Sbjct: 667 LSKEHELQ 674

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/628 (47%), Positives = 415/628 (66%), Gaps = 7/628 (1%)

Query: 100 EKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFS 159
           +   + +++I RL  LAR + + +++A+  + ISS+V MT+P +IG +LDA K       
Sbjct: 88  DSKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENE 147

Query: 160 GPMTLEDLPPI-IYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK 218
              +   +P I  +GL    F      + + G IAN GRI++L+V GE+LVARLR+  +K
Sbjct: 148 EEDSKTIVPDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMK 207

Query: 219 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSAS 278
             + QDA F D N+VGDLISRLSSDA +VS+++TQNVSDG +A              S  
Sbjct: 208 AALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWK 267

Query: 279 LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338
           LT  + L  PPL + AL+YG+KIR +S++LQES G L+KV+EEQL+  KTIQA+V E  E
Sbjct: 268 LTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLE 327

Query: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398
           +HRY   +R VF  G KEA+T+  FF STG++G+++ + +L  G++++  G L+VG+L++
Sbjct: 328 IHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSS 387

Query: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG-KPYVPSWGEIKF 457
           FM+Y  YTGS++FGLS+FYSELMKGAGAASR+FE+ D    IK + G  P       IKF
Sbjct: 388 FMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKF 447

Query: 458 EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
           E+VSF+YP+RP ++IF+ LN  I PG +VC+VG SG GKSTIASLLLRYYD N+G I I 
Sbjct: 448 ENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIG 507

Query: 518 GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDE----IRSVAKKCFC 573
             +I   S +  RR +G VQQEP L +GSI  N+ Y +  E+T ++    ++   K+  C
Sbjct: 508 DNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANC 567

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
           + F+ KFP+G +T++GPRGA LSGGQKQRIA+ARA +  P +LILDE+TSALD  SE  +
Sbjct: 568 NIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELV 627

Query: 634 NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
             TL +   +R LT ISIAHRLSTI+ S  VIV+G  GSVVE G F  L  N +SEL  L
Sbjct: 628 AKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNML 686

Query: 694 LNDKKPTQLQSQSRNSVETKENEVDDQV 721
           L+ +     +  S+   E +E  ++ +V
Sbjct: 687 LSQQNEHIDEDPSQEKQEPEEVTLEKRV 714

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/613 (49%), Positives = 402/613 (65%), Gaps = 16/613 (2%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVK---- 152
           S  +   + +++I RL  LA+ +   + +A+  + IS  V MTIP VIG +LDA K    
Sbjct: 93  SPHDSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHL 152

Query: 153 ---NASGGFSGPMTLEDLPP-----IIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVL 204
              +ASG   G     D        +IYGL    F      I V G  AN GRIVLL+V 
Sbjct: 153 AGVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVT 212

Query: 205 GEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 264
           GEKLVARLR+  +K  + QDA F D N+VGDLISRLSSDA +VS+S+TQN+SDG +A   
Sbjct: 213 GEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQ 272

Query: 265 XXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLS 324
                      S  LT  + L APPL V A++YGKKIR +SR+LQ S G LTKV+EEQLS
Sbjct: 273 GAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLS 332

Query: 325 GVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSH 384
             +T+QA+  E +E+ RY   +R VF+ G KEALT+  FF  TG +G+++ L +L  G+ 
Sbjct: 333 AARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTS 392

Query: 385 LVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSS 444
           ++  G ++VGDL++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I P+ 
Sbjct: 393 MIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTK 452

Query: 445 GKPYVPSWGE-IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL 503
           G   V   G+ I+F +V+F+YPTR  N+IF+ L+  I+PG +VC+VGPSG GKSTIASLL
Sbjct: 453 GVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLL 512

Query: 504 LRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDE 563
           LRYYD ++GRI I GQ+I + + +  RR LGVVQQEP+L +G+I  N+TY +  E+  D+
Sbjct: 513 LRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDD 572

Query: 564 IR--SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEA 621
            R      +  C  F+  FP+G ET++GPRGA +SGGQKQRIA+ARA +  P +LILDEA
Sbjct: 573 SRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEA 632

Query: 622 TSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
           TSALD +SE  +  +L R    R  T +SIAHRLSTI+ S  VIVL   G V E G F+E
Sbjct: 633 TSALDSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRE 691

Query: 682 LYANDQSELFKLL 694
           L ++  S L +LL
Sbjct: 692 LISDPDSHLTQLL 704

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/626 (47%), Positives = 410/626 (65%), Gaps = 12/626 (1%)

Query: 91  GKANNESTEEKSKTN-----YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIG 145
           GKA+ + T + S  N     +++I RL  L+R + K + +A+ L+ ISS+V M +P VIG
Sbjct: 66  GKASTKPTLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIG 125

Query: 146 IVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLG 205
            +LD    AS         +     +YGL    F      + V G +AN  RI++L++ G
Sbjct: 126 KLLDV---ASESDDEEDEEKARDSKLYGLTKKQFFTALGLVFVIGAVANASRIIILKITG 182

Query: 206 EKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXX 265
           E+LVARLR+  +K  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A    
Sbjct: 183 ERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQG 242

Query: 266 XXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSG 325
                     S  LT  + L APPL   AL+YGKKIR +SR+LQ S G LTKV+EEQL+ 
Sbjct: 243 FVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNA 302

Query: 326 VKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHL 385
            +TIQA+  E  E+HRY   +R VF  G KEA+T+  FF STG++G+ + L +L  G+++
Sbjct: 303 TRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNM 362

Query: 386 VLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG 445
           +  G +++G+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I P+ G
Sbjct: 363 IQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIG 422

Query: 446 K-PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL 504
           K P   +   + F++VSF+YPTRP +QIF  LN TI+PG +VC VGPSG GKSTIASLLL
Sbjct: 423 KDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLL 482

Query: 505 RYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVT--MD 562
           RYYD NSG I  D +++   + +  RR +G VQQEP+L +G+I  N+ Y + SE+    D
Sbjct: 483 RYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAERED 542

Query: 563 EIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
            +    ++  C  F+  FP+G +T++G RGA LSGGQKQRIA+ARA +  P +LILDEAT
Sbjct: 543 RVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEAT 602

Query: 623 SALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
           SALD +SE  +   L + +  R LT ISIAHRLSTI+ S  +IVLG  GSVVE G F++L
Sbjct: 603 SALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDL 661

Query: 683 YANDQSELFKLLNDKKPTQLQSQSRN 708
            A   SEL  LL ++   + + ++ N
Sbjct: 662 IAIPDSELNALLAEQHDEEGKEKTAN 687

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 399/616 (64%), Gaps = 13/616 (2%)

Query: 91  GKANNESTEEKSKTN-----YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIG 145
           GK + + T + S  N     +++I RL  L++ + K + +A+ L+ ISS+V M +P VIG
Sbjct: 66  GKKSTKPTLKLSNANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIG 125

Query: 146 IVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLG 205
            +LD    + G          L    YG     F      + + G +AN  RI++L+V G
Sbjct: 126 KLLDLASESDGEDEEGSKSNKL----YGFTKKQFFTALGAVFIIGAVANASRIIILKVTG 181

Query: 206 EKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXX 265
           E+LVARLR+  +K  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A    
Sbjct: 182 ERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQG 241

Query: 266 XXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSG 325
                     S  LT  + + APPL   ALIYG+KIR +SR+LQ S G LTKV+EEQL+ 
Sbjct: 242 FVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNA 301

Query: 326 VKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHL 385
            +TIQA+  E  E+ RY   +R VF  G KEA+T+  FF STG++G+ + L +L  G+ +
Sbjct: 302 TRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSM 361

Query: 386 VLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG 445
           +  G ++VG+L++FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I+P+ G
Sbjct: 362 IQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIG 421

Query: 446 K-PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL 504
           K P   +   I F++VSF+YPTRP +QIF  LN TI+PG +VC VGPSG GKSTIASLLL
Sbjct: 422 KDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLL 481

Query: 505 RYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTM--D 562
           RYYD NSG I    ++I   + +  RR +G VQQEP+L +G+I  N+ Y +  E+    D
Sbjct: 482 RYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDD 541

Query: 563 EIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
            IR    K  C  F+  FP+G +T++G RGA LSGGQKQRIA+ARA +  P +LILDEAT
Sbjct: 542 RIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEAT 601

Query: 623 SALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
           SALD +SE  +   L R +  R  T ISIAHRLSTI+ S  VIVLG  GSVVE G F++L
Sbjct: 602 SALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDL 660

Query: 683 YANDQSELFKLLNDKK 698
            A   SEL  LL +++
Sbjct: 661 IAIPNSELNALLAEQQ 676

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  530 bits (1365), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 285/605 (47%), Positives = 392/605 (64%), Gaps = 10/605 (1%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           ST   + +  +++ RL +LAR + K L  A+ L+ IS  V MTIP VIG +LD  +    
Sbjct: 73  STATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVE 132

Query: 157 GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNV 216
             SG    ++   ++YGL    F    +GI   G +AN GRIV+L+  GE+LVARLR+  
Sbjct: 133 QESG----DEEEAVLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRT 188

Query: 217 IKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS 276
           +K  + Q+  F D N+VGDLISRLSSDA +VS+S+TQN SDG +A              S
Sbjct: 189 MKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYIS 248

Query: 277 ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEG 336
             LT+ + L APPL++ A  YG+++R +SRELQ   G LTKV+EEQL+  +T+QA+  E 
Sbjct: 249 WQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGER 308

Query: 337 KELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
           +E+ RY   +R VF  G KEAL + +FF +TG +G+ + L +L  G+ ++  GG+SVG+L
Sbjct: 309 REIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGEL 368

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGE-I 455
           ++FM+Y  YTGS++F LS+FYSELMKGAGAA R+FE+ D    I P+ GK  V   G+ I
Sbjct: 369 SSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTI 428

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            F  V+F+YPTRP +Q+F  ++ +I PG +VC+VGPSG GKST+ASLLLR+YDP SG I 
Sbjct: 429 AFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSIT 488

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFC 573
           I G++I   +    RR +G+VQQEP+L + SI  N+TY +   +T D  R     +   C
Sbjct: 489 IGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNC 548

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
             F+  FPEG +T +GPRG  LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  +
Sbjct: 549 SAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIV 608

Query: 634 NYTLGRLMRSRELTI-ISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
             TL  L R +E  I ISIAHR STI+ S  VIVL   G V+E G +++L  +  S L  
Sbjct: 609 ASTL--LQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSG 666

Query: 693 LLNDK 697
           LL+ +
Sbjct: 667 LLSKE 671

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  531 bits (1367), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 296/623 (47%), Positives = 409/623 (65%), Gaps = 12/623 (1%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASG 156
           S  +   + +++I RL  L+R +   + +A+ L+ ISS+V M +P VIG +LD   +   
Sbjct: 76  SDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDD 135

Query: 157 GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNV 216
                 T ++    +YGL    F      + + G IAN  RI++L+V GE+LVARLR+  
Sbjct: 136 EEDAKETKDNK---LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRT 192

Query: 217 IKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS 276
           +K  + QDA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A              S
Sbjct: 193 MKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLS 252

Query: 277 ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEG 336
             LT  + + APPL   ALIYG+KIR +SR+LQ S G LTKV+EEQL+  +TIQA+  E 
Sbjct: 253 WKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEK 312

Query: 337 KELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
            E+ RY   +R VF  G KEA+T+  FF STG++G+ + L +L  G++++  G ++VG+L
Sbjct: 313 NEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGEL 372

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK-PYVPSWGEI 455
           T+FM+Y  YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I+P+ GK P   +   I
Sbjct: 373 TSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPI 432

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            F+DVSF+YPTRP +QIF  LN TI+PG +VC VGPSG GKSTIASLLLRYYD ++G I 
Sbjct: 433 VFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSID 492

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK---KCF 572
              ++I   + +  RR +G VQQEP+L +G+I  N+ Y +  E+   E R VA+   +  
Sbjct: 493 FGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDR-VARAIGQAN 551

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632
           C  F+  FP+G +T++G RGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  
Sbjct: 552 CTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEV 611

Query: 633 INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
           +   L R ++ R LT ISIAHRLSTI+ S  VIVLG  GSVVE G F++L +   SEL  
Sbjct: 612 VAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNA 670

Query: 693 LLNDKKPTQLQSQSRNSVETKEN 715
           LL +++  + + +   +V +K N
Sbjct: 671 LLAEQQDDEGKDE---TVTSKNN 690

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  530 bits (1366), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 290/598 (48%), Positives = 392/598 (65%), Gaps = 7/598 (1%)

Query: 104 TNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMT 163
           + +++I RL  L++ + K + +A+ L+ ISS+V M +P VIG +LD    AS        
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDL---ASETEDEEKE 140

Query: 164 LEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQ 223
            +     +YGL    F      + + G +AN  RI++L+V GE+LVARLR+  +K  + Q
Sbjct: 141 EKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALDQ 200

Query: 224 DAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSAL 283
           DA F D N+VGDLISRLSSDA +V++S+TQNVSDG +A              S  LT  +
Sbjct: 201 DATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVM 260

Query: 284 FLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
            + APPL   ALIYG+KIR +SR+LQ S G LTKV+EEQL+  +TIQA+  E  E+ RY 
Sbjct: 261 MVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYA 320

Query: 344 NAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYT 403
             +R VF  G KEA+T+  FF STG++G+ + L +L  G+ ++  G ++VG+L++FM+Y 
Sbjct: 321 KEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYA 380

Query: 404 EYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK-PYVPSWGEIKFEDVSF 462
            YTGS++FGLS+FYSELMKGAGAA+R+FE+ D    I+P+ GK P   +   I F++VSF
Sbjct: 381 VYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSF 440

Query: 463 SYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
           +YPTRP +QIF  LN TI PG +VC VGPSG GKSTIASLLLRYYD NSG I    ++I 
Sbjct: 441 TYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIR 500

Query: 523 KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVT--MDEIRSVAKKCFCHGFITKF 580
             + +  RR +G VQQEP+L +G+I  N+ Y +  E+    D I     +  C  F+  F
Sbjct: 501 SFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTKFLANF 560

Query: 581 PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640
           P+G +T +G RGA LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +   L R 
Sbjct: 561 PDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQRR 620

Query: 641 MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698
           +  R LT ISIAHRLSTI+ S  V+VLG  GSVVE G F++L A   SEL  LL +++
Sbjct: 621 VE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLAEQQ 677

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  531 bits (1368), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 294/626 (46%), Positives = 411/626 (65%), Gaps = 23/626 (3%)

Query: 97  STEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVK---- 152
           ++EE++ +++++I RL +LAR + K +  A+ L+ +SS+V M +P VIG ++D  K    
Sbjct: 75  TSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGT 134

Query: 153 --NASGGFSGPMTLE---------DLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLL 201
             + + G  G  T +         D   +I GL +  F      + V G  AN GRIV+L
Sbjct: 135 SSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVIL 194

Query: 202 RVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKA 261
           +V GEKLVARLR+  +K  + QDA F D NKVGDLISRLSSDA +VS+S+TQN+SDG ++
Sbjct: 195 KVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRS 254

Query: 262 XXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEE 321
                         S  LT  + L APPL V AL+YG+KIR +SR LQ S G LTK +EE
Sbjct: 255 LIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEE 314

Query: 322 QLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAY 381
           QLS  +TIQA+  E + +  Y   +R+V+  G KEALT+  FF  TG++G+ + L +L  
Sbjct: 315 QLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLT 374

Query: 382 GSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIK 441
           G+ ++  G ++VGDL++FM+Y  YTGS++FG+S+FYSELMKGAGAA+R+FE+ D    I 
Sbjct: 375 GTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIH 434

Query: 442 PSSGK-PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIA 500
           P+ G+ P   +   ++F+ V F+YPTR  + IF  L+  I+PG +VC+VGPSG GKST+A
Sbjct: 435 PTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVA 494

Query: 501 SLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVT 560
           SLLLR+YD ++G I+I GQNI+  + +  RR +G+VQQEPML +G+I  N+ Y +   + 
Sbjct: 495 SLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLL 554

Query: 561 MDEIRSVAK---KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
            +E   VA+   +  C  F++ FP+G +T++GPRG  LSGGQKQRIA+ARA +  P +LI
Sbjct: 555 NEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLI 614

Query: 618 LDEATSALDVESEGAINYTL-GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEM 676
           LDEATSALD  SE  I  TL  R  R +  T ISIAHR+STI+ S  VIVLG +G VVE 
Sbjct: 615 LDEATSALDSRSEEVIARTLHSRTTRGK--TTISIAHRVSTIQHSTRVIVLGRNGGVVET 672

Query: 677 GKFKELYANDQSELFKLL-NDKKPTQ 701
           G F EL +N  S+L KLL  +++P Q
Sbjct: 673 GTFDELASNTDSQLNKLLRKEEEPVQ 698

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  527 bits (1358), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 307/693 (44%), Positives = 428/693 (61%), Gaps = 46/693 (6%)

Query: 20  QLLSWRRGLSGVQAFIHLSPARYHGATHRPLGLLQRPTQLDLRNPVS----SSFIRYHXX 75
           Q+++ R  LS  +AF          ++ RPL L   P +     P+S    S  IR++  
Sbjct: 16  QIINLRSNLSYSKAF----------SSVRPLTLTTVPCKSAWVKPISLIHVSRQIRWNHA 65

Query: 76  XXXXXXXXXXXXXXGGKANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISST 135
                            ++  + EE + +++++I RL +LAR + + +  A+ L+ ISS+
Sbjct: 66  ESRQ------------PSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSS 113

Query: 136 VGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPI---------IYGLGMFDFLAIFAGI 186
           V M +P VIG ++DA K+          +E+             I+GL M  F  +   +
Sbjct: 114 VSMLVPGVIGKLMDAAKDDQ---QASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSV 170

Query: 187 LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYV 246
            V G  AN GRIV+L+V GEKLVARLR+  +K  + QDA F D NKVGDLISRLSSDA +
Sbjct: 171 FVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASI 230

Query: 247 VSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISR 306
           VS+S+TQN+SDG ++              S  LT  + L APPL   ALIYGK+IR +SR
Sbjct: 231 VSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSR 290

Query: 307 ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS 366
            LQ S G LTK +EEQLS  +TIQA+  E   +H+Y   +R+V+  G KEALT+  FF  
Sbjct: 291 TLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGL 350

Query: 367 TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426
           TG++G+++ L +L  G+ ++  G +++GDL++FM+Y  YTGS++FG+S+FYSELMKGAGA
Sbjct: 351 TGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGA 410

Query: 427 ASRLFEMTDHTSQIKPSSGKPYVPSWGE-IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSN 485
           A+R+FE+ D    I P+ G   V   G+ ++F++V F+YPTR  + IF  L F I  G +
Sbjct: 411 AARVFELNDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEH 470

Query: 486 VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG 545
           VC+VGPSG GKST+ASLLLR+YD ++G I I GQ+I+  + +  RR LGVVQQEPML +G
Sbjct: 471 VCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNG 530

Query: 546 SIRYNLTYGMNSEVTMDEIRSVAK---KCFCHGFITKFPEGYETVIGPRGASLSGGQKQR 602
           +I  N+ Y +   +  DE R VA+   +  C  F++ FP+G +T++GPRG  LSGGQKQR
Sbjct: 531 TILDNIVYSVPQSLLNDENR-VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQR 589

Query: 603 IAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSRELTIISIAHRLSTIRRS 661
           IA+ARA +  P +LILDEATSALD  SE  +   L  R  R +  T ISIAHR+STI+ S
Sbjct: 590 IALARAFLLDPDLLILDEATSALDSRSEEVVARALYSRSTRGK--TTISIAHRVSTIQHS 647

Query: 662 ENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
             VIVLG  G VVE G F EL ++  S+L  LL
Sbjct: 648 SRVIVLGRSGYVVETGTFDELISDPDSQLNLLL 680

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  514 bits (1323), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 279/601 (46%), Positives = 392/601 (65%), Gaps = 23/601 (3%)

Query: 98  TEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGG 157
           T+ K    + ++ +L+RLA+ + K ++ A+GL+ +SS V M++P VIG ++D        
Sbjct: 23  TDLKKTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHA------ 76

Query: 158 FSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI 217
            S P    D P  IYGL    FL     + V G IAN GRI++L++ GEKLVARLR+  +
Sbjct: 77  -STP----DAP--IYGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTM 129

Query: 218 KKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSA 277
           K ++ QDA F D+++VGDLISRLSSDA +VS+S+T N+SDG +A              S 
Sbjct: 130 KSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISL 189

Query: 278 SLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGK 337
            LT+ + +  PPL + A++YG KI+ ISR+LQ+  G L+K SEEQL+ +KT+QA+  E K
Sbjct: 190 KLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERK 249

Query: 338 ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLT 397
           EL RY+N +R VF+ G KEA+ +A FF STG++G+++ + +L  G+       +++G+L+
Sbjct: 250 ELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELS 306

Query: 398 AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG--KPYVPSWGEI 455
           +FM+Y  YTGS+VFGL+ FYSELMKG GAA R+ E+ +  ++I P+ G   P       I
Sbjct: 307 SFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPI 366

Query: 456 KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            F +VSF+Y    G  + +++NF I PG +VC VG SG GKSTI+SLLLRYY   SG I 
Sbjct: 367 TFNNVSFAYSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNIS 424

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575
           I   +IS  + +  RR LGVVQQEP+L +G+I  N+TYG++ + ++ ++    K   C  
Sbjct: 425 IGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDK-SLTDLNMALKAANCDQ 483

Query: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
           FI +   G +T++GPRGA LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN 
Sbjct: 484 FIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINK 543

Query: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            L R   +  +T ISIAHRLSTIR S  VIV+  DG VVE G F +L +   SEL KLL 
Sbjct: 544 ELQRRQEA-GMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLK 601

Query: 696 D 696
           +
Sbjct: 602 E 602

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  505 bits (1300), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 276/622 (44%), Positives = 396/622 (63%), Gaps = 21/622 (3%)

Query: 90  GGKANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLD 149
           G K+N+ +T+ K++    +I  L +LA+ +   +  ++GL+ I+S V M +P VIG +LD
Sbjct: 83  GTKSNSTNTKGKTR---EDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLD 139

Query: 150 ---AVKNASG-----------GFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANF 195
               ++ AS                    E+   +IYG     F +    I V G IAN 
Sbjct: 140 ISTGIEFASNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANT 199

Query: 196 GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV 255
           GRI++L++ GE++VARLR+  +K I+ QD +F D NKVGDLISRLSSD+ +VS ++T+NV
Sbjct: 200 GRIIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNV 259

Query: 256 SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
           SDG +A              S  L+  +    PP+ V A+IYG+KIR IS++LQES G+L
Sbjct: 260 SDGARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSL 319

Query: 316 TKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF 375
           TK+SEEQL+G +TIQ++V E  E+H+Y   +RKV+  G  EA+ +  FF  TG++G+ + 
Sbjct: 320 TKISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAM 379

Query: 376 LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD 435
           L +L  G +++  G LS+G L++FM+Y  YTGS++FGLS+FYSE+MKG+GAASR+FE+  
Sbjct: 380 LSLLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINK 439

Query: 436 HTSQIKPSSG-KPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGR 494
           +   I  + G  P       I+FE + F+YPTR G+ IF  LN  I PG +VC++GPSG 
Sbjct: 440 YVPDINATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGS 499

Query: 495 GKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYG 554
           GKSTI+SLLLRYYDP +G I I G++I + S +  R+ +GVV QEP+L +G+I  N+ Y 
Sbjct: 500 GKSTISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYN 559

Query: 555 MNSEVTMDEIR--SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKK 612
           +  E+  D+ R  +  +   C+ F+   P G ET +GPRG  LSGGQKQR+A+ARA + +
Sbjct: 560 VPEEIANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLE 619

Query: 613 PKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
           P +L+LDEATSALD  SE  +  TL +   ++  T ISIAHR+STI+ S  V+VL   G 
Sbjct: 620 PTLLVLDEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGH 678

Query: 673 VVEMGKFKELYANDQSELFKLL 694
           VVE G ++EL     S L KLL
Sbjct: 679 VVETGPYEELLGIKDSALNKLL 700

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  209 bits (531), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 174/584 (29%), Positives = 266/584 (45%), Gaps = 39/584 (6%)

Query: 126 AIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAG 185
           A+ LL  +  + + +P       DAV + +  +S   T+    PI   L +  + A   G
Sbjct: 121 ALALLIGAKLLNVQVPFFFK---DAVDSMNIEWSDATTVL---PIAITLTVLSYGAARFG 174

Query: 186 ILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSD-- 243
            ++FG I N             + A +  N I+K+  Q  +   R  +G  +SR +    
Sbjct: 175 AVLFGEIRN------------AVFASVAQNAIRKVSLQTFQHLMRLDLGWHLSRQTGGLT 222

Query: 244 ----------AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
                     +YV+S  +   +   F+                A++T A  L        
Sbjct: 223 RAMDRGTKGISYVLSAMVFHIIPIAFEISVVCGILTYQFGTSFAAVTFATMLLYSIFTFK 282

Query: 294 ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
              +  + R   R    +      V+ + L   + ++ F  E     +Y+N++    +  
Sbjct: 283 TTAWRTEFR---RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQ 339

Query: 354 KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
            K A + A   S   ++   +   ++  G   V+ G LSVGDL             +  L
Sbjct: 340 IKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFL 399

Query: 414 SNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS--WGEIKFEDVSFSYPTRPGNQ 471
            + Y EL +       LF++  +   I+ S     +P     EIKFE+V+F Y   P  +
Sbjct: 400 GSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRK 457

Query: 472 IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR 531
           I    NFT+  G    +VGPSG GKSTI  L+ R+YDP  GRI+IDG++I +L  KSLRR
Sbjct: 458 ILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRR 517

Query: 532 HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
            +GVV Q+  L + +I  N+ +G  +  T D+IR    K      I   P+G ET++G R
Sbjct: 518 AIGVVPQDTPLFNDTIWENVKFGKIT-ATDDDIRKAIDKAQLAPLIHSLPQGSETIVGER 576

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISI 651
           G  +SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+         T I I
Sbjct: 577 GLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYI 636

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           AHRL TI  ++ ++VL N G V E GK  EL +   S   +L N
Sbjct: 637 AHRLRTIADADKIVVLEN-GRVKEEGKHAELLSKPTSLYSELWN 679

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  202 bits (513), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 181/648 (27%), Positives = 295/648 (45%), Gaps = 57/648 (8%)

Query: 97  STEEKSKTNYREILRLIR-LARHDWK--------LLSVAIGLLTISSTVGMTIPKVIGIV 147
           ST  KSKT     LR+++ L ++ W          + +A+ LL  +  + + +P      
Sbjct: 95  STNGKSKTPTISELRIMKDLFKYIWPSGDNKVKIRVLIALALLIGAKLLNVQVPFFFKQT 154

Query: 148 LDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEK 207
           +D++    G    P     LP           +AI   IL +G  A FG  V+   L   
Sbjct: 155 IDSMNIEWG----PDVATVLP-----------VAITMTILSYGA-ARFG-AVMFGELRNA 197

Query: 208 LVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSD------------AYVVSRSMTQNV 255
           + A++  N I+K+  Q  +   +  +G  +SR +              +YV+S  +   +
Sbjct: 198 VFAKVAQNAIRKVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHMI 257

Query: 256 SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
              F+                A++T    L           +  + R   R    +    
Sbjct: 258 PITFEISVVCGILTYQFGSSFAAMTFVTMLLYSFFTFKTTAWRTEFR---RSANRADNKA 314

Query: 316 TKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF 375
             V+ + L   + ++ F  E    ++Y+ ++ K      K A + A   +    +   + 
Sbjct: 315 ASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSAL 374

Query: 376 LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD 435
             ++  G+  V++G L+VGDL             +  L + Y EL +       LF++  
Sbjct: 375 TAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQK 434

Query: 436 HTSQIKPSSGKPYVPSW--GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSG 493
           +   IK +     +P     EIKFE+V+F Y  +P   I     FTI PG    +VGPSG
Sbjct: 435 NPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIAPGKKTAIVGPSG 492

Query: 494 RGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553
            GKSTI  L+ R+YDP  GRI++DG++I +L    LRR +GVV Q+  L + +I  N+ +
Sbjct: 493 SGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKF 552

Query: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
           G     T +EI +  +K      I K P+G ET++G RG  +SGG+KQR+AIAR L+K  
Sbjct: 553 G-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDT 611

Query: 614 KILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSV 673
            I+  DEATSALD  +E ++  T+         T + IAHRL TI  ++ +IVL N G+V
Sbjct: 612 PIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLEN-GAV 670

Query: 674 VEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQV 721
            E G    L AN  S   +L N ++          +++  E+E++D++
Sbjct: 671 REEGTHNALLANPNSLYSELWNIQE----------NLDMLEDELEDEL 708

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  201 bits (511), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 202/387 (52%), Gaps = 18/387 (4%)

Query: 318 VSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLI 377
           ++ + L   + ++ F  E     +YNNA+        K + + A   S   ++   +   
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNSGQNLIFTSALTA 346

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
           ++  G   +L G L+VGDL             +  L + Y EL +       LF++  + 
Sbjct: 347 MMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRNE 406

Query: 438 SQIK--------PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVV 489
             IK        P+ GKP+     EI+FE+V+F Y   P   I    +F I  G  + +V
Sbjct: 407 VVIKNVEQPKMLPADGKPF-----EIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIV 459

Query: 490 GPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRY 549
           GPSG GKSTI  L+ R+YDP  GRI+I+G ++ ++   SLR+ +GVV Q+  L + +I  
Sbjct: 460 GPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWE 519

Query: 550 NLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARAL 609
           N+ +G   + T +E+ +  +K      I+K   G +T++G RG  +SGG+KQR+AIAR L
Sbjct: 520 NVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVL 578

Query: 610 IKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGN 669
           +K   I+  DEATSALD  +E  +  T+    ++   T I IAHRL TI  ++ +IVL  
Sbjct: 579 LKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-E 637

Query: 670 DGSVVEMGKFKELYANDQSELFKLLND 696
           DGSV E G   EL A D S L+K L D
Sbjct: 638 DGSVKEEGTHTELLARDHS-LYKDLWD 663

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  198 bits (503), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 134/398 (33%), Positives = 208/398 (52%), Gaps = 13/398 (3%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+   +      V+ + L   + ++ F  E     +YN+++        K + + A   S
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS 345

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +   ++  G   V+ G L+VGDL             +  L + Y +L +   
Sbjct: 346 GQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 405

Query: 426 AASRLFEMTDHTSQIK----PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIE 481
               LF++  +  +IK    P     +VP   EI FE+V+F Y   P  +I    +FTI 
Sbjct: 406 DMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HPDRKILKNASFTIP 461

Query: 482 PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPM 541
            G    +VG SG GKSTI  L+ R+YDP SGRI+I+G++I +    +LRR +GVV Q+  
Sbjct: 462 AGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTP 521

Query: 542 LMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQ 601
           L + +I  N+ +G   + T +E+++  +K      I K P+G+ET++G RG  +SGG+KQ
Sbjct: 522 LFNDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQ 580

Query: 602 RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRS 661
           R+AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T + IAHRL TI  +
Sbjct: 581 RLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADA 640

Query: 662 ENVIVLGNDGSVVEMGKFKELYANDQS---ELFKLLND 696
           + +IVL N G+V E GK  EL A   S   EL+ +  D
Sbjct: 641 DKIIVLDN-GTVKEDGKHIELLATPGSLYRELWTIQED 677

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  197 bits (502), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/382 (35%), Positives = 200/382 (52%), Gaps = 10/382 (2%)

Query: 318 VSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLI 377
           V+ + L   + ++ F  E    ++Y+ ++ +      K A + A   S   ++   +   
Sbjct: 324 VAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSALTA 383

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
           ++  G   V+ G LSVGDL             +  L + Y EL +       LF++  + 
Sbjct: 384 MMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNK 443

Query: 438 SQI----KPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSG 493
             I    KP    P VPS  EI F++VSF Y   P   I    +FTI  GS   +VGPSG
Sbjct: 444 VSIQNSKKPLMLPPNVPS--EIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSG 499

Query: 494 RGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553
            GKSTI  L+ R+YDP  GRI++DG+++ +L  +SLRR +GVV Q+  L + SI  N+ +
Sbjct: 500 SGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKF 559

Query: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
           G   + T  EI     +      I + P+G +T++G RG  +SGG+KQR+AIAR L+K  
Sbjct: 560 G-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDA 618

Query: 614 KILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSV 673
            I+  DEATSALD  +E A+  T+     +   T + IAHRL TI  ++ +IVL + G V
Sbjct: 619 PIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-GRV 677

Query: 674 VEMGKFKELYANDQSELFKLLN 695
            E GK  EL A  +S   +L N
Sbjct: 678 KEEGKHAELLATPKSLYAELWN 699

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  196 bits (498), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 173/594 (29%), Positives = 279/594 (46%), Gaps = 52/594 (8%)

Query: 125 VAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFA 184
           VA+GLL  +  + + +P      +D++  A   +  P     LP            AI  
Sbjct: 113 VALGLLISAKILNVQVPFFFKQTIDSMNIA---WDDPTV--ALPA-----------AIGL 156

Query: 185 GILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDA 244
            IL +G +A FG  VL   L   + AR+  N I+ +  Q  +   +  +G  +SR +   
Sbjct: 157 TILCYG-VARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGG- 213

Query: 245 YVVSRSM---TQNVSD------------GFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
             ++R+M   T+ +S              F+                A++T +  L    
Sbjct: 214 --LTRAMDRGTKGISQVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSM 271

Query: 290 LLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
             +    +  K R   R+  ++      V+ + L   + ++ F  E     +YN+++   
Sbjct: 272 FTIKTTAWRTKFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISY 328

Query: 350 FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409
                K + + A   S   ++   +   ++  G   V+ G L+VGDL             
Sbjct: 329 RDSQIKVSQSLAFLNSGQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVP 388

Query: 410 VFGLSNFYSELMKGAGAASRLFEMTDHTSQIK----PSSGKPYVPSWGEIKFEDVSFSYP 465
           +  L + Y +L +       LF++  +  +IK    P     +VP   +I FE+V+F Y 
Sbjct: 389 LNFLGSVYRDLKQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPY--DITFENVTFGY- 445

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLS 525
             P  +I    +FTI  G    +VG SG GKSTI  L+ R+YDP SGRI+I+G++I +  
Sbjct: 446 -HPDRKILKNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYD 504

Query: 526 CKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYE 585
             +LR+ +GVV Q+  L + +I  N+ +G   + T +E+ +V +K      I K P+G++
Sbjct: 505 INALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFD 563

Query: 586 TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRE 645
           T++G RG  +SGG+KQR+AIAR L+K  KI+  DEATSALD  +E A+  T+     S  
Sbjct: 564 TIVGERGLMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGS 623

Query: 646 LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS---ELFKLLND 696
            T + IAHRL TI  ++ +IVL N G V E GK  EL A   S   EL+ +  D
Sbjct: 624 RTSVYIAHRLRTIADADKIIVLDN-GRVREEGKHLELLATPNSLYRELWTIQED 676

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  199 bits (507), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 161/550 (29%), Positives = 271/550 (49%), Gaps = 35/550 (6%)

Query: 163  TLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIH 222
            TL+D+  + Y   +  +  I  GI +   I+NF +  LL +  E  +  LR   +K+I+ 
Sbjct: 758  TLKDIGSVHY---LIKWSCIVIGITIIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILR 814

Query: 223  QDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS---- 276
            +  ++F  ++ +  ++ + + +D     R +   VS+   A              +    
Sbjct: 815  KKIQWFSDEKYQTAEMSALILNDL----RDLRSLVSEFMSAMATFIVVSLFGLIWALVTG 870

Query: 277  ---ASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFV 333
               A +  A+F   P +++ + IYG  ++    + + S  NL  +  + +S +KTI++  
Sbjct: 871  WKLALVCIAMF---PLIIIFSAIYGAVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQ 927

Query: 334  AEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSV 393
             EG   H Y  A  K+ +   K ++      S T  +      I+  YG  L++ G  +V
Sbjct: 928  LEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNTITMCIQAILYYYGFKLIMDGEYTV 987

Query: 394  GDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF---EMTDHTSQIK-PSS----G 445
              +        +T      L N   ++ +G  AAS ++   + +D T ++  P+S     
Sbjct: 988  KQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDN 1047

Query: 446  KPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLR 505
                  +  +  ++++F+Y + P  ++ + L   + PG  + + G SG GK+T+ SLL++
Sbjct: 1048 NTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVK 1107

Query: 506  YYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD-EI 564
            +YD +  +I  +G++I     +SLR  + +V+Q+P ++SGSIR NL  G N  +  D E+
Sbjct: 1108 FYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPSVLSGSIRDNL-LGNNKRLISDYEL 1166

Query: 565  RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSA 624
              V K      FI   P G +T+I      LSGGQ QRI IARAL++KPKILILDE TSA
Sbjct: 1167 YDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQRICIARALLRKPKILILDECTSA 1224

Query: 625  LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYA 684
            LD  S   IN  + + +    +TIISI H  S +   +NV VL N G +VE+G +  L A
Sbjct: 1225 LDAMSADIINNLVSKELNG--VTIISITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL-A 1280

Query: 685  NDQSELFKLL 694
               S L KLL
Sbjct: 1281 TSSSHLGKLL 1290

 Score =  188 bits (478), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 152/600 (25%), Positives = 282/600 (47%), Gaps = 49/600 (8%)

Query: 119 DWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGP----------MTLEDLP 168
           D+KLL     L+++S+     +P +  I+   +      F  P          +TL  + 
Sbjct: 29  DYKLL----FLISLSTLANGLVPTISSILTGRIFAILKDFVNPELSKSQIHNKLTLNTMS 84

Query: 169 PIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF 228
            +I G+G F         +++  I+ +  I      GE+   ++R+ ++   + Q   ++
Sbjct: 85  IMILGVGCFP--------IMWTCISTWMSI------GERQGIKVRTKILNNYLTQSMTWY 130

Query: 229 DRNKV--GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF 286
           D N+   GD  ++L      +  S  +  +  F+               S SLT  +   
Sbjct: 131 DLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQNCIAIIALIATSFYYSWSLTLIILCS 189

Query: 287 APPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346
            P + + ++ +   I+  +      T    ++  E +  ++ I+    + K+L ++  +I
Sbjct: 190 TPIICIFSICFSIMIQKFANLENNETTVSAQIFTETIQNIQLIKLNNLQLKKLMKFQTSI 249

Query: 347 RKVFSFGKKEALTNATFFSSTGILGDLSFLIVLA---YGSHLVLQGGLSVGDLTAFMLYT 403
            K   F  +  L  +    +T IL  L+ L+ +    +GS ++ +G L + ++       
Sbjct: 250 SKCNKFFIQMCLYVSL---NTSILRTLTLLMFVQGFWFGSTMIRKGHLKIDEVITCFSSC 306

Query: 404 EYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFS 463
              GS +    +    L KG  A  ++ +  D        +  P       I F+++SF+
Sbjct: 307 LLLGSIISNTLHQIVVLQKGEVALQKIVDFLDEADDPLEINSAPITLINSNISFQNISFA 366

Query: 464 YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
           YP+RP   I N++N   +  +   +VG SG GKST+++LLL++Y+   G I+ID  NI  
Sbjct: 367 YPSRPNENILNQINLYFQNSATTFIVGKSGSGKSTLSNLLLKFYETYKGDILIDNINIKN 426

Query: 524 LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTM---------DEIRSVAKKCFCH 574
           L+ K+L  ++ +V+Q+  L + +IR N+ +G+++             + +++        
Sbjct: 427 LNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVSNFTNQYASNRPNLNERLKNACTFALLD 486

Query: 575 GFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 634
            F+   P G +TVIG  G +LSGGQ+QR+A+ARA ++ P ILILDEA SALDV     + 
Sbjct: 487 HFLIDLPNGIDTVIGTGGITLSGGQQQRVALARAYMRDPPILILDEAVSALDVNIRELLM 546

Query: 635 YTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
             + +L RS + TII + H L+ I   + + V+ + G ++E GK KEL  +  +E  KL+
Sbjct: 547 KAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVIKH-GRIIEHGKRKELITDPNTEFHKLV 603

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  195 bits (496), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/347 (36%), Positives = 182/347 (52%), Gaps = 34/347 (9%)

Query: 357 ALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNF 416
           ALT   +   TG++G                 G L+VGDL             +  L + 
Sbjct: 352 ALTAMMYMGCTGVIG-----------------GDLTVGDLVLINQLVFQLSVPLNFLGSV 394

Query: 417 YSELMKGAGAASRLFEMTDHTSQIK--------PSSGKPYVPSWGEIKFEDVSFSYPTRP 468
           Y EL +       LF++  +  +I+         +S  P+     EI FE+V+F Y ++ 
Sbjct: 395 YRELKQSLIDMESLFQLRKNEIKIENGTNPIVLKASDGPF-----EITFENVTFGYDSK- 448

Query: 469 GNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             +I N  +FTI  G    VVGPSG GKSTI  L+ R+YDP  GRI+I+G ++ +    S
Sbjct: 449 -RKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDS 507

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
           LRR +GVV Q+  L + +I  N+ +G   + T +E+ +V +K      I K P+GYET++
Sbjct: 508 LRRVMGVVPQDTPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIV 566

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTI 648
           G RG  +SGG+KQR+AIAR L+K  KI+  DEATSALD  +E A+  T+     S   T 
Sbjct: 567 GERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTS 626

Query: 649 ISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           + IAHRL TI  ++ +IVL  DG+V E G    L A   S    L N
Sbjct: 627 VYIAHRLRTIADADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  194 bits (493), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 166/562 (29%), Positives = 261/562 (46%), Gaps = 44/562 (7%)

Query: 181 AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRL 240
           AI   IL +GT A FG  VL   L   + AR+  N I+ +  Q      +  +G  +SR 
Sbjct: 156 AIGLTILCYGT-ARFGS-VLFGELRNAVFARVAQNAIRTVSLQTFRHLMKLDLGWHLSRQ 213

Query: 241 SSD------------AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAP 288
           +              +YV++  +   +   F+                A++T +  L   
Sbjct: 214 TGGLTRAMDRGTKGISYVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYS 273

Query: 289 PLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRK 348
              +    +    R   R+   +      V+ + L   + ++ F  E     +YN ++  
Sbjct: 274 MFTIKTTAWRTNFR---RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLIN 330

Query: 349 VFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGS 408
                 K + + A   S   ++   +   ++  G   V+ G L+VGDL            
Sbjct: 331 YRDSQIKVSQSLAFLNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSV 390

Query: 409 AVFGLSNFYSELMKGAGAASRLFEMTDHTSQIK----PSSGKPYVPSWGEIKFEDVSFSY 464
            +  L + Y EL +       LF++  +  +IK    P     +VP   +I F++V+F Y
Sbjct: 391 PLNFLGSVYRELKQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPY--DITFQNVTFGY 448

Query: 465 PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKL 524
              P  +I    +FTI  GS   +VG SG GKSTI  L+ R+YDP SGRI+I+G++I + 
Sbjct: 449 --HPDRKILKNASFTIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEY 506

Query: 525 SCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGY 584
              +LR+ +GVV Q+  L + +I  N+ +G   + T +E+ +V +K      I K P+G+
Sbjct: 507 DIDALRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGF 565

Query: 585 ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSR 644
            T++G RG  +SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T+     S 
Sbjct: 566 NTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSG 625

Query: 645 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS---ELFKLLNDKKPTQ 701
             T + IAHRL TI  ++ +IV  N G V E GK  EL A   S   EL+ +  D     
Sbjct: 626 SRTSVYIAHRLRTIADADKIIVFDN-GKVREEGKHLELLATPGSLYRELWTIQED----- 679

Query: 702 LQSQSRNSVETKENEV-DDQVL 722
                   +   ENE+ DDQ L
Sbjct: 680 --------LHHLENELKDDQAL 693

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  194 bits (492), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 135/404 (33%), Positives = 210/404 (51%), Gaps = 16/404 (3%)

Query: 318 VSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLI 377
           V+ + L   + ++ F  E    ++Y+N++ +      K A + A   +    +   +   
Sbjct: 296 VAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTA 355

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
           ++  G   V+ G LSVGDL             +  L + Y EL +       LF++  + 
Sbjct: 356 MMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNK 415

Query: 438 SQI----KP---SSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVG 490
            +I    KP   SS +P      +I FE+VSF Y   P   I    +FT+  G    +VG
Sbjct: 416 VKIQNKEKPLMLSSQRP-----SKIVFENVSFGY--DPDRMILKNSSFTMPAGWKTAIVG 468

Query: 491 PSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYN 550
           PSG GKSTI  L+ R+YDP  GRI++DG+++ +L  +SLRR +GVV Q+  L + SI  N
Sbjct: 469 PSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWEN 528

Query: 551 LTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALI 610
           + +G  S  + +EIR   +K      + + P+G +T++G RG  +SGG+KQR+AIAR L+
Sbjct: 529 VRFGKIS-ASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVLL 587

Query: 611 KKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGND 670
           K   I+  DEATSALD  +E A+  T+     +   T + IAHRL TI  ++ +IV+   
Sbjct: 588 KDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-QQ 646

Query: 671 GSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKE 714
           G V E GK  EL A   S   +L N ++   + ++     ET+E
Sbjct: 647 GQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEELQREETQE 690

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  192 bits (489), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/420 (32%), Positives = 214/420 (50%), Gaps = 22/420 (5%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+  ++      V+ + L   + ++ F  E     +YN ++        K + + A   S
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS 344

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +   ++  G   V+ G L+VGDL             +  L + Y +L +   
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 404

Query: 426 AASRLFEMTDHTSQIKPSSGKPYVPS--WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPG 483
               LF++  +  +IK +     +P     +I FE+V+F Y   P  +I    +FTI  G
Sbjct: 405 DMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAG 462

Query: 484 SNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLM 543
               +VG SG GKSTI  L+ R+YDP SGRI+I+G++I +    +LR+ +GVV Q+  L 
Sbjct: 463 WKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLF 522

Query: 544 SGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
           + +I  N+ +G   + T +E+ +V +K      I K P+G++T++G RG  +SGG+KQR+
Sbjct: 523 NDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRL 581

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663
           AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T + IAHRL TI  ++ 
Sbjct: 582 AIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADK 641

Query: 664 VIVLGNDGSVVEMGKFKELYANDQS---ELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ 720
           +IVL N G V E GK  EL A   S   EL+ +  D             ++  ENE+ DQ
Sbjct: 642 IIVLDN-GRVREEGKHLELLAMPGSLYRELWTIQED-------------LDHLENELKDQ 687

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 156/529 (29%), Positives = 253/529 (47%), Gaps = 27/529 (5%)

Query: 186 ILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSD-- 243
           I+ +G +A FG  VL   L   + AR+  N I+ +  Q  E   +  +G  +SR +    
Sbjct: 186 IMCYG-LARFG-AVLFGELRNAIFARVAQNAIRNVSLQTFEHLMKLDLGWHLSRQTGGLT 243

Query: 244 ----------AYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
                     +YV+S  +   +   F+                A +T    L      + 
Sbjct: 244 RAMDRGTKGISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYSIFTIR 303

Query: 294 ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
              +  + R   +E  ++      V+ + L   + ++ F  E    ++Y+N++ K     
Sbjct: 304 TTAWRTRFR---KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQ 360

Query: 354 KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
            K A + A   S   ++   +   ++  G   V+ G L+VGDL             +  L
Sbjct: 361 VKVAQSLAFLNSGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFL 420

Query: 414 SNFYSELMKGAGAASRLFEMTDHTSQIKPSSG-KPYVPSWG--EIKFEDVSFSYPTRPGN 470
            + Y EL +       LF++  +  +I+  S  K    S G  EIKFE+V+F Y  +   
Sbjct: 421 GSVYRELKQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQ--R 478

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLR 530
           +I    +FTI  G    + GPSG GKST+  L+ R+YDP  GR++++G ++ +     LR
Sbjct: 479 KILKNASFTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLR 538

Query: 531 RHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGP 590
           + +GVV Q+  L + +I  N+ +G   E + +EI  V  K      I K P+G  T++G 
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGE 597

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           RG  +SGG+KQR+AIAR L+K   I+  DEATSALD  +E ++  T+ R   S E T + 
Sbjct: 598 RGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVY 657

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS---ELFKLLND 696
           IAHRL TI  ++ +IVL  +G+V E G  +EL A + S   EL+++  D
Sbjct: 658 IAHRLRTIADADKIIVL-EEGTVREEGTHQELLARENSLYKELWRIQED 705

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  194 bits (492), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 156/581 (26%), Positives = 281/581 (48%), Gaps = 36/581 (6%)

Query: 143  VIGIVLDAVKNASG---GFSGPMTLEDLPPIIYG-LGMFDFLAIFAGILVFGTIA----- 193
            ++G++   +  A+     ++    LE + P   G  G   +LA ++ +LV G  A     
Sbjct: 718  ILGLLCSLIAGATNPVFSYTFSFLLEGIVPSTDGKTGSSHYLAKWS-LLVLGVAAADGIF 776

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 251
            NF +  LL    E  V  LR+ V++K+  ++ ++F  + NK  ++ + + +D   +   +
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLV 836

Query: 252  TQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQES 311
            ++ +S                      L+       P +++ + IYG  ++    + + S
Sbjct: 837  SEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTS 896

Query: 312  TGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
               L     + ++ +KTI+   AE      Y++   K+     K A+      S T ++ 
Sbjct: 897  VAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIV 956

Query: 372  DLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF 431
                 I+  YG  LV+    +  ++        +T  +   L +   ++ +G  AAS ++
Sbjct: 957  MCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIY 1016

Query: 432  EMTD---HTSQIKPSS------------GKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKL 476
             + D   +T +++ ++            GK   P    +  ++++F+YP+ P   ++  +
Sbjct: 1017 RILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPI---VSIQNLTFAYPSAPTAFVYKNM 1073

Query: 477  NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVV 536
            NF +  G  + ++G SG GKST+  LL + Y+   G+I IDG +++  +  SLR+ + VV
Sbjct: 1074 NFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVV 1133

Query: 537  QQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLS 596
            +Q+P+L +G+IR NLTYG+  E+   E+    K    H F+   P+G +T I      LS
Sbjct: 1134 EQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLS 1191

Query: 597  GGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLS 656
            GGQ QR+ IARAL++K KILILDE TSALD  S   IN  + +      L  + I H   
Sbjct: 1192 GGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GPPALLTMVITHSEQ 1249

Query: 657  TIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
             +R   ++ VL  DG VVE G F  LY N++ ELF++++++
Sbjct: 1250 MMRSCNSIAVL-KDGKVVERGNFDTLY-NNRGELFQIVSNQ 1288

 Score =  179 bits (454), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 148/559 (26%), Positives = 266/559 (47%), Gaps = 36/559 (6%)

Query: 204 LGEKLVARLRSNVIKKIIHQD-AEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFK 260
           +GE+   R+RS +++  + +   E++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 261 AXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSE 320
                          S SLT  +   +P +   A+++ + I + S +    T    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 321 EQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLS---FLI 377
             ++  + ++ +  +  E  ++   I    +F  K     A   ++ GIL  L+   F+ 
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVA---ANAGILRFLTLTMFVQ 274

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
              +GS ++ +G L++ D+          GS +    +    L KG  A  ++  +    
Sbjct: 275 GFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDG 334

Query: 438 SQIKPSSGK-----PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPS 492
           S+  P +       P   +  ++ F +VSFSYP+RP   +   ++     G    +VG S
Sbjct: 335 SKRNPLNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKS 394

Query: 493 GRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT 552
           G GKST+++LLLR+YD  +G I I+G NI  +  K L  ++ VV+Q   L + ++R N+ 
Sbjct: 395 GSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNIL 454

Query: 553 YG-----MNSEVTMDE----IRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
            G      N++ + +E    I+   +      FI   P+G ET+IG  G +LSGGQ+QR+
Sbjct: 455 LGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRV 514

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663
           AIARA I+   IL LDEA SALD+     +   + R  R  + TII + H LS I  S++
Sbjct: 515 AIARAFIRDTPILFLDEAVSALDIVHRNLLMKAI-RHWRKGKTTII-LTHELSQI-ESDD 571

Query: 664 VIVLGNDGSVVEMGKFKELYANDQ---SELFKLLNDKK------PTQLQSQSRNSVETKE 714
            + L  +G VVE G   EL A+     S  + L ND         T+ + +S ++VE+  
Sbjct: 572 YLYLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDYSDAKTIVDTETEEKSIHTVESFN 631

Query: 715 NEVDDQVLEQVANDFNLDQ 733
           ++++   L    ++   D+
Sbjct: 632 SQLETPKLGSCLSNLGYDE 650

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  189 bits (480), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 203/393 (51%), Gaps = 7/393 (1%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+  ++      V+ + L   + ++ F  E     +Y+ ++ K      K + + A   +
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNT 343

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +   ++    + V+QG L+VGDL             +  L + Y +L +   
Sbjct: 344 GQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 403

Query: 426 AASRLFEMTDHTSQIKPSSGKPYVPSWG--EIKFEDVSFSYPTRPGNQIFNKLNFTIEPG 483
               LF++  +   IK S     +P     +I+FE+V+F Y   P  +I N ++FTI  G
Sbjct: 404 DMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAG 461

Query: 484 SNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLM 543
               +VGPSG GKSTI  L+ R+Y+P  GRI++ G +I  L   SLR+ +GVV Q+  L 
Sbjct: 462 MKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLF 521

Query: 544 SGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
           + +I  N+ +G N   + DEI    +K      +   P+G  TV+G RG  +SGG+KQR+
Sbjct: 522 NDTIWENVKFG-NISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRL 580

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663
           AIAR L+K   ++  DEATSALD  +E A+ +T+ +   S   T + +AHRL TI  ++ 
Sbjct: 581 AIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADK 640

Query: 664 VIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
           +IVL   GSV E G    L A+ Q  L++ L D
Sbjct: 641 IIVL-EQGSVREEGTHSSLLAS-QGSLYRGLWD 671

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  189 bits (479), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/326 (36%), Positives = 175/326 (53%), Gaps = 17/326 (5%)

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
           ++  G   V+ G L+VGDL             +  L + Y EL +       LF++  + 
Sbjct: 370 IMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNE 429

Query: 438 SQIK--------PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVV 489
            +I+        P+   P+     EIKFE+V+F Y      +I    +FTI  G    VV
Sbjct: 430 IKIQNVHRPLMLPNELTPF-----EIKFENVTFGYDKE--RKILKNASFTIPAGWKTAVV 482

Query: 490 GPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRY 549
           GPSG GKSTI  L+ R+YDP  GRI+++G +I ++   SLR+ +GVV Q+  L + +I  
Sbjct: 483 GPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWE 542

Query: 550 NLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARAL 609
           N+ +G   E T +EI    +K      I K P+G ET++G RG  +SGG+KQR+AIAR L
Sbjct: 543 NVKFG-RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVL 601

Query: 610 IKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGN 669
           +K   I+  DEATSALD  +E ++  T+         T + IAHRL TI  ++ +IVL  
Sbjct: 602 LKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-K 660

Query: 670 DGSVVEMGKFKELYANDQSELFKLLN 695
           DG V E G  ++L A  +S   +L N
Sbjct: 661 DGQVEEEGTHRQLIAKKESLYSELWN 686

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  191 bits (485), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 160/557 (28%), Positives = 258/557 (46%), Gaps = 23/557 (4%)

Query: 143  VIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGT----IANFGRI 198
            VI  ++  + N    F+    L+ + P + G+G   +L  ++ I++       I+ F + 
Sbjct: 707  VISAIIAGIANPVFSFTFSYLLDGIVPKVDGVGSSHYLLKWSVIVLCVAFTDGISTFLKS 766

Query: 199  VLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSMTQNVS 256
              L  + E  +  LR+  ++ I +++ E+F  D NK  +L + + +D   +   +++ +S
Sbjct: 767  FSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFIS 826

Query: 257  DGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLT 316
                                  L+       P +++ + IYG  ++      + +  +L 
Sbjct: 827  AMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLE 886

Query: 317  KVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFL 376
                E + G+KTI+    E   + RY+    ++   G+K A+      + T  L      
Sbjct: 887  NCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEA 946

Query: 377  IVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH 436
            I+  YG  LV  G  +   +        +T      L N   ++ +G  AASR+F + D 
Sbjct: 947  ILFYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTSLINQIPDVTRGQRAASRIFRILDE 1006

Query: 437  TSQIKPSSGKPY----VPSWGEIK----FEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCV 488
            + +    S +      +P    IK      ++ F YP+   + +FN+LN  I     V V
Sbjct: 1007 SDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVAV 1066

Query: 489  VGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIR 548
            V  SG GKST+  LL R Y  +   I IDG +I++    SLR  + +V+Q+P L  GSIR
Sbjct: 1067 VAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSIR 1126

Query: 549  YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
             NL YG   E+   +I  V K+     F+T  P G +T +    + LSGGQ QRI IARA
Sbjct: 1127 KNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIARA 1184

Query: 609  LIKKPKILILDEATSALDVESEGAINYTLGRLMRS--RELTIISIAHRLSTIRRSENVIV 666
            L++K KILILDE TSALD ES     + +  L++S    +  I+I H    +R   NVIV
Sbjct: 1185 LLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVIV 1240

Query: 667  LGNDGSVVEMGKFKELY 683
            L  DG   + G F ELY
Sbjct: 1241 L-QDGETAQQGTFDELY 1256

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 132/523 (25%), Positives = 243/523 (46%), Gaps = 34/523 (6%)

Query: 204 LGEKLVARLRSNVIKKIIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFKA 261
           +GE    R+R  ++   + +  E+FD N   +GD +        V S S  +  +  F+ 
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGS-AEASAITFQN 154

Query: 262 XXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEE 321
                         S SLT  +   +P L+V A  + + I   ++   + TG   +    
Sbjct: 155 FVAIIALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLTW 214

Query: 322 QLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSS--TGILGDLS---FL 376
            ++  + ++ +  +  E+ ++   + +       +   NA F+ S  T IL  LS   F+
Sbjct: 215 SMNAAQLVKLYCTQDFEIKKFKEIVIRC-----NDYFINAWFYVSANTSILRFLSLAMFV 269

Query: 377 IVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH 436
               +GS ++ +  +SV  +          GS +         L K     +R+ +  + 
Sbjct: 270 QGFWFGSTMIKKNKMSVDQVITCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQDFLED 329

Query: 437 TSQI------KPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVG 490
            S++      + S     VP    I F+ +SF YP+RP + +   ++   +P     +VG
Sbjct: 330 KSEMATDRDRQTSINLDNVPI--SISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVG 387

Query: 491 PSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYN 550
            SG GKST+++LLL++Y+  +G I ++G N+  +    + +++ +V+Q+  L + ++R N
Sbjct: 388 KSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNN 447

Query: 551 LTYGMNSEVTMDEIRS-VAKKC---FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
           L  G++     +++ S + + C        I K P G +T +G  G SLSGGQ+QR+A+A
Sbjct: 448 LLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALA 507

Query: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
           RA ++   ++ILDEA SALD  +   +   +    RS+  T I + H L+ I  S+ + +
Sbjct: 508 RAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELNQILPSDFLYL 565

Query: 667 LGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNS 709
           + N G + E G   EL  N +S   K  +      LQ+ +R S
Sbjct: 566 MEN-GQIKEEGYQNELIENVESTFCKFFH------LQNSNRES 601

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 202/401 (50%), Gaps = 20/401 (4%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+  ++      V+ + L   + ++ F  E    ++Y++++ +      K A + A   S
Sbjct: 316 RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNS 375

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +  +++  G   V++G L+VGDL             +  L + Y EL +   
Sbjct: 376 GQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 435

Query: 426 AASRLFEMTDHTSQIK-----------PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFN 474
               LF++  +  +I+            SS  P+     EIKFE+V+F Y T    +I  
Sbjct: 436 DMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPF-----EIKFENVTFGYDT--NRKILK 488

Query: 475 KLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLG 534
             +F I  G    VVGPSG GKSTI  L+ R+YDP  GR++I+G N+ +    SLRR +G
Sbjct: 489 NASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMG 548

Query: 535 VVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGAS 594
           VV Q+  L + +I  N+ +G       +EI+ V +K      I K P+  +T++G RG  
Sbjct: 549 VVPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLM 607

Query: 595 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHR 654
           +SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T I IAHR
Sbjct: 608 ISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHR 667

Query: 655 LSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           L TI  ++ +IVL  DG V E G   EL A   S    L N
Sbjct: 668 LRTIADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  187 bits (474), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/399 (31%), Positives = 203/399 (50%), Gaps = 18/399 (4%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+  ++      V+ + L   + ++ F  E     +Y+N++ K      K A + A   +
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
               +   +   ++  G   V+ G L+VGDL             +  L + Y EL +   
Sbjct: 341 GQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 400

Query: 426 AASRLFEMTDHTSQIK--------PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLN 477
               LF + ++  +I         P +  P+     EIKFE+V+F Y TR   +I    +
Sbjct: 401 DMEALFNLRNNKIKIHNNDKPLMLPENAGPF-----EIKFENVTFGYDTR--RKILRNAS 453

Query: 478 FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQ 537
           FTI  G    +VGPSG GKSTI  L+ R+YDP SGR++++G+++ +    S R+ +GVV 
Sbjct: 454 FTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVP 513

Query: 538 QEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSG 597
           Q+  L + +I  N+ +G   + T DE+ +  +K      I K P G  T++G RG  +SG
Sbjct: 514 QDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISG 572

Query: 598 GQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLST 657
           G+KQR+AIAR L+K  +I+  DEATSALD  +E ++  T+         T + +AHRL T
Sbjct: 573 GEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRT 632

Query: 658 IRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
           I  ++ ++VL  +G V E G   EL +   S L+K L D
Sbjct: 633 IADADKILVL-EEGCVREEGSHTELLSRPNS-LYKQLWD 669

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  190 bits (482), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 161/592 (27%), Positives = 270/592 (45%), Gaps = 31/592 (5%)

Query: 126  AIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGL-------GMFD 178
            +I L TI   +  TI K   ++L    +   G + P+       ++ G+       G   
Sbjct: 728  SISLWTIVRKMNTTINKRSLLILGLTCSLMAGIANPIFSYTFSKLLSGIVPQNNEIGSPK 787

Query: 179  FLAIFAGILVFGTIAN----FGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNK 232
            +L  ++GI++F  + +    F +   L    E  +  LR   I+KI  QD  +F  D NK
Sbjct: 788  YLIKWSGIVLFIAVLDSTFTFLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNK 847

Query: 233  VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLV 292
              ++ + + +D   +   +++ +S                      L+       P  ++
Sbjct: 848  SSEISALVLNDLRDLRSLVSEFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFIL 907

Query: 293  GALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSF 352
             +  YG  ++    + +     L     E   G+ TI+    E + L +Y N  +K+   
Sbjct: 908  FSCFYGGLLQRYETDYKTKVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRA 967

Query: 353  GKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLT---AFMLYTEYTGSA 409
             KK A+T     +++  L      I+  YG  LV  G  S   +      +L+T  T  +
Sbjct: 968  SKKRAITIGFGVAASNTLTLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVS 1027

Query: 410  VFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWG-----EIKFEDVSFSY 464
            + G      ++ +G  AA+ +F + D+ S       K  + S+       I  +++SFSY
Sbjct: 1028 LIGQ---IPDISRGQRAATYIFRIIDNQSPAAKDEKKK-IASYKFTHDPLISVKNLSFSY 1083

Query: 465  PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKL 524
            P+ P   I+  L   +  G  + VVG SG GKST+  L+   Y+  +G I IDG +I++ 
Sbjct: 1084 PSAPSTAIYKGLKLDVFSGETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRW 1143

Query: 525  SCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGY 584
                LR  + VV+Q+P    G++  NL YG++  VT  +++          F+   PEG 
Sbjct: 1144 DTNKLRTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGL 1203

Query: 585  ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSR 644
            +T I    + +SGGQ QR++IARA+++KPKIL LDE TSALD  +  AI   + +     
Sbjct: 1204 DTRIDT--SLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIKKHFCG- 1260

Query: 645  ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
             +T I I H    +R  E + VL N G V E G F +LYA  + E F+++N+
Sbjct: 1261 -ITTIVITHNEQMMRACERIAVLQN-GKVAEDGSFDDLYAQ-RGEFFRIMNN 1309

 Score =  138 bits (348), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 136/549 (24%), Positives = 245/549 (44%), Gaps = 31/549 (5%)

Query: 204 LGEKLVARLRSNVIKKIIHQDAEFFDRN-KVGDLISRLSSDAYVVSRSMTQNVSDGFKAX 262
           LGEK   R+R  ++   + +   ++D++ +     ++L+     +  S  ++ +  F+  
Sbjct: 104 LGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNV 163

Query: 263 XXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQ 322
                        S SLT  +    P ++V ++I  K I   +R     +    ++    
Sbjct: 164 VTVFALTITSFYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWS 223

Query: 323 LSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG 382
               + I+ F  +  E+ ++  +++K   +  + +L ++  ++         F+    +G
Sbjct: 224 FDAAEMIRLFCTQQFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFG 283

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFG--LSNFYSELM---KGAGAASRLFEMT--- 434
           + ++ QG L+ GD+      T ++   + G  L+N   +++   KG  A  ++   T   
Sbjct: 284 NKMIRQGVLTTGDVI-----TCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEE 338

Query: 435 ----DHTSQIKPSS------GKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGS 484
               DH ++I   +              GEI F++VSFSYPTRP   +   ++       
Sbjct: 339 NDFPDHRNEIISDAFILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNK 398

Query: 485 NVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMS 544
              +VG SG GKSTI  LLL+ Y   +G I +DG +I  +    L  ++ +V+Q   L +
Sbjct: 399 TTFIVGKSGSGKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFN 458

Query: 545 GSIRYNLTYGMNSEVTMDE-IRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
            +I+ N+  G   +   D  +R   +       I   P G +TV+G  G SLSGGQKQR+
Sbjct: 459 DTIKNNILLGCKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRV 518

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663
           A+ARA ++   ILILDEA S +D+     +   + +  +   +T + + H L+ I   E+
Sbjct: 519 ALARARVRDSPILILDEAISGMDIIHRDLLVEAIKKWRKG--MTTVIVTHELTQI-SDED 575

Query: 664 VIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQVLE 723
            +    +G + E G    L  N+ S   +L   +K       SR SV T   E   +  E
Sbjct: 576 YLYFMEEGQIRESGFKCNLEKNENSHFNRLWRLQKAK--TGFSRRSVSTSNLEKFPENAE 633

Query: 724 QVANDFNLD 732
            V N+  LD
Sbjct: 634 -VVNETKLD 641

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 177/342 (51%), Gaps = 24/342 (7%)

Query: 357 ALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNF 416
           ALT   +   TG++G                 G L+VGDL             +  L + 
Sbjct: 370 ALTGMMYLGCTGVIG-----------------GNLTVGDLVLINQLVFQLSVPLNFLGSV 412

Query: 417 YSELMKGAGAASRLFEMTDHTSQIKP-SSGKPYVPSWG--EIKFEDVSFSYPTRPGNQIF 473
           Y EL +       LF++  +  +I    + K  +   G  EI FE+V+F Y      +I 
Sbjct: 413 YRELKQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKIL 470

Query: 474 NKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHL 533
              +FTI  G    +VGPSG GKSTI  L+ R+YDP  GRI+I+G ++ ++   SLR+ +
Sbjct: 471 KNASFTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLI 530

Query: 534 GVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGA 593
           GVV Q+  L + SI  N+ +G   +    EI  V +K      I K P+ YET++G RG 
Sbjct: 531 GVVPQDTPLFNDSIWENVKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGL 589

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
            +SGG+KQR+AIAR L+K   ++  DEATSALD  +E A+  T+    ++   T I IAH
Sbjct: 590 MISGGEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAH 649

Query: 654 RLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           RL TI  ++ +IVL  DG+V E G   EL A   S   +L N
Sbjct: 650 RLRTIADADKIIVL-EDGTVREEGTHNELLAKSTSLYKELWN 690

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  189 bits (479), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 151/578 (26%), Positives = 265/578 (45%), Gaps = 34/578 (5%)

Query: 143  VIGIVLDAVKNASG---GFSGPMTLEDLPPIIYGLG----MFDFLAIFAGILVFGTIANF 195
             +GIV      A+     +S    L  + P+   +G    +  +  I   + +      F
Sbjct: 709  CVGIVFALCAGAANPVFSYSFSYLLNGIIPVHGTVGSSFYLLKWSLIVLSVAIIDAFCTF 768

Query: 196  GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD--RNKVGDLISRLSSDAYVVSRSMTQ 253
             +  ++    E  +  LR  V++ I +   E+F    NK  ++ +   +D   +   +T+
Sbjct: 769  SKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVTE 828

Query: 254  NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTG 313
             ++                      L+       P ++V + +YG  ++    + + +  
Sbjct: 829  FLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAVA 888

Query: 314  NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL 373
             L     E +  +KTI+    +    +RY+   +++ S G++ ++      + T  L   
Sbjct: 889  QLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTLC 948

Query: 374  SFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLF-- 431
               I+  YG  LV+ G  +   +        +T      L N   E+ +G  AA+ ++  
Sbjct: 949  IQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYRI 1008

Query: 432  -----------EMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI 480
                       +M + T  I  +S K  +     +  +D++F+YP  P   ++  LN  +
Sbjct: 1009 LKEAAATREHQDMHNRTLPISNTSEKDTM-----VLVKDLTFAYPATPSKHVYEHLNLNL 1063

Query: 481  EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540
            +  ++V +VG SG GKSTI SLL + YD     I +DG ++S+    SLR  + VV+Q  
Sbjct: 1064 KSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSA 1123

Query: 541  MLMSGSIRYNLTYGMNSEVTMD-EIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQ 599
             L++G+IR NLTYG+  E T + ++  + K    + F+++ P G +T++      LSGGQ
Sbjct: 1124 NLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQ 1181

Query: 600  KQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIR 659
             QR+ IARAL+K  +ILILDE TSALD  S   I   + + + +    II+I H    +R
Sbjct: 1182 AQRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIPNT--LIIAITHDEHMMR 1239

Query: 660  RSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
              E+V++L N G++VE G F EL   D SE  K LN +
Sbjct: 1240 SCESVLLLKN-GAIVEQGSFVELMQQD-SEFKKCLNGR 1275

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 154/619 (24%), Positives = 283/619 (45%), Gaps = 40/619 (6%)

Query: 119 DWKLLSVAIGLLTISSTVGMTIPKVI-GIVLDAVKNASGG---FSGPMTLEDLPPIIYGL 174
           D+KLL+V + L TI+S +   I  ++ G V D + N S     FS  + L  +  +I G 
Sbjct: 14  DYKLLTV-VTLTTIASGLIPAITSILTGRVFDILSNISLNDRQFSHQLVLRSMSVMILGA 72

Query: 175 GMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNK-- 232
             F  + IF              I     LGE    R+R N++   + +   ++D N   
Sbjct: 73  ASFPVMWIF--------------ITSWMHLGEVQGDRIRINMLGSYLSKSWTWYDGNGKR 118

Query: 233 -VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
            +G+  ++LS     V +S +++ +   ++              S SLT  + L + P++
Sbjct: 119 LLGEF-TQLSRCIEEVRQSSSESAAITLQSFVSVLSLIGTSFYYSWSLT-LIILCSTPII 176

Query: 292 VGALIYGKKIRMISRELQ-ESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVF 350
               IY  K+     +L+ + T    ++    +     ++ + A+ +E+ +++ ++ +  
Sbjct: 177 TAIAIYFAKLTNKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQNEEISKFDTSVTRCN 236

Query: 351 SFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAV 410
           S   K  L +A   S    L    F+    +G+ ++ +  L + D+          G+ V
Sbjct: 237 SLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNKLDINDVITCFHSCLMLGATV 296

Query: 411 FGLSNFYSELMKGAGAASRL--FEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRP 468
               +  + + KG  A  +L  F   +  + ++ +   P   +   I F ++SF YP R 
Sbjct: 297 SEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFKYPCRT 356

Query: 469 GNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
            N     ++  +E G    ++G SG GKST+A LLLR+Y+  SG I +D  +I  L+ + 
Sbjct: 357 SNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEW 416

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSE---VTMDEI----RSVAKKC---FCHGFIT 578
           L  ++ VV+Q   L + ++R N+  G  ++     M+ I    R + K C     +  + 
Sbjct: 417 LLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMESIEERERKLRKACNFALLNEMLA 476

Query: 579 KFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638
              +G +TVIG  G  LSGGQ+QR+A+ARA ++   I+I DE+ SALDV     +   + 
Sbjct: 477 DLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAI- 535

Query: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698
           R  R  + TI+ + H LS I  ++ + ++ + G V E G  ++L  ++ S   +    + 
Sbjct: 536 RSWRQGKTTIV-LTHELSQINPTDFIYIMEH-GRVCEYGYQEDLLKSETSYFSRFYQHQA 593

Query: 699 PTQLQSQSRNSVETKENEV 717
           P     +S    +T  N +
Sbjct: 594 PEGAVHESLPRYDTFRNSI 612

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  189 bits (479), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 150/541 (27%), Positives = 256/541 (47%), Gaps = 24/541 (4%)

Query: 164  LEDLPPIIYGLG----MFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKK 219
            L  L P   G+G    +  +  I  G+ +   I NF +  L     E  + +LR+ V+++
Sbjct: 716  LNGLAPQFDGVGSPSYLLKWSLIVIGVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQR 775

Query: 220  IIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASL 279
            I  ++ ++F R +     S +S+      R +    SD   A              +  +
Sbjct: 776  ISFEELDWFQRER--HKASEVSALLLNDLRDLRALASDFLIAVSSFAVVSSVGIIWALII 833

Query: 280  TSALFLFA----PPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
               L L      P +++ + +YG  ++    + + +  +L  +  E  +G+KTI+    E
Sbjct: 834  GWKLSLVCISMFPLIVIFSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLE 893

Query: 336  GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395
               L +Y      +     + A+T     +    L      I+  Y   LV+ G  +   
Sbjct: 894  TNFLRQYKRLESHMRVIASRRAITTGLGVAVIEALAMSIQAILFYYALKLVIDGQYTTKK 953

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD--------HTSQIKPSSGKP 447
            +   +    +T      L +   ++ +G  AA+R+ +M D        H  + + +SG  
Sbjct: 954  MFETLTLLLFTIMTCNILISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSV 1013

Query: 448  YVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
               S   I  ++V+F+YP+ P   IF+ L   +  G    +VG SG GKST+ +LL + Y
Sbjct: 1014 SESS-AVISLQNVTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLY 1072

Query: 508  DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSV 567
             P SG ++++ +++++ + + LRR + VV+Q P + SG++R NL YG++ +    E+  V
Sbjct: 1073 RPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDV 1132

Query: 568  AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
             +    H FI+K P G +T I      LSGGQ QR+ IARA++K+PKILILDE TSALD 
Sbjct: 1133 LRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDP 1190

Query: 628  ESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ 687
             S   IN  + R   +  LT ISI H +  ++  + +I L N G V   G F  L  +D+
Sbjct: 1191 FSSHVINNIVRRGCPA-PLT-ISITHNVDMMKACDEIIFLKN-GRVAGTGSFDALLQSDK 1247

Query: 688  S 688
            +
Sbjct: 1248 T 1248

 Score =  142 bits (358), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 121/423 (28%), Positives = 218/423 (51%), Gaps = 11/423 (2%)

Query: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
           S SLT      AP +++    + +K++  +    E T   +++ +  ++  + I+    E
Sbjct: 158 SWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTE 217

Query: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGD 395
            +E+  + N ++   +   K    ++   ++   L    F+    +GS ++ +G +++GD
Sbjct: 218 LREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAFWFGSTMIRKGKMNIGD 277

Query: 396 LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL--FEMTDHT--SQIKPSSGKPYVPS 451
           +          GS + G       + KG+ A + +  F   D T  + I+     P+   
Sbjct: 278 VITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPEL 337

Query: 452 WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            G+I+F++V FSYP+RP + +   ++     G    ++G SG GKS++++LLL++Y+  +
Sbjct: 338 KGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYT 397

Query: 512 GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGM---NSEVTMDEIRSVA 568
           G I +DG+NI  +    L +++ VV+Q   + +G+++ N+  G+   + E  + +++ V 
Sbjct: 398 GVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVC 457

Query: 569 KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
           +      FI    +G  T+IG  G SLSGGQ+Q++AIARAL+K P+ILILDE+ SALDV 
Sbjct: 458 RISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALDVL 517

Query: 629 SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
             G I   + R  R  + TII + H L+ I  S +   L   G  +E G  +E   ND S
Sbjct: 518 QRGLILRAI-RTHRKEKTTII-LTHELNQI-GSNDFCYLIESGQCIEHG-LEETLVNDPS 573

Query: 689 ELF 691
             F
Sbjct: 574 TRF 576

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  188 bits (477), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 147/538 (27%), Positives = 253/538 (47%), Gaps = 22/538 (4%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--D 229
            + L  + F+ +  G+     I NF +  LL    E  +  LR+ +++K+  ++  +F  +
Sbjct: 758  FYLAKWSFVVL--GVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGE 815

Query: 230  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
             NK  ++ + + +D   +   +++ +S                      L+       P 
Sbjct: 816  NNKAAEISALVMNDLRDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPL 875

Query: 290  LLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
            +++ ++IYG  ++    + + S   L     + ++ +KTI+   AE      Y++   K+
Sbjct: 876  IIIFSVIYGSSLQTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKM 935

Query: 350  FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409
                 K A+      S T ++      I+  YG  LV+    +   + A      +T  +
Sbjct: 936  EGIASKRAIATGFGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMS 995

Query: 410  VFGLSNFYSELMKGAGAASRLFEMTDH---TSQIKPSSGKPYVPSWGE---------IKF 457
               L     ++ +G  AAS ++ + D    T +I+ ++G+    S G          +  
Sbjct: 996  CTTLVGQIPDISRGQRAASWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSI 1055

Query: 458  EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
            ++++F+YP+ P   I+ +++  +  G  V +VG SG GKST+  LL   Y    G I ID
Sbjct: 1056 QNLTFAYPSAPNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEID 1115

Query: 518  GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577
            G +++  +  SLRR + VV+Q+P L  GSIR NLTYG   ++   E+    K    + F+
Sbjct: 1116 GTDVNDWNLTSLRREISVVEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFV 1175

Query: 578  TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
               P+  +T I      LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  +
Sbjct: 1176 ASLPQSLDTRIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIV 1233

Query: 638  GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
             +      L  + I H    +R   +V+V   DG +VE G F  LY ND  ELF++++
Sbjct: 1234 KK--GPPALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLY-NDHKELFRIIS 1287

 Score =  167 bits (423), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 143/559 (25%), Positives = 268/559 (47%), Gaps = 36/559 (6%)

Query: 204 LGEKLVARLRSNVIKKIIHQDA-EFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFK 260
           +GE+   R+RS +++  + +   E++D N+  +GD  ++++     +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 261 AXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSE 320
                          S SLT  +   +P + + A+ + + I + +++    TG   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 321 EQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLS---FLI 377
             ++  + ++ +  +  E  ++   +    +F  K     A   ++ G+L  L+   F+ 
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLA---ANAGVLRFLTLTMFVQ 275

Query: 378 VLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHT 437
              +GS ++ +G L++ D+          G+ +    +    L KG  A  ++  + ++ 
Sbjct: 276 GFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLENG 335

Query: 438 SQIKPSSG-KPYVP----SWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPS 492
            +   S+  + Y P    + G++ FE+VSF+YP+RP   I          G    +VG S
Sbjct: 336 PKRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIVGKS 395

Query: 493 GRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT 552
           G GKSTI++LLL++YD   G I I+G+NI  +  KSL  ++ VV+Q   L + +++ N+ 
Sbjct: 396 GSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKNNIL 455

Query: 553 YGMNSEV------TMDE---IRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
            G    +      T+D    I+   +       I   P+G ET+IG  G +LSGGQ+QR+
Sbjct: 456 LGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQQRV 515

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSEN 663
           AIARA I+   IL LDEA SALD+     +   + R  R  + TII + H+LS I  +++
Sbjct: 516 AIARAFIRDTPILFLDEAISALDIVHRNLLMKAI-RHWRKGKTTII-LTHQLSQI-EADD 572

Query: 664 VIVLGNDGSVVEMGKFKELYANDQSELFKLLN------DKKP---TQLQSQSRNSVETKE 714
            + L  DG V+E G   EL  +  +   K  +      D K    T+ + +S +++E+  
Sbjct: 573 YLYLMQDGKVIESGIQSELLVDSTTTFSKWYHLQEDYFDAKTVVNTKTEEKSISTMESFN 632

Query: 715 NEVDDQVLEQVANDFNLDQ 733
           +++     E   N+   D+
Sbjct: 633 SQLKTPKFESGLNNLGYDE 651

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  187 bits (475), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 135/439 (30%), Positives = 219/439 (49%), Gaps = 28/439 (6%)

Query: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
           S SLT  +   AP +++ A+++   I   +      TG   ++    ++  + ++ +  +
Sbjct: 173 SWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQ 232

Query: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSS--TGILGDLS---FLIVLAYGSHLVLQGG 390
             E+H +   + +       +    + F+ S  T IL  LS   F+    +G+ +V +G 
Sbjct: 233 AYEIHSFKELVGQC-----NDLFIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGK 287

Query: 391 LSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP 450
           LS+ D+          GS +         L KG  A  ++ +     SQ  PS   PY P
Sbjct: 288 LSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISF-SQRSPSLEPPYEP 346

Query: 451 SW----GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRY 506
           S     GEI F+++SF+YPTRP   +   ++ T +PG +  ++G SG GKST+A+LLL++
Sbjct: 347 SVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLKF 406

Query: 507 YDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGM---NSEVTMDE 563
           Y+   G I I   N+ K++   L  ++ VV+Q   L + ++R NL  G+   N +V  D+
Sbjct: 407 YNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQDD 466

Query: 564 I------RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
           I      +   +       I + P+G +T+IG  G SLSGGQ+QR+AIARA IK   +LI
Sbjct: 467 IEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVLI 526

Query: 618 LDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
           LDEA SALD+     I   +    RS + TII + H LS +   + + V   DG V E G
Sbjct: 527 LDEAVSALDIIHRELIMKAIKN-WRSGKTTII-LTHDLSQLDYDDFLYVF-EDGEVKESG 583

Query: 678 KFKELYANDQSELFKLLND 696
            +++    D+  +F  L D
Sbjct: 584 -YQQALLQDEKTIFSKLYD 601

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 144/543 (26%), Positives = 248/543 (45%), Gaps = 33/543 (6%)

Query: 174  LGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR--N 231
            L +  +  I  GI     I+NF +  +L    E  +  LR+  +  I+++  ++F +  N
Sbjct: 762  LYLLKWSFIVLGISAADAISNFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEEN 821

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
            K  +L + L +D   +   +++ +S                      L+       P ++
Sbjct: 822  KSSELSALLLNDLRDLRSLVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLII 881

Query: 292  VGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRY---NNAIRK 348
            + + IYG  ++      + +   L     E ++ +KTI+   A    +  Y    N ++K
Sbjct: 882  LVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKK 941

Query: 349  VFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGS 408
            +     K ++      S T  +      I+  YG  LV +G  S   +        +T  
Sbjct: 942  I---AHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTII 998

Query: 409  AVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPS------------SGKP-YVPSWGEI 455
            +   L +   ++ +G  AAS L+ + D +   K S            SG    VP    I
Sbjct: 999  SCTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIIISGNTNSVPL---I 1055

Query: 456  KFEDVSFSYPTRPGNQIFNKLNFTIEPGS-NVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
              +++ FSYP+    +I+  +   +      + +VG SG GKST+  LL + Y   +  I
Sbjct: 1056 SIKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSI 1115

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
             IDG ++++     LR+ + VV+Q P L  G++R NL YG  ++++  EI  V K    +
Sbjct: 1116 YIDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIY 1175

Query: 575  GFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 634
             FI   P G ++ I  +   +SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN
Sbjct: 1176 EFIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN 1233

Query: 635  YTLGRLMRSRELTIISIAHRLS-TIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
                 L+++   T+++I    S  +  + N + +  DG + E G F EL  N+ SEL ++
Sbjct: 1234 ----NLVKNGLPTVLTIVITHSKQMMEACNSLAVIKDGRLAEQGNFAELMKNN-SELRRI 1288

Query: 694  LND 696
            +N+
Sbjct: 1289 INE 1291

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  184 bits (468), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 121/327 (37%), Positives = 173/327 (52%), Gaps = 9/327 (2%)

Query: 374 SFLIVLAY-GSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 432
           S L V+ Y G   ++ G L+VGDL             +  L + Y EL +       LF+
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 433 MTDHTSQIKPSSGKPYVPSWGE----IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCV 488
           +  +   IK       +   G     I+FE+V+F Y  +   +I    +F IE G    +
Sbjct: 432 LKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQ--RKILKNASFQIESGQKTAI 489

Query: 489 VGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIR 548
           VGPSG GKSTI  LL R+YDP  GRI+++G +  +    SLR+ +GVV Q+  L + +I 
Sbjct: 490 VGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIW 549

Query: 549 YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
            N+ +G     + DEI  V  K      + K P+G ET++G RG  +SGG+KQR+AIAR 
Sbjct: 550 ENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARV 608

Query: 609 LIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLG 668
           L+K   I+  DEATSALD  +E A+  T+    +    T + IAHRL TI  ++ +IVL 
Sbjct: 609 LLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL- 667

Query: 669 NDGSVVEMGKFKELYANDQSELFKLLN 695
            +G+V E GK  EL A   S   +L N
Sbjct: 668 QEGTVREEGKHSELLARSGSLYKELWN 694

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  186 bits (471), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 154/573 (26%), Positives = 264/573 (46%), Gaps = 30/573 (5%)

Query: 146  IVLDAVKNASGGFSGPM-------TLEDLPPIIYGLGMFDFLAIFAGILVF----GTIAN 194
            +V   V + + G + P+        L  + P + G G   +L  ++ I++       ++N
Sbjct: 706  LVFGLVCSIAAGVANPIFSWAFSYLLNGIVPTVDGPGSPSYLVKWSIIVLCVSGADAVSN 765

Query: 195  FGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR--NKVGDLISRLSSDAYVVSRSMT 252
            F +  +L    E  +  LR+  +++I  +  E+F R  NK  ++ + L +D   +   ++
Sbjct: 766  FLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSLVS 825

Query: 253  QNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQEST 312
            Q +S                      L+       P +++ ++IYG  ++      +   
Sbjct: 826  QFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTKV 885

Query: 313  GNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGD 372
             NL  +  E ++GVKTI+    +      Y+    ++    +K A+      + T  +  
Sbjct: 886  ANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIAT 945

Query: 373  LSFLIVLAYGSHLVLQGGLSVGDLT---AFMLYTEYTGSAVFGLSNFYSELMKGAGAASR 429
                I+  YG  LV+ G  S   +      +L+T  T +++       S   + A    R
Sbjct: 946  TIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLISQIPDISRGQRAASWIYR 1005

Query: 430  LFEMTDHTSQIKPSSGKPYVPSWGE--------IKFEDVSFSYPTRPGNQIFNKLNFTIE 481
            + E ++ T +   + G+      GE        +   ++ F+YPT     I++ L+  + 
Sbjct: 1006 IIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNLSLDLN 1065

Query: 482  PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPM 541
             G  V +VG SG GKST+  LL + Y      I IDG ++++   ++LRR + VV+Q+P+
Sbjct: 1066 VGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISVVEQKPV 1125

Query: 542  LMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQ 601
            L  G++R NL YG+       +I  + K    + FI   PEG ET +    + +SGGQ Q
Sbjct: 1126 LFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLISGGQAQ 1183

Query: 602  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRS 661
            R+ IARAL++KPKILILDE TSALD  S   IN  + +   S  L  ISI H    +R  
Sbjct: 1184 RLCIARALLRKPKILILDECTSALDANSSKIINDIVAKGPPS--LLTISITHNEQMMRSC 1241

Query: 662  ENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
              V VL  DG + E G F +L+    +EL+K++
Sbjct: 1242 NTVAVL-KDGKICETGPFNKLF-KPGNELYKVV 1272

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 145/596 (24%), Positives = 267/596 (44%), Gaps = 39/596 (6%)

Query: 100 EKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFS 159
           +K  + ++E + +    + DW L++  + L TI++ +   +P V  I+   V +    F+
Sbjct: 3   KKKVSVWKENIYMYVQFKRDWLLIATMV-LTTIANGL---VPAVTSILTGKVFDLLKDFA 58

Query: 160 GPMTLEDL----PPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN 215
            P   +D       ++  + +   LA  A  L++ +I+ +         GE     +R  
Sbjct: 59  DPNIPKDHNLYHQLVLRSMSLMA-LAACAFPLIWTSISTWMS------FGEGQGFTVRYR 111

Query: 216 VIKKIIHQDAEFFDR--NKVGDL------ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXX 267
           ++   + +  E++D+  N  GD       +  L + +   S    QN+S           
Sbjct: 112 MLNSYLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASAITLQNISSMLS------- 164

Query: 268 XXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVK 327
                   S SLT  +    P L++ A I+ + I+  +      +G    +    ++  +
Sbjct: 165 LIGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQ 224

Query: 328 TIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVL 387
            I+    + KE+  +     K   +  K +L  A   S+   L    F+    +G+  + 
Sbjct: 225 MIKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIR 284

Query: 388 QGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIKPSSGK 446
           +G L++ D+          GS +     +   L KG  A  ++   + D+  +I  S+ K
Sbjct: 285 KGNLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDESALK 344

Query: 447 PYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRY 506
               S  +I F  VSFSYP+RP + + N ++     G    +VG SG GKST+++LLL+ 
Sbjct: 345 QIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKL 404

Query: 507 YDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSE-----VTM 561
           YD   G I I   +I ++  + L +++ VV+Q   L + ++  N+  G   E     V  
Sbjct: 405 YDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQ 464

Query: 562 DEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEA 621
            +++   K       I     G +T++G  G SLSGGQ+QR+A+ARA ++  ++LILDEA
Sbjct: 465 KKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEA 524

Query: 622 TSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
            SALD+     +   + +  + R  T I + H LS I   + + V+  +G ++E G
Sbjct: 525 VSALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESG 577

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  185 bits (469), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 148/521 (28%), Positives = 251/521 (48%), Gaps = 26/521 (4%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLISRLSSDAYVVSRSM 251
            NF +  LL    E  +  LR+ ++ K+  ++  +F  + NK  ++ + + +D   +   +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDLRSLV 837

Query: 252  TQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQES 311
            ++ +S                      L+       P +++ + IYG  ++    + + S
Sbjct: 838  SEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYKTS 897

Query: 312  TGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
               L     + ++ +KTI+   AE      Y++  +K+     K A+      S T ++ 
Sbjct: 898  VAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNMIA 957

Query: 372  DLSFLIVLAYGSHLVLQGGLS---VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAAS 428
                 I+  YG  LVL    +   + +    +L+T  + +++ G      ++ +G  AAS
Sbjct: 958  MCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQRAAS 1014

Query: 429  RLFEMTDH---TSQIKPSSGKPYVPSWGE---------IKFEDVSFSYPTRPGNQIFNKL 476
             ++ + D    T +I+ +  +    S  E         I   ++SF+YP+ P   IF  +
Sbjct: 1015 WIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPIISIRNLSFAYPSAPNVPIFKHM 1074

Query: 477  NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVV 536
            +  +     + +VG SG GKST+A LL R Y+  +  I+IDG +++  +  SLR+ + VV
Sbjct: 1075 DLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRKQISVV 1134

Query: 537  QQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLS 596
            +Q+P    GSIR NLTYG   E+   EI  V K    + F+   P+G +T +      LS
Sbjct: 1135 EQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN--LLS 1192

Query: 597  GGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLS 656
            GGQ QR+ IARAL++K KILILDE TSALD  S   IN  + R      LT++ I H   
Sbjct: 1193 GGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN-DIVRKGPPGLLTLV-ITHSEQ 1250

Query: 657  TIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
             +R   ++ VL + G VVE G F  LY N + ELF+++ +K
Sbjct: 1251 MMRCCNSIAVLKH-GKVVEEGNFDNLY-NKEGELFRIVCNK 1289

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 218/441 (49%), Gaps = 26/441 (5%)

Query: 276 SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAE 335
           S SLT  +   +P + + A+I+ + I   +++    T N  ++    ++  + ++ +  +
Sbjct: 174 SWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQ 233

Query: 336 GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLS---FLIVLAYGSHLVLQGGLS 392
             E  ++   I    +F  K  L  A   ++ GIL  L+   F+    +GS ++ +G L+
Sbjct: 234 PLERQKFQEIILSCNTFFIKSCLYVA---ANAGILRFLTLTMFVQGFWFGSTMIRKGKLN 290

Query: 393 VGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP-- 450
           + D+          GS +    +    L KG  A  ++  + +  S+   S+ + ++   
Sbjct: 291 INDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPP 350

Query: 451 ---SWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
              +  ++ FE+VSF+YP+RP   +   +N     G    +VG SG GKSTI++LLL +Y
Sbjct: 351 LNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFY 410

Query: 508 DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYG---------MNSE 558
           D   G I+I+G+N   +  K L  ++ VV+Q   L + +++ N+  G          N+ 
Sbjct: 411 DNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTI 470

Query: 559 VTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
              + I+   +       I   P+G ET+IG  G SLSGGQ+QR+AIARA I+   IL L
Sbjct: 471 GNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFL 530

Query: 619 DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
           DEA SALD+     +   + R  R  + TII + H LS I   +++ V+  +G VVE G 
Sbjct: 531 DEAVSALDIVHRNLLMKAI-RHWRKGKTTII-LTHELSQIESDDHLYVM-QEGRVVESGI 587

Query: 679 FKELYANDQ---SELFKLLND 696
             EL A+     S+ + L ND
Sbjct: 588 QSELLADSATTFSKWYYLQND 608

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  184 bits (467), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 247/534 (46%), Gaps = 40/534 (7%)

Query: 185  GILVFGTIANFGRIVLLR--VLG---EKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLI 237
              +V G  A    + LL+  +LG   E  +  LR + ++KI +   E+   D NK  +L 
Sbjct: 751  AFIVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELS 810

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            + L +D   +  S +  +S                      L+       P L++ ++IY
Sbjct: 811  ALLMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIY 870

Query: 298  GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEA 357
            G  ++    E + +   L  V  E ++G+KTI+    E     ++N   +     G++ A
Sbjct: 871  GILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRA 930

Query: 358  L--------TNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409
            +        +N    S  GIL          Y   LV+ G  +   +        +T   
Sbjct: 931  IVTGFGVAVSNGLTMSIQGIL--------YYYAIKLVIHGEYTTKKMFETFTLLLFTIMT 982

Query: 410  VFGLSNFYSELMKGAGAASRLFEMTD--HTSQIKPSSGKPYVP-----SWGEIKFEDVSF 462
               L N   ++ +G  AAS+++ + +    S+   + G   VP     +   I+F D+SF
Sbjct: 983  CNNLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIRFNDLSF 1042

Query: 463  SYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
            +YPT P  +I   L+  I  G  + +VG SG GKST+ +++ R Y+  S  + +D  +++
Sbjct: 1043 AYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFVDNTDVN 1102

Query: 523  KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPE 582
              +   LR  + VV+Q+P L  G+IR NL YG        ++ ++ K    + F    PE
Sbjct: 1103 DWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFNMLKYVGIYDFFATLPE 1162

Query: 583  GYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR 642
            G ET I      LSGGQ QR+ IARAL+++PKILILDE TSALD  S   IN     ++R
Sbjct: 1163 GLETKID--SGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIIN----EIIR 1216

Query: 643  SRELTI--ISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
                T+  ISI H    +R    V VL + G +VEMG  ++L    + +L+KL+
Sbjct: 1217 EGPPTMLTISITHDEQMVRACNKVAVL-DQGHIVEMGNREDLL-RQKGQLWKLV 1268

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 156/579 (26%), Positives = 273/579 (47%), Gaps = 30/579 (5%)

Query: 179 FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKV--GDL 236
            LA+ AG +V   I     I    +LGE+   R+R+ +I   + +  +++D N    GDL
Sbjct: 68  ILALGAGSIVIIWIC----ISSWMLLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL 123

Query: 237 ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALI 296
            ++ +     +  S  +  +  +K               S SLT      AP +++ A+ 
Sbjct: 124 -TQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIF 182

Query: 297 YGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKE 356
           + + I + S +    T   +++    +   + ++    +  E+  +  A++K      K 
Sbjct: 183 FSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKM 242

Query: 357 ALTNATFFSSTGILGDLS---FLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
            L  +   ++T IL  L+   F+    +GS ++ +  L + D+          G+ + G 
Sbjct: 243 CLYAS---ANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGT 299

Query: 414 SNFYSELMKGAGAASRLFEMTDHTSQIKPS--SGKPYVPSWG---EIKFEDVSFSYPTRP 468
            +    L KG      + E       +K    + + +    G   +I+  +V F+YP+RP
Sbjct: 300 LHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRP 359

Query: 469 GNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
                  ++ T+  G    VVG SG GKS++ +LLL+ YD  +G I IDG +I  +  KS
Sbjct: 360 TVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKS 419

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGM--NSEVTMDE-IRSVAKKCFCHGFITKFPEGYE 585
           + +++ +V+Q   L + ++R N+ +G     E+  DE +++  +      FI   PEG +
Sbjct: 420 ILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRISLLDNFIYDLPEGLD 479

Query: 586 TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRE 645
           T+IG  G + SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +   + R  RS +
Sbjct: 480 TLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLLMNAI-RNWRSEK 538

Query: 646 LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQ 705
            TII + H LS I   +++I L  DG VVE G+ + L  N Q   F +++    T L   
Sbjct: 539 TTII-LTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNLLLNQQGRFFNMVSLGAGTDLADS 596

Query: 706 SR--NSVET----KENEVDDQVLEQVANDFNLDQKSSKL 738
           S    ++E     K +  +D ++E   N   +D+ S  L
Sbjct: 597 SSLITTIEIPGRFKTSTYEDSLIEYELNTPRIDEDSGSL 635

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 115/321 (35%), Positives = 171/321 (53%), Gaps = 24/321 (7%)

Query: 386 VLQGGLSVGDLTAFMLYTEYTGSAVFGLS---NF----YSELMKGAGAASRLFEMTDHTS 438
           V++G L+VGDL             +F LS   NF    Y EL +       LF +  +  
Sbjct: 373 VMEGSLTVGDLVLI-------NQLIFQLSLPLNFLGSVYRELKQSLIDMESLFRLQKNKI 425

Query: 439 QIK----PSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGR 494
            IK    P      +PS  +I+FE+V+F Y   P  +I     FTI  G    +VGPSG 
Sbjct: 426 TIKNVLNPQMLPEKLPS--DIRFENVTFGYD--PERKILKNATFTIPAGKKTAIVGPSGS 481

Query: 495 GKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYG 554
           GKSTI  L+ R+Y+P  GRI+IDG++I ++   SLR+ +GVV Q+  L + +I  N+ +G
Sbjct: 482 GKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFNDTIWENVKFG 541

Query: 555 MNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPK 614
              + +  +I +  ++      I   P+G  T++G RG  +SGG+KQR+AI+R L+K   
Sbjct: 542 -RIDASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAISRVLLKDCP 600

Query: 615 ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
           ++  DEATSALD  +E ++  T+      +  T + IAHRL TI  ++ +IVL N+  V 
Sbjct: 601 LMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKIIVL-NNSRVH 659

Query: 675 EMGKFKELYANDQSELFKLLN 695
           E G  K L     S   +L N
Sbjct: 660 EEGDHKTLLKTPGSLYSELWN 680

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  177 bits (448), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 118/376 (31%), Positives = 192/376 (51%), Gaps = 9/376 (2%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           R+  ++      ++ + L   + ++ F  E     +YN +++       K A + A   S
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNS 361

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +   ++  G   +L G LSVGDL             +  L + Y +L +   
Sbjct: 362 GQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 421

Query: 426 AASRLFEMTDHTSQIKPSSGKPYVPSWGE----IKFEDVSFSYPTRPGNQIFNKLNFTIE 481
               LF++  +  +I  ++  P + S  +    I+F++V+F Y   P  +I    +F I 
Sbjct: 422 DMESLFKLRKNEVKIL-NNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIP 478

Query: 482 PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPM 541
            G    VVGPSG GKSTI  L+ R+YDP  GR++++G ++      SLRR +GVV Q+  
Sbjct: 479 AGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTP 538

Query: 542 LMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQ 601
           L + +I  N+ +G +   T ++I +  +K      I K P+ YET++G RG  +SGG+KQ
Sbjct: 539 LFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQ 597

Query: 602 RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRS 661
           R+AIAR L+K   I+  DEATSALD  +E  +  T+         T + IAHRL T+  S
Sbjct: 598 RLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADS 657

Query: 662 ENVIVLGNDGSVVEMG 677
           + +IVL  +GS+ E G
Sbjct: 658 DKIIVL-KEGSIFEEG 672

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  178 bits (452), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 139/523 (26%), Positives = 242/523 (46%), Gaps = 28/523 (5%)

Query: 180  LAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR--NKVGDLI 237
            L + A  L  GT  NF +I +L    E  +  LR+ +++ +  +  E++ R  NK  ++ 
Sbjct: 726  LIVLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEIS 784

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +   +D   +   +T+ +S                      L+       P +++ ++IY
Sbjct: 785  ALALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 298  GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEA 357
            G  ++      + +  +L  +  E ++ +KTI+        L  Y+   +K+    KK  
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 358  LTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFY 417
            +      S    +      I+  YG  LVL G  +   +        +T +    L +  
Sbjct: 905  IVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQI 964

Query: 418  SELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGE--------IKFEDVSFSYPTRPG 469
             ++ +G  AAS +  + D     K  +G+       E        I+ E+++F YP  PG
Sbjct: 965  PDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPG 1024

Query: 470  NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSL 529
              ++  LN  I  G  + +VG SG GKST+  LL + YD    RI+I+G +I+  S   L
Sbjct: 1025 VNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDIL 1084

Query: 530  RRHLGVVQQEPMLMSGSIRYNLTYGMNSE--VTMDEIRSVAKKCFCHGFITKFPEGYETV 587
            R  + VV+Q+P L  G+IR N+TYG++ +  V+  E++ + +    H F+   P+  +TV
Sbjct: 1085 RAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTV 1144

Query: 588  IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI-------NYTLGRL 640
            +      LSGGQ QR+ I R L++KPK+LILDE TS+LD ++   +       N  LG  
Sbjct: 1145 VDI--GLLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLG-- 1200

Query: 641  MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
                ++  I I H    ++    ++VL + G VVE G+F +L+
Sbjct: 1201 ---WDILTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH 1239

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 130/541 (24%), Positives = 262/541 (48%), Gaps = 31/541 (5%)

Query: 204 LGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXX 263
           LGE+   R+RS ++++ + +  E++D      L   L+ D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 264 XXXXXXXXXXXX-------SASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLT 316
                              S  LT  +   +P ++V A  + + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 317 KVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLS-- 374
            +    +   +T++    + KE+ ++   + K   +  + +L  A   ++ GIL  L+  
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRTSLFTA---ANIGILRFLTLS 263

Query: 375 -FLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM 433
            F+    +GS ++ +G L++ D+          GS +    +    + KG  A +++ + 
Sbjct: 264 MFVQGFWFGSTMIRKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKIQKF 323

Query: 434 TDHTSQI--KPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGP 491
            + + ++  K  +    V S  +I  ++++F+YP+RP   +   ++  I+      +VG 
Sbjct: 324 INESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGK 383

Query: 492 SGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL 551
           SG GKSTI +L++++Y+   G I++  ++I  +    L +++ +V+Q   L + +++ N+
Sbjct: 384 SGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNI 443

Query: 552 TYG--MNSEVTMDEIRSVAKKCFC-HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
             G    S+   D + S      C    I+  P+G ET +G  G +LSGGQ+QR+A+ARA
Sbjct: 444 LLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARA 503

Query: 609 LIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLG 668
            ++   ILILDEA SALD+     +   + ++ +++  T I + H L+ I  ++ + +  
Sbjct: 504 FLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDNDYIYLFE 561

Query: 669 NDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQVLEQVAND 728
           N+  + E G FK+   ND++ LF  + + +     + SR S  T  ++  D+V E+  +D
Sbjct: 562 NN-EIKENG-FKKTLMNDENTLFYNMYNLQRNAAITDSRASSPTIYDK--DEVYEK-KDD 616

Query: 729 F 729
           F
Sbjct: 617 F 617

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  174 bits (441), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 191/393 (48%), Gaps = 7/393 (1%)

Query: 306 RELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFS 365
           RE  ++      V+ + L   + ++ F  E     +Y  ++ K      + A + A   S
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNS 339

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              ++   +   ++  G   ++ G L+VGDL             +  L + Y EL +   
Sbjct: 340 GQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 399

Query: 426 AASRLFEMTDHTSQIKPSSGKPYVPSWG---EIKFEDVSFSYPTRPGNQIFNKLNFTIEP 482
               LF + ++   I   S    +P+     +I FE+V+F Y   P  +I    +F I  
Sbjct: 400 DMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASFVIPA 457

Query: 483 GSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPML 542
           G    VVGPSG GKST+  L+ R+YDP  GRI+++G +I +    SLRR +GVV Q+  L
Sbjct: 458 GWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPL 517

Query: 543 MSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQR 602
            + +I  N+ +G       +  RS+ +K      + + P G  T++G RG  +SGG+KQR
Sbjct: 518 FNDTIWENVKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLMISGGEKQR 576

Query: 603 IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSE 662
           +AIAR L+K   I+  DEATSALD  +E A+  T+         T + IAHRL TI  ++
Sbjct: 577 LAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADAD 636

Query: 663 NVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            +IVL  +G   E G   EL   + S   +L N
Sbjct: 637 KIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  173 bits (438), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 241/529 (45%), Gaps = 22/529 (4%)

Query: 182  IFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLISR 239
            I  G+ V   ++NF +  +L    E  +  LR+  ++ I+++D  +F  D NK  +L S 
Sbjct: 763  IVLGVAVADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSEL-SA 821

Query: 240  LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG-ALIYG 298
            L  +     RS+                        S    S + L   PL++  + +YG
Sbjct: 822  LLLNDLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYG 881

Query: 299  KKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEAL 358
              ++      + S   L     E ++G+KTI++  AE   +  Y+     + +   K ++
Sbjct: 882  TMLQKYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSI 941

Query: 359  TNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYS 418
                  S T ++      I+  YG  LV +G  S   +        +T      L N   
Sbjct: 942  ATGFGISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIP 1001

Query: 419  ELMKGAGAASRLFEMTDH-----TSQIKPSSGKPYVPSWGE------IKFEDVSFSYPTR 467
            ++ +G  +A+ L+ + D       S+ +       V    E      IK ++++F+YP+ 
Sbjct: 1002 DISRGQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAYPSE 1061

Query: 468  PGNQIFNKLNFTIEPGS-NVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC 526
                ++  LN  +      + +VG SG GKST+  LL + Y      I +DG +++    
Sbjct: 1062 TNVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGL 1121

Query: 527  KSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYET 586
             +LR  + VV+Q+P L  G++R NL+YG+++++   E+  + K    + F+   P G +T
Sbjct: 1122 MNLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDT 1181

Query: 587  VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
             I  +   LSGGQ QRI IARAL++KPKILILDE TSALD  S   I   +        L
Sbjct: 1182 RIDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANIIIDIVKN--GPPAL 1237

Query: 647  TIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
              I I H    +R    + VL N G ++E G FKEL  N   EL K+++
Sbjct: 1238 LTIVITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL-VNGNGELKKIID 1284

 Score =  135 bits (340), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 153/622 (24%), Positives = 275/622 (44%), Gaps = 60/622 (9%)

Query: 113 IRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGI----VLDAVKNASGGFSGPMTLEDLP 168
           + + R  W L+     L+ I++T    +P +  I    V D + N S  FS    L +L 
Sbjct: 22  VDVKRDKWILM-----LVLITTTSNGLVPAITSILTGRVFDLLSNISN-FSMHTILSELR 75

Query: 169 PIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF 228
                   F  +A+ A  L    I+    +     LGE+    +R  ++++ + +   ++
Sbjct: 76  T-----RAFAIMALGAASLPLMWIS----LSSWMSLGERQGFAVREKILQEYLTKPITWY 126

Query: 229 DRNKVGDLISRLSSDAYVVSRSMTQNVSDG-------FKAXXXXXXXXXXXXXXSASLTS 281
           D N        LS D   ++R + +  S         F+               S SLT 
Sbjct: 127 DSN------DNLSGDFTQINRCVEELRSSSAEASAIIFQNLVSILALIGTSFYYSWSLTL 180

Query: 282 ALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHR 341
            +   AP ++  A+ +   I   +      TG   +++   +  ++ ++ +  + +E+  
Sbjct: 181 IILCTAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQFREVRN 240

Query: 342 YNNAIRKVFSFGKKEALTNATFFSSTGILGDLS---FLIVLAYGSHLVLQGGLSVGDLTA 398
           +            K  L  +   ++T +L  LS   F+    +G+ +V +G L + ++  
Sbjct: 241 FRELTSNCNDLFIKCCLYVS---ANTALLRFLSLSMFIQGFWFGATMVRKGKLQISNVVT 297

Query: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM----TDHTSQIKPSSGKPYVPS-WG 453
                   GS +         L KG  A  ++        DH +  +P   +P  P+   
Sbjct: 298 CFQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFLSTSVDHGAD-EPIY-EPETPAELC 355

Query: 454 EIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGR 513
            I F +++FSYP+RP + +   ++   EP     ++G SG GKST+++LLL++YD  +G 
Sbjct: 356 TIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDDYNGT 415

Query: 514 IMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD------EIRSV 567
           I + G ++ +++   L  ++ VV+Q   L + ++R N+  G++ +   D      +++  
Sbjct: 416 ITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQKLKDA 475

Query: 568 AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
                    +   P G  T+IG  G SLSGGQ+QR+AIARA ++   ILILDEA SALD+
Sbjct: 476 CSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEAVSALDI 535

Query: 628 ESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ 687
                +   + R  RS + TI+ + H LS I   +   V+  +G V E G  K+L     
Sbjct: 536 IHRELLMKNI-RQWRSGKTTIL-LTHELSQIEPDDYTYVI-QEGEVKENGYQKDLKQKKT 592

Query: 688 SELFKLLNDKKPTQLQSQSRNS 709
           S    +LN      LQ+ +R+S
Sbjct: 593 SVFNHMLN------LQTNNRDS 608

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  172 bits (437), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 157/598 (26%), Positives = 271/598 (45%), Gaps = 67/598 (11%)

Query: 139  TIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLG-----------MFDFLAIFAGIL 187
            +IPK   +VL  + +   G S P+       ++ G+            +  +  I   I 
Sbjct: 696  SIPKRRYLVLGLLFSVIAGMSNPLFSYTFSKLLTGIAPQDTGTSSSYYLMKWSLIVISIS 755

Query: 188  VFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD------------------ 229
                I+ F +  +L    E  + RLR + + KI  +  ++F                   
Sbjct: 756  AVDGISTFLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLR 815

Query: 230  --RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA 287
              R    + +S +++  +V S  +   +  G+K                 SL  A  LF+
Sbjct: 816  DLRGLASEFLSAITTLVFVASIGLIWALVSGWK-----------LSLVCISLFPAFILFS 864

Query: 288  PPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR 347
                    IYG  +++     +     L     E +  +KTI+    +      +   + 
Sbjct: 865  G-------IYGSLLQVYETAYKTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLA 917

Query: 348  KVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTG 407
            KV    KK ++      + T  L  +   I+  +G  LV+QG  SV  +        ++ 
Sbjct: 918  KVRIVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSI 977

Query: 408  SAVFGLSNFYSELMKGAGAASRLFEMTDH-----TSQIKPSSGKPYVPSWGE---IKFED 459
                 L N   E+ +G  AA+ +F++ +      TS+  PS  + +  + G    IK  +
Sbjct: 978  MTCVSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISN 1037

Query: 460  VSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQ 519
            +SF++ + P N+IFN L+  I     V +VG SG GKST++ LL R Y   SG++ I G 
Sbjct: 1038 LSFAFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGI 1097

Query: 520  NISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITK 579
            +I+K    +LRR + +V+Q+P    G++R NL YG+   V+  E+RSV K      F+  
Sbjct: 1098 DINKWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQT 1157

Query: 580  FPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 639
             P    T +      +SGGQ QR++IAR L+++PKI+ILDE TSALD     A ++ +  
Sbjct: 1158 LPNDLNTRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALD----AANSFAIAE 1211

Query: 640  LMRS--RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            L+R+  + +T+I I H    ++  + V+VL   G V E G + EL+ + + EL+++++
Sbjct: 1212 LIRTVLKNVTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELFES-RGELYRIVS 1267

 Score =  160 bits (405), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 143/531 (26%), Positives = 238/531 (44%), Gaps = 36/531 (6%)

Query: 204 LGEKLVARLRSNVIKKIIHQDAEFFDRNK--VGDLISRLSSDAYVVSRSMTQNVSDGFKA 261
           LGE+   R+R+++I     +D +++D N+   GD I +++     V  S  +  +  F+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEVRASSAEASAIFFQN 149

Query: 262 XXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEE 321
                         S SLT  +    P L   A+    K+   S+     +   + V   
Sbjct: 150 VISIIALIATSMYYSWSLTLIILCSLPLLATLAVFLSMKVEKFSKLENLESSKASSVLAW 209

Query: 322 QLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAY 381
            L   + I+ F     E  ++   + K      K  L +A   SS   L    F+    +
Sbjct: 210 SLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCMFVQGFWF 269

Query: 382 GSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIK 441
           G+  + +G +  GD+          GS++         + KG  A  R+       +Q  
Sbjct: 270 GNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRI-------NQFL 322

Query: 442 PSSGKPYVPSW---------------------GEIKFEDVSFSYPTRPGNQIFNKLNFTI 480
             + K  V  W                     G+I+F DVSF+YPTRP + +   ++  I
Sbjct: 323 VPNSKSAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIKI 382

Query: 481 EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540
           + G+   +VG SG GKST+ASLLL+ Y   +G I      I  L    L  ++ +V+Q  
Sbjct: 383 KSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQRC 442

Query: 541 MLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQK 600
            L +G+++ NLT  +N   +  E++   +    +  +   P G +T++G  G +LSGGQ+
Sbjct: 443 TLFNGTLKDNLTI-VNKYASCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQQ 501

Query: 601 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRR 660
           QR+A+ARA ++   +LILDE+ SALD+ S   I   + R  R  + TII + H  + I+ 
Sbjct: 502 QRVALARAYLRNTPVLILDESLSALDIMSRELIVEAI-RHWRKGKTTII-LTHEYTQIKD 559

Query: 661 SENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE 711
            E V ++ ++G+VVE G   +L  N  S  F  LN  + T+ +      VE
Sbjct: 560 DEYVYLM-SEGTVVESGFKYDLLENPDS-YFAQLNSLQETRYEVPVSPDVE 608

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  172 bits (437), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 148/533 (27%), Positives = 250/533 (46%), Gaps = 59/533 (11%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLISRLSSDA----YVV 247
             F +  +L V  E  +  LR   + +I +QD  +F  D NK  ++ + + +D     Y+V
Sbjct: 807  TFLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLV 866

Query: 248  SRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGAL-IYGKKIRMISR 306
            S  ++   +  F +              S    S +     PL +G   IYG  ++    
Sbjct: 867  SGFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTI-----PLFIGVTGIYGGVLQKYET 921

Query: 307  ELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRY--------NNAIRKVFSFGKKEAL 358
            + + +   L     E + G+KT++    E    ++Y        + + R+    G   AL
Sbjct: 922  DYKTAVAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVAL 981

Query: 359  TNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLT---AFMLYTEYTGSAVFGLSN 415
            +NA       IL          YG  LV+ G  +  +L      +++T  T SA+     
Sbjct: 982  SNALVIGVQAIL--------YYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVP 1033

Query: 416  FYSELMKGAGAASRLFEMTDHTSQI-------------KPSSGKPYVPSWGEIKFEDVSF 462
             +S   +G  AA+ +F + +  S               KPS   P       I+ +D++F
Sbjct: 1034 SFS---RGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPL------IRIQDLTF 1084

Query: 463  SYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
            +YP+    +++ KL+ TI  G N+ +VG SG GKST+  +L   Y  N   + ID  +I 
Sbjct: 1085 AYPSALDVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDIC 1144

Query: 523  KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPE 582
            K +  SLR+H+ +V+Q+     GSIR NL YG++  VT  +I  V        F+ + P+
Sbjct: 1145 KWNLSSLRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQ 1204

Query: 583  GYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR 642
            G  T I      +SGGQ QRI+I RAL+++PK+LILDE TS+LD ++  AI   +G  + 
Sbjct: 1205 GLNTRIDTN--LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLY 1262

Query: 643  SRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
               +T I I H  + + +S N I+   +G + E G F+EL ++ + + ++++ 
Sbjct: 1263 G--ITTIVITHN-TQMMKSCNRILFFKNGRISEEGTFQEL-SDSRRDFYRMIT 1311

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 135/539 (25%), Positives = 241/539 (44%), Gaps = 32/539 (5%)

Query: 183 FAGI-LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNK--VGDLISR 239
           F G+ L + T++++       +LGE+   R+R  ++   + +   ++D N+   GD  ++
Sbjct: 86  FGGLPLCWATLSSW------MLLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDF-TQ 138

Query: 240 LSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGK 299
           +      +  S  ++ +  F                S SLT  +    P ++  A+I+ K
Sbjct: 139 IHRGVEELRSSAAESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSK 198

Query: 300 KIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALT 359
            +   +      T +   +    +   + I+ F  E  EL +++ +++K   F    +  
Sbjct: 199 LVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKY 258

Query: 360 NATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSE 419
            A   +S   L  + F+    +G+ ++ +G L+ G +          G+ +         
Sbjct: 259 AAANQASLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVI 318

Query: 420 LMKGAGAASRLFEMTD-----------HTSQIKPS--SG---KPYVPSWGEIKFEDVSFS 463
           + KG  A  ++  M +            T +I PS  SG    P  P   +I FE+VSFS
Sbjct: 319 MQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPK--QITFENVSFS 376

Query: 464 YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
           YP+RP     + ++ T  P     +VG SG GKST+++LLL+ Y    G I +   +I  
Sbjct: 377 YPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRA 436

Query: 524 LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD-EIRSVAKKCFCHGFITKFPE 582
                L  ++ +V+Q   L + S+  NL      +   +  I+   +       +   P+
Sbjct: 437 TKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPD 496

Query: 583 GYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR 642
           G  TVIG  G SLSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +   + R  R
Sbjct: 497 GLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVI-RNWR 555

Query: 643 SRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQ 701
           + + TII + H LS I   ++ + L  DG V E G  ++L +       +L N   P+ 
Sbjct: 556 AGKTTII-LTHELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTELHNAVIPSD 612

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
           YKL209C (REAL)
          Length = 1316

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 160/626 (25%), Positives = 289/626 (46%), Gaps = 42/626 (6%)

Query: 117 RHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYGLGM 176
           R D+KLL     L+ IS+     +P +  I+   V +    F    +  DL P +    M
Sbjct: 47  RSDYKLLI----LMIISTVATGLVPAITSILTGRVFDLLSVFVLSGSHNDLYPQLVQRAM 102

Query: 177 FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQD-AEFFDRNK--V 233
               A+ A + V    A +  +     +GEK   R+RS +++  + +   +++D N   +
Sbjct: 103 ----AVMA-LGVASVPAMWLSLTSWMYIGEKQGLRIRSQLLEAYLEKKPMKWYDVNDTLL 157

Query: 234 GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
           GD  ++++     +  S  +  +  F+               S SLT  +   +P +   
Sbjct: 158 GDF-TQINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLIILCSSPIITFF 216

Query: 294 ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
           A+ + + + M S++  E T    ++    ++  + ++ +  +  E  ++   I    +F 
Sbjct: 217 AVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERKKFQRIILSCNTFF 276

Query: 354 KKEALTNATFFSSTGILGDLSFLIVLA---YGSHLVLQGGLSVGDLTAFMLYTEYTGSAV 410
            K  L  A   ++ GIL  L+  + +    +GS ++ QG L++ D+          GS +
Sbjct: 277 IKSCLFVA---ANAGILRFLTLTMFVQGFWFGSTMIKQGKLNINDVITCFHSCILLGSTL 333

Query: 411 FGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSS-----GKPYVPSWGEIKFEDVSFSYP 465
               +    L KG  A  ++  + ++  +  P +       P   +  ++ F++VSFSYP
Sbjct: 334 NNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYP 393

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLS 525
           +RP   +    +     G    +VG SG GKST++SLLL++YD   G I I+G+NI  + 
Sbjct: 394 SRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIP 453

Query: 526 CKSLRRHLGVVQQEPMLMSGSIRYNLTYG-----MNSEVTMDE----IRSVAKKCFCHGF 576
            K L +++ VV+Q   L + ++R N+  G      N++ + ++    I+   +       
Sbjct: 454 QKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRL 513

Query: 577 ITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 636
           I   P+G ET+IG  G +LSGGQ+QR+A+ARA I+   IL LDEA SALD+     +   
Sbjct: 514 ILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKA 573

Query: 637 LGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
           + R  R  + TII + H L  +  S++ + L  +G V+E G   EL A+  S        
Sbjct: 574 I-RHWRKGKTTII-LTHELGQV-ESDDHLYLMQEGKVIESGTQSELLADSTSTF------ 624

Query: 697 KKPTQLQSQSRNSVETKENEVDDQVL 722
            K   LQ    ++     +E+D++ L
Sbjct: 625 SKWYCLQKDYSDTKTIVNSEIDEKSL 650

 Score =  166 bits (421), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 149/536 (27%), Positives = 250/536 (46%), Gaps = 30/536 (5%)

Query: 181  AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFF--DRNKVGDLIS 238
             I  G+     I NF +  LL    E  +  LR+ V++K+  +   +F  + NK  ++ +
Sbjct: 790  CIVLGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSA 849

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA----PPLLVGA 294
             + +D     R +   VS+   A              + +    L L      P +++ +
Sbjct: 850  LVLNDL----RDLRSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFS 905

Query: 295  LIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGK 354
             IYG  ++    + + S   L     + ++ +KTI+   AE      Y+    K+     
Sbjct: 906  AIYGSILQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIAS 965

Query: 355  KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
            K A+      S T ++      I+  YG  LV+    +   +        +T  +   L 
Sbjct: 966  KRAIATGFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLV 1025

Query: 415  NFYSELMKGAGAASRLFEMTDH---TSQIKPSSGKPYVPSWGE----------IKFEDVS 461
            +   ++ +G  AAS ++ + D    T +I+ ++ +  +   GE          +  ++++
Sbjct: 1026 SQIPDISRGQRAASWIYRILDEKQVTLEIEDNNARS-IGIIGETYHEKQTTPMLSIQNLT 1084

Query: 462  FSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNI 521
            F+YP+ P   I+  +N  +  G  + +VG SG GKST+  LL R YD   G I +DG ++
Sbjct: 1085 FAYPSAPSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDV 1144

Query: 522  SKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFP 581
            +  +   LRR + VV+Q+P+L +G+IR NLTYG   E+   EI    K    + F+   P
Sbjct: 1145 NDWNLTVLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLP 1204

Query: 582  EGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
             G  T I      LSGGQ QR+ IARAL++KPKILILDE TSALD  S   I   + +  
Sbjct: 1205 LGLGTRIDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK-- 1260

Query: 642  RSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
                L  + I H    +R  +++ V   DG V+E G F  LY N+  E+F+++++K
Sbjct: 1261 GPPALLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEK 1314

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 156/549 (28%), Positives = 256/549 (46%), Gaps = 49/549 (8%)

Query: 176  MFDFLAIFAGILVF-GTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            ++ F+ I+A I VF     N   IVLL     +  A+L   + K ++     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +I+R SSD   V  ++    +  F++                S     FL    +L+  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILI-----SYNMPWFLIVNAVLLII 1107

Query: 295  LIYGKKIRM-ISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
             IY +   + +SREL+     ST  +  +  E L G   I AF    K   R++      
Sbjct: 1108 YIYYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRFD-----F 1158

Query: 350  FSFGKKEALTNATF-FSSTGI-----LGDLSFLIVLAYG----SHLVLQGGLSVGDLTAF 399
             +F   +   N +F F ST       L  +   IVLA      S +  +  LS G +   
Sbjct: 1159 INFNNVQFNINCSFNFRSTNRWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLL 1218

Query: 400  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEI 455
            M Y     S++  +     ++     +  R++E  + T +    I+    K   PS GEI
Sbjct: 1219 MSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEI 1278

Query: 456  KFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
             F++ S  Y T+ G+     +N +I+P   + VVG +G GKST++  L R  +   G I 
Sbjct: 1279 IFKNYSTKYKTK-GDLALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIE 1337

Query: 516  IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL-------TYGMNSEVTMDEIRSVA 568
            IDG +ISK+  K LR HLG++ Q+     G++R NL       T  + + + +  ++   
Sbjct: 1338 IDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHI 1397

Query: 569  KKCFCHGFITKFPEGYETV----IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSA 624
             + F     ++ P   E +    I   G +LS GQ+Q + ++RAL+   K+L+LDEAT+A
Sbjct: 1398 VEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAA 1457

Query: 625  LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYA 684
            +D+E++  I  T+   +  +E TI++IAHR+ T+  S+ +IVL + G V E    + L +
Sbjct: 1458 VDMETDKIIQETIRSEL--KEKTILTIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLS 1514

Query: 685  NDQSELFKL 693
            N QS  + L
Sbjct: 1515 NKQSIFYAL 1523

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 119/224 (53%), Gaps = 15/224 (6%)

Query: 478 FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH--LGV 535
           F  + G   C+VG  G GKST+   +L       G++     ++  L  K L R   +  
Sbjct: 644 FQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIRASTVAY 696

Query: 536 VQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASL 595
             QEP +M+ SI+ N+T+G   + T     +  K C     +   PE   T++G +G SL
Sbjct: 697 CPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVGEKGISL 754

Query: 596 SGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLM-RSRELTIISIAH 653
           SGGQK RI++ARA+  +  + +LD+  SA+D E S+  +   L + M   R  T++   +
Sbjct: 755 SGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNKTVVLTTN 814

Query: 654 RLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ-SELFKLLND 696
            +S + RS+ + +L   GS+VE G F E+ ++ + S+L K++++
Sbjct: 815 AISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  172 bits (435), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 136/510 (26%), Positives = 235/510 (46%), Gaps = 14/510 (2%)

Query: 182  IFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLS 241
            +  GI  F  + NF ++ LL  + E+ V +LR N+++ ++ +D  +  +NK  ++ +   
Sbjct: 766  VVIGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTM 825

Query: 242  SDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGAL-IYGKK 300
            +D   +    +  +S                      LT  + L   PL +G + +YG  
Sbjct: 826  NDLRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLT-LVCLSLLPLFIGVITLYGMF 884

Query: 301  IRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN 360
            ++    + + +   L  +  E + GVKTI+    E     RY    + +    ++ ++  
Sbjct: 885  VQKSEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILY 944

Query: 361  ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420
             +  + T  L  L   I+  YG  LV+ G      L        +T  +  GL +     
Sbjct: 945  GSGLAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSS 1004

Query: 421  MKGAGAASRLFEMT-------DHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIF 473
             +G  A + +F M        D+ S +   +   +      +    ++F+YP     QI+
Sbjct: 1005 SRGQRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIY 1064

Query: 474  NKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHL 533
               N  I  G+ V +VG SG GKST+  L+   Y      + IDG +I      +LR+ +
Sbjct: 1065 KNFNLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKII 1124

Query: 534  GVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGA 593
             VV+Q+P   +G+IR NL YG+   +T +EI  V  +     F+   PEG ET +     
Sbjct: 1125 AVVEQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN-- 1182

Query: 594  SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
             +SGGQ QR++I RAL+++P +LILDE TSALD  +  AI   +   +   ++T+I I H
Sbjct: 1183 LVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITH 1240

Query: 654  RLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
                ++  + ++VL N G+V E G F +L+
Sbjct: 1241 SKQMMKMCDRIVVLKN-GAVAEDGSFDDLF 1269

 Score =  142 bits (358), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 135/555 (24%), Positives = 253/555 (45%), Gaps = 27/555 (4%)

Query: 203 VLGEKLVARLRSNVIKKIIHQDAEFFDR----NKVGDLISRLSSDAYVVSRSMTQNVSDG 258
           +LGE+   R+R  +++  + +  +++D+    N +  + +R   +A     S  +     
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEA---RASCAEASGVL 153

Query: 259 FKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKV 318
           F++              SA LT      AP L +  +++ K ++  +    E T + +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 319 SEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIV 378
               L+    ++ F  +  EL ++N A+     +  +  + ++   ++   L  + F+  
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMFVQA 273

Query: 379 LAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTS 438
             YGS L+ +  +    +      +    S++  + +    L KG  A  ++ E  +   
Sbjct: 274 FWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEP 333

Query: 439 QIKPSS-GKPY----------VPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVC 487
           + +P+    PY           PS  EI F+ VSF+YP RP  +  + ++ T  P     
Sbjct: 334 EGRPNQYAFPYEVGHIIALEDQPS--EIVFDQVSFNYPARPDTKALDGVSLTFRPNQITF 391

Query: 488 VVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI 547
           +VG SG GKST+ +LLL++Y    G I ++  N+  +    L +++ +V+Q   L +G++
Sbjct: 392 IVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTL 451

Query: 548 RYNLTYGMNS-EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
             N+T        T   ++   +       +   PEG  T +G  G S+SGGQ+QR+A+A
Sbjct: 452 FENITLSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALA 511

Query: 607 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
           RA+++   +LILDEA SALD+     +   + R  R+ + TII + H LS +   ++ + 
Sbjct: 512 RAILRDAPVLILDEAISALDIIHRDLLMEVI-RSWRADKTTII-LTHELSHV-LDDDYLY 568

Query: 667 LGNDGSVVEMGKFKELYANDQSE---LFKLLNDKKPTQLQSQSRNSVETKENEVDDQVLE 723
           +   G V+E G   EL +N  S    L +L N K    L+ +   ++E K  + DD +  
Sbjct: 569 MMEHGQVIEQGYKSELLSNPNSRFRALNRLQNSKNERALEERRSFAIENKLEQEDDAISS 628

Query: 724 QVANDFNLDQKSSKL 738
             A D   D   S++
Sbjct: 629 TSAGDDKFDTIGSRI 643

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  167 bits (423), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 193/379 (50%), Gaps = 17/379 (4%)

Query: 326  VKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHL 385
            +KTI+    E + +  Y     K    G+K AL      + +  L  ++  I+L YG  L
Sbjct: 924  IKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKL 983

Query: 386  VLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSS- 444
            V+ G  S   +   +    +T      L     E+ +G  AA+ LF + D  +Q   ++ 
Sbjct: 984  VITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANL 1043

Query: 445  -GKPYVPSWGE-----IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKST 498
             G+  + S G      I  +D+ FSY       ++  LN +++ G  V +VG SG GKST
Sbjct: 1044 EGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKST 1103

Query: 499  IASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSE 558
            +  L+ R Y   SG I  DG ++++    +LR+ + VV+Q P L  GSI  NLTYG+++ 
Sbjct: 1104 LWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTS 1163

Query: 559  VTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
            V   EIR + +      F+   P G ++ I      LSGGQ QR+AI RAL++KP++L+L
Sbjct: 1164 VDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVL 1221

Query: 619  DEATSALDVESEGAINYTLGRLMR--SRELTIISIAHRLSTIRRSENVIVLGNDGSVVEM 676
            DE TSALD +      + +   +R  S+  T + + H    +R    ++   N G+++E 
Sbjct: 1222 DECTSALDAQH----GFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIED 1276

Query: 677  GKFKELYANDQSELFKLLN 695
            G F+ LY+  + ELFK+L+
Sbjct: 1277 GSFERLYSQ-KGELFKILS 1294

 Score =  160 bits (405), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 153/596 (25%), Positives = 264/596 (44%), Gaps = 38/596 (6%)

Query: 117 RHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFSGPMTLE--DLPPIIYGL 174
           + DW LL V    +T+ S     +P V  I+   V N       P   E   +  +++ L
Sbjct: 19  KQDWSLLVV----ITVCSVAYGLVPAVTSILTGTVFNL---LQQPAAREFGSVNALMHEL 71

Query: 175 GMFDFLAIFAGI----LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR 230
            +     +  GI    L + +++ +        LGE+   RLR  +++  + +   ++D 
Sbjct: 72  ALRSMAILATGIASIPLCWLSVSAW------MSLGERQAFRLRRKMLQSYLDKSMAWYDA 125

Query: 231 NK--VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAP 288
           N+   GD  ++L+     +  S  ++ +  F+               S SLT  + +   
Sbjct: 126 NEQISGDF-TQLNRCVEELRSSSAESSAIVFQNVVTVAALLGSALYYSWSLT-LIIMANS 183

Query: 289 PLLVG-ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR 347
           PL++G A+ + +K+   ++     T +        L   K ++    + +EL R+   ++
Sbjct: 184 PLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWSLDAAKMVRLLGTQDRELARFEACVQ 243

Query: 348 KVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTG 407
           K      K +L ++  +S    L    F+    YG+  +  G L  GD+           
Sbjct: 244 KCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWYGNSRINIGKLKPGDVVTCFSSCVLLA 303

Query: 408 SAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK--------PYVPSWGEIKFED 459
           S +    +    L KGA    ++    +     +    K        P       I F++
Sbjct: 304 STLNSTLHQIIILQKGAVGLQKIMAFVNSRDASESQKNKVEISFRRLPLCWERASITFQN 363

Query: 460 VSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQ 519
           V F+YPTRP + +   ++     G    V+G SG GKSTI +LLL +Y   SG I ++GQ
Sbjct: 364 VHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQ 423

Query: 520 NISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFCHGFI 577
           ++ +++   L R++ +V+Q   L + ++  N+T G  + V  DEIR     +       I
Sbjct: 424 DVKEINQSELARNIMLVEQTTSLFTETLANNVTIG-EAGVDDDEIRLKQACQMAMLGNII 482

Query: 578 TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
               +G ET IG  G  LSGG++QR+A+ARA  +   ILILDEA SA D   +  +   +
Sbjct: 483 RDLAKGLETTIGCSGLDLSGGEQQRVALARAYFRNAPILILDEALSAQDRIHKSLLMEAI 542

Query: 638 GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
            R  R+ + TII + H LS I  ++ V V+ +DG + E G    L +N +SE   L
Sbjct: 543 -RKWRADKTTII-LTHELSDILDTDYVYVM-SDGQIREHGYKSGLLSNPKSEFSNL 595

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 148/538 (27%), Positives = 243/538 (45%), Gaps = 24/538 (4%)

Query: 176  MFDFLAIFAGILVFGTIANFGR-IVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            ++ +L I+  +    +++   R I L      K  ARL   + K ++     FF+   VG
Sbjct: 980  IWKYLGIYFLLCFSASLSTLLRSITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVG 1039

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +++R S+D Y V   + ++ S  F                  S+T     F  PL V  
Sbjct: 1040 RILNRFSNDIYKVDELLGRSFSQFF----IHVTKVVFTMIVICSITWQFIFFILPLSVLY 1095

Query: 295  LIYGKKIRMISRELQESTGNLTKVS-----EEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
            L Y +     SREL+    ++TK       +E L+GV T+++F  + + +H   + I   
Sbjct: 1096 LFYQQYYLRTSRELRR-LASVTKSPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTY 1154

Query: 350  FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSA 409
                      N         +G +  L         + QG L+ G L   + Y      +
Sbjct: 1155 MCAYYLSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQS 1214

Query: 410  VFGLSNFYSELMKGAGAASRLFEMTD---HTSQIKPSSGKPY-VPSWGEIKFEDVSFSYP 465
            +  +     E+     +  R+ E TD       I P+S  P   P+ G+IKFE  S  Y 
Sbjct: 1215 LNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEHFSTRY- 1273

Query: 466  TRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKL 524
             RP  + I   +N  I P   V +VG +G GKS++   L R  +  +GRI+ID   I  +
Sbjct: 1274 -RPELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSI 1332

Query: 525  SCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF-PEG 583
                LR  L ++ Q+  +  G+ R N+     ++ T DEI +  +       +     EG
Sbjct: 1333 GLNDLRSSLSIIPQDSEVFEGTFRENI--DPCNKFTDDEIWNALELAHLKQHVMTLGTEG 1390

Query: 584  YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
              T +   G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T+    + 
Sbjct: 1391 LNTSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKD 1450

Query: 644  RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQ 701
            R  TI++IAHRL+TI  S+ ++VL + G + E      L  ++ S  + L N+   T+
Sbjct: 1451 R--TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDETSIFYSLCNEAGLTE 1505

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 127/276 (46%), Gaps = 26/276 (9%)

Query: 447 PYVPSWGEIKFE---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASL 502
           P V   G+I      D ++ +  +P  ++    +NF    G   C+VG  G GKS +   
Sbjct: 604 PKVEEIGDISVNISGDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQA 663

Query: 503 LLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD 562
           +L             G         +L   +  V Q   +M+G+I+ N+ +G   +    
Sbjct: 664 ML-------------GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDAEFY 710

Query: 563 EIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
           E     K C     +   P+G +T +G RG SLSGGQK R+A+ARA+  K  +  LD+  
Sbjct: 711 E--KTIKACALSLDLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPL 768

Query: 623 SALDVE-SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
           +A+D   S+  + Y +G     +  T I   +++  +  ++++ +L N G +V+ G + +
Sbjct: 769 AAVDEHVSKHLVKYVIGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQ 827

Query: 682 LYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEV 717
           + +N  S LFKL+ +        Q   ++E  E+ V
Sbjct: 828 VNSNKDSPLFKLIAN-----FGKQKSQAIENNEDTV 858

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  164 bits (415), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 150/556 (26%), Positives = 253/556 (45%), Gaps = 65/556 (11%)

Query: 176  MFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGD 235
            MF +LAI+  I    ++ +  + +L  V G     ++ + +++K++H    FFD   +G 
Sbjct: 1142 MFYYLAIYFLIGFAQSVLSAFKTILSFVAGLNASKKIFNLLLQKVLHAKLRFFDSTPIGR 1201

Query: 236  LISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGAL 295
            +++R S D   V + +T      F +                S    +    P  L+ A+
Sbjct: 1202 IMNRFSKDIEAVDQELTPFFEGAFYSLVT-----------CLSTVVLITFITPQFLIVAV 1250

Query: 296  IYGKKIRMI-------SRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK----ELH 340
            I       I       SREL+     S   + +   E L GV TI+AF  E +     LH
Sbjct: 1251 IVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDESRFIQENLH 1310

Query: 341  RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ-----GGLSVGD 395
            + +   R  F       + N        ++G L   +V   G  ++L       G++   
Sbjct: 1311 KIDENNRPFFYLW----VANRWLAMRIDLIGSL---VVFGAGVFILLNIDHIDAGMAGIS 1363

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE--MTDHTSQIKPSSGKPY-VPSW 452
            LT  + +TE        L   YS +     +  RL E  + +     +P    P   P  
Sbjct: 1364 LTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIMTPPSDWPQH 1419

Query: 453  GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            G ++  DVS  Y P  P  ++   ++FT+EP S V VVG +G GKSTI + L R+ DP +
Sbjct: 1420 GRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITALFRFLDPET 1477

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE----VTMDEIRS 566
            G I ID  +IS +  + LRR + ++ Q+P L +G+I+ NL  Y   S+      +  +  
Sbjct: 1478 GHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDIFAALKRVNL 1537

Query: 567  VAKKCFCHGFITKFPEGYETV---------IGPRGASLSGGQKQRIAIARALIKKPKILI 617
            V+++      I     G E V         I   G +LS GQ+Q + +AR+L++ PKI++
Sbjct: 1538 VSQEELDRSNIDAASVGSENVNKFLDLNSEINEGGGNLSQGQRQLVCLARSLLRSPKIIL 1597

Query: 618  LDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
            LDEAT+++D +S+  I  T+ +  +    TI++IAHRL ++   + ++V+ + G V E  
Sbjct: 1598 LDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM-DQGEVKEYD 1654

Query: 678  KFKELYANDQSELFKL 693
                L  N  S+ + +
Sbjct: 1655 HPYSLLLNKNSQFYSM 1670

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 113/233 (48%), Gaps = 9/233 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P   ++ FE+ + S+ +   +     LN   + G    V+GP+G GK++I   LL     
Sbjct: 741 PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKL 800

Query: 510 NSGRIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
            +G I++   D + +  +    +   +    Q   L++ ++R N+ +  NS  +      
Sbjct: 801 LNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILF--NSPYSEARYND 858

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG RG +LSGGQKQRI++AR+L    + L+LD+  SA+D
Sbjct: 859 VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             +   I  N   G LM+ R  T I I+H ++   R+  ++VL  +G V E G
Sbjct: 919 SHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  161 bits (408), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 143/529 (27%), Positives = 238/529 (44%), Gaps = 15/529 (2%)

Query: 176  MFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR--NKV 233
            +  F  I + I +   ++ F ++  L   GE  +  LR     KII     +F +  NK 
Sbjct: 704  LLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKA 763

Query: 234  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
              L + L +D   +   +T+ +S                      L+       P ++V 
Sbjct: 764  PILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVL 823

Query: 294  ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
              +YG  +       + S  NL  +  E + G+KTIQ+   +     ++N  I+ +   G
Sbjct: 824  TGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNG 883

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
               A+      + T +L  L   I+  YG  LVL G  +   L   +    +T   V  L
Sbjct: 884  TYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVASL 943

Query: 414  SNFYSELMKGAGAASRLFEMT--DHTSQIKPSSGKP-----YVPSWGEIKFEDVSFSYPT 466
                 ++ +G  + S + ++   D+   I+P S        + P+   I+  ++SF+Y  
Sbjct: 944  VTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSFTYAQ 1003

Query: 467  RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC 526
                +    +N  +       +VG SG GKST+ +L+   Y  + G I I   +I+K S 
Sbjct: 1004 VHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWST 1063

Query: 527  KSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYET 586
            K L + + ++QQ P+L   +IR NL YG+   V  + + +V +      FI     G ++
Sbjct: 1064 KELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDS 1123

Query: 587  VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
             +    + LSGGQ QR+ +AR +++ PK+LILDE TSALDV S   IN  +G   RS   
Sbjct: 1124 KLD--DSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAP 1179

Query: 647  TIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
              I ++H+  TI+  + +  L  DG+V  MG ++EL  N+  E  KLLN
Sbjct: 1180 VTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMENNW-EFRKLLN 1226

 Score =  157 bits (396), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 198/398 (49%), Gaps = 15/398 (3%)

Query: 276 SASLTSALFLFAPPLLVGALIYGKKI-RMISRELQESTGNLTKVSEEQLSGVKTIQAFVA 334
           S SLT  +F   P +++ A+I+ K I +   +E  ES     +++   L  ++ ++    
Sbjct: 172 SWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNG 230

Query: 335 EGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVG 394
           +  E+  Y + I +   +  K +L  +   S   +L  L F+    +GS ++ QG L++ 
Sbjct: 231 DDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNID 290

Query: 395 DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ-----IKPSSGKPYV 449
            +          GS +         L KG  A  RL +M D T +     I   SG   +
Sbjct: 291 SVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLL 350

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P    I F +VSF YP R  +++F+K+NF I+P     V+GPSG GKST+  L+L +YD 
Sbjct: 351 P----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDN 406

Query: 510 NSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMN--SEVTMDEIRSV 567
             G IM+   +I  ++   +  ++ +V Q P L + +IR N+    N  +  +  E+  +
Sbjct: 407 YHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECI 466

Query: 568 AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            K       I + P+G +T IG  G  LSGGQ Q++A+ARA  +   IL+LDE  SA+D+
Sbjct: 467 CKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDM 526

Query: 628 ESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVI 665
                +   + R  R+ + T+I I H L  IR ++N++
Sbjct: 527 RQRIVLMENIKR-WRNGKTTVI-ITHDLEFIRNTDNIL 562

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 152/568 (26%), Positives = 262/568 (46%), Gaps = 78/568 (13%)

Query: 175  GMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            G+  FL ++  I V  +I    +  +  + G +    +  +++ +++H    FFD   +G
Sbjct: 1088 GIAKFLVVYCLIGVMSSIIGSIKTFVNSLFGIRASKLIFDSLLDRVLHARVRFFDSTPIG 1147

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +++R S D   + + +  N+   F +               + +T A F  A  +++G 
Sbjct: 1148 RIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLI----SYITPAFFPVAIIIVLGY 1203

Query: 295  LIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVF 350
             I G      SREL+     S   + +   E L GV TI+AF   G E  R+   I++  
Sbjct: 1204 SIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAF---GDE-QRF---IKENL 1256

Query: 351  SFGKKEALTNATFFSSTGILGDLSF-------LIVLAYGSHLVLQ-----GGLSVGDLTA 398
            S   + ++    FF    +   LSF       L++ + G  ++L       GL+   LT 
Sbjct: 1257 SMIDQNSMP---FFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINNIDAGLAGISLTY 1313

Query: 399  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE---------MTDHTSQIKPSSGKPYV 449
             + +TE    A   L   YSEL     +  R+ E         + D  + + P    P  
Sbjct: 1314 AISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTPP---PQW 1366

Query: 450  PSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYD 508
            P  G+++  ++S  Y P  P   +   + FTIEP   V +VG +G GKSTI + L R+ +
Sbjct: 1367 PDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLE 1424

Query: 509  PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNS---------- 557
             ++G I +DG NI+ +  K LRR + ++ Q+P L +GSIR NL  Y   S          
Sbjct: 1425 ADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKR 1484

Query: 558  ---------EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
                     E +  EI+S + K      + KF    E+ I   G++ S GQ+Q + +AR+
Sbjct: 1485 VNLVSTEEMEASTSEIQSNSSKN-----VNKFL-NLESEIAEGGSNFSQGQRQLMCLARS 1538

Query: 609  LIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLG 668
            L++ PK+++LDEAT+++D  S+  I  T+ +   +   T+++IAHRL +I   + ++V+ 
Sbjct: 1539 LLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIVDYDKILVM- 1595

Query: 669  NDGSVVEMGKFKELYANDQSELFKLLND 696
            + G V E      L    +S  + +  D
Sbjct: 1596 DAGEVKEFDHPYSLLLEKKSIFYNMCED 1623

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 109/235 (46%), Gaps = 9/235 (3%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + FE+V+  + +   + +   L+     G    +VG +G GK++I   LL     + G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 515 MIDG---QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
           ++     ++  +     +   +    Q   L++ ++R N+ +  N+        +V + C
Sbjct: 766 IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILF--NAPFDQARYDAVVEAC 823

Query: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
                      G  T IG +G +LSGGQKQR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824 SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 632 AI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYA 684
            I      G LM  R  T I + H ++   ++ + +V+  DG V E G   EL A
Sbjct: 884 WIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLA 936

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 154/556 (27%), Positives = 258/556 (46%), Gaps = 53/556 (9%)

Query: 173  GLGMFDFLAIFAGI-LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
             + ++ F+ I+A I +      N   I+LL     +   +L  N+   I++   +FF+  
Sbjct: 1000 NIDVWKFVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETT 1059

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R S+D   V  ++       FK+                +++  LFL     L
Sbjct: 1060 PIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILI-----TISMPLFLVFCLFL 1114

Query: 292  VGALIYGKKIRMI-SRELQESTG----NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346
            +   IY +K+ ++ SREL+  T      +  +  E L G+  I+A+  +   + +Y N  
Sbjct: 1115 MVIYIYYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNE 1172

Query: 347  RKVFSFGKKEALTNATF-FSSTGI-----LGDLSFLIVLAYG----SHLVLQGGLSVGDL 396
            R  F+        N  F + ST       L  +  L+VL  G    S +     L+ G +
Sbjct: 1173 RVQFNI-------NCVFDYRSTNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMV 1225

Query: 397  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ-------IKPSSGKPYV 449
               M Y     +++  +      +  G  +  R+ E  +  S+        +P+S  P  
Sbjct: 1226 GLLMSYVLQVTTSLMWIVRSSVMIETGIVSVERIMEYCELPSEAEQIVDDYRPASNWP-- 1283

Query: 450  PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
             S G I+F++ S  Y     + +   ++  I PG  V +VG +G GKST+   L R  +P
Sbjct: 1284 -SKGAIQFKNYSTRYRANL-DPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEP 1341

Query: 510  NSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------VTMD 562
              G I+IDG +ISK+    LR HL ++ Q+     G++R NL  + M S+      +T+ 
Sbjct: 1342 IEGTIIIDGMDISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLS 1401

Query: 563  EIRSVAKKCFCH-GFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEA 621
             ++   KK     G      +  E  I   G+SLS GQ+Q + +ARAL+ + KIL+LDEA
Sbjct: 1402 HLKPHLKKLMEESGSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEA 1461

Query: 622  TSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            T+++DVE++  I  T+      R  TII+IAHR+ T+  S+ ++VL   G V E      
Sbjct: 1462 TASVDVETDKIIQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPAS 1518

Query: 682  LYANDQSELFKLLNDK 697
            L A D+S LF  L +K
Sbjct: 1519 LLA-DKSTLFYQLCEK 1533

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 110/224 (49%), Gaps = 32/224 (14%)

Query: 487 CVVGPSGRGKSTIASLLLRYYDPNSG-------RIMIDGQNISKLSCKSLRRHLGVVQQE 539
           CVVG  G GK+T+   +L      SG       +++I G++++   C           QE
Sbjct: 663 CVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESVAY--CP----------QE 710

Query: 540 PMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQ 599
             +M+ SI+ N+ +G   + T   +    K C         P+G  T++G +G +LSGGQ
Sbjct: 711 AWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQ 768

Query: 600 KQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-----RELTIISIAHR 654
           K R+++ARA+  +  I +LD+  SA+D     +I   + R++ S     +   II   + 
Sbjct: 769 KARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSI---IHRVLDSDTGLLKNKAIILTTND 825

Query: 655 LSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSE--LFKLLND 696
           +S +  S+ + VL  DG ++E   + E   ++  +  L+KLL +
Sbjct: 826 ISVLEHSDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 153/549 (27%), Positives = 255/549 (46%), Gaps = 81/549 (14%)

Query: 205  GEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 264
            G +   ++ +N++  ++H    FFD   VG +++R S D   V + +   +         
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLE-------- 1118

Query: 265  XXXXXXXXXXXSASLTSALFLFAPPLLVGALIY-------GKKIRMISRELQESTGNLTK 317
                        AS+   + +  P  L  A+I        GK     SREL+    ++TK
Sbjct: 1119 ---VTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKR-LDSITK 1174

Query: 318  VS-----EEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGD 372
                    E L GV TI+AF  E + +    N I +           N  FF  +  +  
Sbjct: 1175 SPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQ----------NNRAFFYLSVTVKW 1224

Query: 373  LSF-------LIVLAYGSHLVLQ-----GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420
             SF        IVLA GS ++L       GL+   LT  +L+T+        L   YS  
Sbjct: 1225 FSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTF 1280

Query: 421  MKGAGAASRLFEMT--DHTSQIKPSSGKPYV---PSW---GEIKFEDVSFSY-PTRPGNQ 471
                 +  RL E +  +  + +    G+  +   PSW   GEI+ E++S  Y P  P   
Sbjct: 1281 EMNMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLP--P 1338

Query: 472  IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR 531
            +   ++F ++P S + +VG +G GKSTI + L R  +P +G I IDGQ+ISK+   +LRR
Sbjct: 1339 VIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRR 1398

Query: 532  HLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHGF--ITKFPEGY---- 584
             + ++ Q+P+L +G+I+ N+  Y    E  + +  S       H F  +    E +    
Sbjct: 1399 SITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTH 1458

Query: 585  ------ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638
                   T I   G +LS G++Q + IAR+L+++PKI++LDEATS++D +S+  I     
Sbjct: 1459 NKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQ---- 1514

Query: 639  RLMRSR--ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
             ++RS   + TI++IAHRL ++   + +IV+ + G V E  +  EL  +++   + +  D
Sbjct: 1515 GIIRSEFNKSTILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKDERGIFYSMCRD 1573

Query: 697  KKPTQLQSQ 705
                +L  Q
Sbjct: 1574 SGGLELLKQ 1582

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 110/445 (24%), Positives = 196/445 (44%), Gaps = 66/445 (14%)

Query: 321 EQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKE-----------ALTNATFFSSTGI 369
           E L  ++ ++ F  E        N I ++ S  +KE           ++T+  +F +  +
Sbjct: 532 ECLQNIRIVKYFAWE-------RNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTL 584

Query: 370 LGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASR 429
           +  ++F I   +  H  L   L+   L+ F L      + +  LSN  S + +   +  R
Sbjct: 585 VTGVTFAIC-TFVQHEDLNAPLAFTTLSLFTLL----KTPLDQLSNMLSFINQSKVSLKR 639

Query: 430 LFEM-----TDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKL---NFTIE 481
           + +      T+  +Q+  S      P   +I+F++ + ++     +    KL   N   +
Sbjct: 640 ISDFLRMDDTEKYNQLTIS------PDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQ 693

Query: 482 PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI---DGQNISKLSCKSLRRHLGVVQQ 538
            G    ++G +G GKS +   LL   +  SG I++   + ++     C+ L        Q
Sbjct: 694 IGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQ 753

Query: 539 EPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGG 598
              L++ +++ N+ +  ++    D    V   C     +   P G  T IG +G +LSGG
Sbjct: 754 SAWLLNDTVKNNIIF--DNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGG 811

Query: 599 QKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISIAHRLS 656
           QKQRI++ARA+    K ++LD+  SA+D  +   I  N   G LM++R  T I + H +S
Sbjct: 812 QKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGPLMKNR--TCILVTHNVS 869

Query: 657 -TIRRSENVIVL-----GNDGSVVEM---GKFKELYANDQSELFKLLNDKKPTQLQSQSR 707
            T+R +   IVL      N G++ E+   G FKE Y    S     +N+K   +L++  +
Sbjct: 870 LTLRNAHFAIVLENGKVKNQGTITELQSKGLFKEKYVQLSSR--DSINEKNANRLKAPRK 927

Query: 708 NSVETKENEVDDQVLEQVANDFNLD 732
           N         D Q +E V  + N D
Sbjct: 928 N---------DSQKIEPVTENINFD 943

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 155/603 (25%), Positives = 272/603 (45%), Gaps = 57/603 (9%)

Query: 119 DWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKN-----------ASGGFSGPMTLEDL 167
           DW LL +    ++I S     +P V  I++ AV N           +       +T+  +
Sbjct: 25  DWWLLMI----ISICSVAYGIVPAVTSILMGAVFNLLQKPVIQQFDSVNTLMRDLTIRTM 80

Query: 168 PPIIYGLGM--FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDA 225
             +I G+    F +L+I+A +                 LGE+   RLR  +++    +  
Sbjct: 81  AILITGIASIPFCWLSIYAWM----------------SLGERQGFRLRRKLLRSYFEKSM 124

Query: 226 EFFDRN-KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALF 284
            ++D N ++    ++L+     +  S  +  +  F+               S SLT  + 
Sbjct: 125 AWYDINEQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLT-LVI 183

Query: 285 LFAPPLLVGALIY-GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
           +   PL++G  IY  + +    +     T     +    L+  K ++    +  E+ ++ 
Sbjct: 184 MANSPLVIGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFR 243

Query: 344 NAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYT 403
            ++ K      K +L ++  +S    L    F+    YG+  +  G L  GD+       
Sbjct: 244 ASVLKCRMNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCFSSC 303

Query: 404 EYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIKP----SSGKPYVPSWGEIKFE 458
               S +    +    L KGA    ++ E +T    Q K     S   P +    +I FE
Sbjct: 304 ILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFE 363

Query: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
           +VSF+YP+R  + +   LN  +  G    +VG SG GKSTI++LLL+ Y P SG I ++ 
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVND 423

Query: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS---VAKKC---F 572
            +I +++ + L R + +V+Q   L   SI+ N+      ++T DE R    +++ C    
Sbjct: 424 VDIREINQQDLFRSITLVEQNSPLFEDSIKNNI------QLTSDEHRDDGRLSQACQAAM 477

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632
             G I    +G +T+IG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  
Sbjct: 478 LEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDL 537

Query: 633 INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
           +   + R  R    TII + H L+ I   ++ ++L  DG+V+E G+  +L ++  S+ F 
Sbjct: 538 LMEAI-RFWRKGRTTII-LTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSK-FS 593

Query: 693 LLN 695
           LL+
Sbjct: 594 LLH 596

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 134/517 (25%), Positives = 237/517 (45%), Gaps = 31/517 (5%)

Query: 195  FGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD--RNKVGDLISRLSSDAYVVSRSMT 252
            F +  +L   GE  +  LR N  + ++ +D  +F    N   ++ S + +D     R + 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----RDLR 845

Query: 253  QNVSDGFKAXXXXXXXXXX----XXXXSASLTSALFLFAPPLLVGALIYGKKIRMISREL 308
               S+   A                     L+       P  ++ + IYG  ++      
Sbjct: 846  ALASEFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARY 905

Query: 309  QESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG--KKEALTNATFFSS 366
            +     L     + +  +KTI+    E K    Y   + +V S G  +K A+      +S
Sbjct: 906  KTCIAELENELYKAIRCMKTIKCLQMENKVARSYE--MLEVTSKGAARKRAMGTGFGVAS 963

Query: 367  TGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426
            +  L  ++  I+L +G  LV+ G  + G +   +    +T      L +   E+ +G  A
Sbjct: 964  SNALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRA 1023

Query: 427  ASRLFEM--TDHT--SQIKPSSGKPYVPSWGE---IKFEDVSFSYPTRPGNQIFNKLNFT 479
            A+ LF++   +H   + +      P + +  +   I  + + FSY       ++  L+  
Sbjct: 1024 ATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLK 1083

Query: 480  IEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQE 539
            ++ G  V ++G SG GKST+ SLL R Y   +G I IDG +I++   K+LR  + VV+Q+
Sbjct: 1084 VDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQK 1143

Query: 540  PMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQ 599
            P+  SGSI  NLTYG+  +V+ +E+  +        F+   P+   +VI  +   LSGGQ
Sbjct: 1144 PLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQ 1201

Query: 600  KQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSR--ELTIISIAHRLST 657
             QR+AI RAL++KP++L+LDE TSALD       ++ +   ++      T + + H    
Sbjct: 1202 VQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQM 1257

Query: 658  IRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
            +R    ++   N G +VE G    L+ N + EL+++L
Sbjct: 1258 MRSCHRILTF-NKGEIVEEGSIDNLF-NQKGELYRIL 1292

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 155/535 (28%), Positives = 246/535 (45%), Gaps = 57/535 (10%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
            N   I++L     +   +L  ++ K +I     FF+   VG +I+R SSD   V  S+  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 254  NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMI-SRELQE-- 310
              S  FK+                      FL     L+G  IY +   ++ SREL+   
Sbjct: 1096 IFSFFFKSILTYLVTVIL-----VGYNMPWFLVFNMFLLGIYIYYQTFYIVLSRELKRLI 1150

Query: 311  --STGNLTKVSEEQLSGVKTIQA------FVAEGKELHRYNNAIRKVFSFGKKEALTNAT 362
              S   +  +  E L+G   I A      F+    E  +YN  I  VF+F       +  
Sbjct: 1151 SISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVR 1208

Query: 363  F--FSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420
                 +T +L   + L +    +   L  G+ VG L ++ L  E TGS  + +    + +
Sbjct: 1209 LQTIGATIVLAT-AMLTLATMNTKKQLSSGM-VGLLMSYSL--EVTGSLTWIVR---TTV 1261

Query: 421  MKGAGAAS--RLFEMTDHTSQ---IKPSS--GKPYVPSWGEIKFEDVSFSYPTRPGNQIF 473
            M      S  R+ E  +  S+   I P     K + PS G I+F+D S  Y     + + 
Sbjct: 1262 MIETNIVSVERIVEYCELPSEAQSINPEKRPDKNW-PSRGSIEFKDYSTKY-RENLDPVL 1319

Query: 474  NKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHL 533
              +N  IEP   V +VG +G GKST++  L R  +P  G+I+IDG NIS L    LR HL
Sbjct: 1320 KDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHL 1379

Query: 534  GVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHGFITKFPEG--------- 583
             ++ Q+     G+++ NL  +   SE   DE++   +       + K  E          
Sbjct: 1380 AIIPQDAQAFEGTVKTNLDPFNRYSE---DELKKAVELAHLKPHLEKMLENEPSDSEESC 1436

Query: 584  -----YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638
                  +  I   G++LS GQ+Q + +ARAL+ + KIL+LDEAT+++D+E++  I  T+ 
Sbjct: 1437 DIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIR 1496

Query: 639  RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
            R  + R  TI++IAHR+ T+  S+ +IVL ++GSV E     +L +N  S  + L
Sbjct: 1497 REFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 117/225 (52%), Gaps = 14/225 (6%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS-KLSCKSLRRHLGV 535
           +F  + G+ VC+VG  G GKST    +L      SG      ++I  KL  +S    L  
Sbjct: 659 HFEAKRGNLVCIVGRVGAGKSTFLKAILGQLPCMSG----SKESIPPKLIIRS--SSLAY 712

Query: 536 VQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASL 595
             QE  +M+ S++ N+ +G   +    ++    K C     +   P+G ET++G +G SL
Sbjct: 713 CSQESWIMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISL 770

Query: 596 SGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSRELTIISIAH 653
           SGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y L G+    +  TII   +
Sbjct: 771 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTN 830

Query: 654 RLSTIRRSENVIVLGNDGSVVEMGKFKELY--ANDQSELFKLLND 696
            +S ++ S+ +  L N G +VE G +  +    N  S+L KLL +
Sbjct: 831 TVSILKHSQMIYALEN-GEIVEQGNYDSVMNRENSTSKLKKLLEE 874

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 170/655 (25%), Positives = 287/655 (43%), Gaps = 115/655 (17%)

Query: 120  WKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVK----NASGGFSG-PM---TLEDLPPI- 170
            WK LS    L  I+  + ++    I   ++ +K    N+    +G P+    LE L P+ 
Sbjct: 980  WKALSALFTLYIITQVLFISQSWWIRYWVNDIKPHIENSGVSINGLPLKGSVLERLGPLK 1039

Query: 171  -----IYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDA 225
                 +Y LGM+  +     +L  G I N          G +   ++  N++  ++H   
Sbjct: 1040 NKHTMLYYLGMYFAIGFIQALL--GGIKNIATFFS----GIQASRKIFDNMLDLVLHAKI 1093

Query: 226  EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFL 285
             FFD   +G +++R + D   V + +T  +                      S+   + +
Sbjct: 1094 RFFDVTPIGRIMNRFAKDIEGVDQELTPYLE-----------VTMFCLIQCTSIIFLITI 1142

Query: 286  FAPPLLVGALIY-------GKKIRMISRELQESTGNLTKVS-----EEQLSGVKTIQAFV 333
              P  L+ A++        G      SREL+    ++TK        E L GV TI+AF 
Sbjct: 1143 ITPHFLIVAVVVFILYYFVGMWYLTASRELKR-IDSITKSPIFQHFSETLVGVCTIRAFG 1201

Query: 334  AEGK----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ- 388
             E +     L + +   R  F      ++    F     I+G     IVLA GS +++  
Sbjct: 1202 DEKRFILENLDKIDQNNRAFFYL----SVAVKWFAFRVDIIGAF---IVLASGSFILINI 1254

Query: 389  ----GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT---------- 434
                 GL+   LT  +L+T+        L   YS       +  RL E +          
Sbjct: 1255 GNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDY 1310

Query: 435  --DHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPS 492
              DH  +++ SS     P  G+I+ +++S  Y +     I N ++FTIEP S V +VG +
Sbjct: 1311 NKDHIQELQQSSW----PEHGQIEVDNLSLRYASNLPPVIKN-VSFTIEPQSKVGIVGRT 1365

Query: 493  GRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL- 551
            G GKSTI + L R  +P +G I IDG +IS++   +LRR + ++ Q+P+L +G+I+ N+ 
Sbjct: 1366 GAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVD 1425

Query: 552  ---------------------TYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGP 590
                                 T  M +   M +  + A+  F +          +T I  
Sbjct: 1426 PCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVN---------LQTEITE 1476

Query: 591  RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
             G ++S G++Q + IAR+L+++PKI++LDEATS++D ES+  I   +         TI++
Sbjct: 1477 GGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS--TILT 1534

Query: 651  IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQ 705
            IAHRL ++   + V+V+ + G + E      L  N+QS  + +  D    QL  Q
Sbjct: 1535 IAHRLRSVIDYDRVLVM-DAGEIKEYDHPYNLLKNEQSIFYSMCRDSGDLQLLKQ 1588

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 116/462 (25%), Positives = 204/462 (44%), Gaps = 54/462 (11%)

Query: 308 LQESTGNLTKVSEEQLSGVKTIQAFVAEG---KELHRY-NNAIRKVFSFGKKEALTNATF 363
           LQ +   + K++E  L  ++ ++ F  E    K++     N +R +F      AL++  +
Sbjct: 522 LQCTDKRIAKLNE-CLQNIRIVKYFAWENNISKDIKSIRQNELRFLFQKALVWALSSFLW 580

Query: 364 FSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKG 423
           F +  ++  ++F I + +  H  L   L+   L+ F L      + +  LSN  S + + 
Sbjct: 581 FVTPTLVTGVTFAIYI-FVQHQELNAPLAFTTLSLFTL----LKTPLDQLSNMLSFMNQS 635

Query: 424 AGAASRLFEM-----TDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKL-- 476
             +  R+ +      T+  +Q+  S      P   +I+F++ + ++     +    KL  
Sbjct: 636 IVSLDRIVKFINEDDTEKYNQLTVS------PDENKIEFKNATLTWNENDKDSTIFKLCG 689

Query: 477 -NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG---QNISKLSCKSLRRH 532
            N T + G    ++G +G GKS +   LL      SG I + G   ++        L   
Sbjct: 690 LNITFQIGKLNLILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLIPDHNGLTNS 749

Query: 533 LGVVQQEPMLMSGSIRYNLTY-GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
                Q   L++ +++ N+ + G   +V   E   V   C     +   P G  T IG +
Sbjct: 750 FAYCSQSAWLLNDTVKNNIIFNGAYDDVRYKE---VIDACGLKRDLEILPAGDSTEIGEK 806

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTII 649
           G +LSGGQKQRI++ARA+    K ++LD+  SA+D  +   I  N   G +M +R  T I
Sbjct: 807 GITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCI 864

Query: 650 SIAHRLS-TIRRSENVIVLGNDGSVVEMGKFKEL--------------YANDQSELFKLL 694
            + H +S TIR +   ++L N G V   G  K+L              Y  D++E  K +
Sbjct: 865 LVTHNVSLTIREAYFAVILEN-GKVKNQGTIKQLEKTGIFKEEIAQMSYKGDRTE--KSV 921

Query: 695 NDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLDQKSS 736
           N+    Q +S S+ +    EN+   + L Q       +QKS+
Sbjct: 922 NETSDLQ-ESDSQKTKGVTENKESGEDLVQKGQLVKDEQKSN 962

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 242/541 (44%), Gaps = 71/541 (13%)

Query: 197  RIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVS 256
            +  L  + G     ++ + ++ K+IH    FFD   +G +++R S D   V + +T  ++
Sbjct: 1179 KTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLT 1238

Query: 257  DGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQE----ST 312
              F +               + +T   F+ A  + +   + G      SREL+     + 
Sbjct: 1239 GAFYSFVECFSTIILI----SWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITK 1294

Query: 313  GNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGD 372
              + +   E L GV TI+AF   G E+      + K+          N  FF        
Sbjct: 1295 SPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKIDE-------NNKPFFYLWVANRW 1344

Query: 373  LSF-------LIVLAYGSHLV-----LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSEL 420
            LSF        +V   G  ++     +  G++   LT  + +TE        L  FYSE+
Sbjct: 1345 LSFRIDMIGSFVVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEV 1400

Query: 421  MKGAGAASRL----------FEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGN 470
                 +  R+          +++ D   +  P+      P  G+I+  D+S  Y      
Sbjct: 1401 EMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANLPR 1456

Query: 471  QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLR 530
             I N ++FT+EP S V VVG +G GKSTI + L R+ DP SG I ID  +I+ +    LR
Sbjct: 1457 VIKN-VSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLR 1515

Query: 531  RHLGVVQQEPMLMSGSIRYNL----------TYGMNSEVTM-------DEIRSVAKKCFC 573
            R + ++ Q+P L +G++++NL           +   + V +        E  +V+ +   
Sbjct: 1516 RAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSM 1575

Query: 574  HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
            H             I   G +LS GQ+Q I +AR+L++ PKIL+LDEAT+++D ES+  +
Sbjct: 1576 HSNNENRFLDLSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARL 1635

Query: 634  NYTL-GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
              T+ G    S   TI++IAHRL ++   + ++V+ + G V+E      L  N  SE +K
Sbjct: 1636 QATIRGEFGNS---TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLNRNSEFYK 1691

Query: 693  L 693
            +
Sbjct: 1692 M 1692

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 109/229 (47%), Gaps = 9/229 (3%)

Query: 454 EIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGR 513
           ++ F++ + S+ T         LN   + G    V+G +G GK+++   LL       GR
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 514 IMIDG-QNISKLSCKS--LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
           I++   +  S L+  S      +    Q   L++ ++R N+ +  NS    +    V + 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILF--NSSFDENRYHKVVEA 875

Query: 571 CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 630
           C           G  T IG +G +LSGGQKQRI++ARAL    K L+LD+  SA+D  + 
Sbjct: 876 CGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSHTA 935

Query: 631 GAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             I  N   G LM  R  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 936 SWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 982

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 146/558 (26%), Positives = 261/558 (46%), Gaps = 68/558 (12%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            +L+I+ GI VF  + +  + ++  V G +   ++ + ++K +++    FFD   +G +++
Sbjct: 1099 YLSIYLGIGVFQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMN 1158

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXS------ASLTSALFLFAPPLLV 292
            R S D   + + +T  +   F +              +      A++   LF F      
Sbjct: 1159 RFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQFLIVAAIVMLLFYFV----- 1213

Query: 293  GALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRK 348
             A  Y    R + R    S   + +   E L G+ TI+AF  E +     + + ++  R 
Sbjct: 1214 -AYFYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRP 1272

Query: 349  VFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ--------GGLSVGDLTAFM 400
             F       + N        ++G L   IVLA GS ++L          G+S+G      
Sbjct: 1273 FFYLW----VCNRWLSYRIELIGAL---IVLAAGSFILLNIKSIDSGLAGISLG------ 1319

Query: 401  LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP--SW---GEI 455
               ++T  A++ +   YS +     +  RL E T  T + +PS+    VP   W   G+I
Sbjct: 1320 FAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYT--TIEQEPSNVGALVPPCEWPQNGKI 1376

Query: 456  KFEDVSFSYPT-RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
            + +D+S  Y    P  ++   + FT++    V +VG +G GKSTI + L R+ DP +G I
Sbjct: 1377 EVKDLSLRYAAGLP--KVIKNVTFTVDSKCKVGIVGRTGAGKSTIITALFRFLDPETGYI 1434

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------------VTM 561
             ID  +I+ +  K LR+ + ++ Q+P L +G+++ NL  Y   SE            V+ 
Sbjct: 1435 KIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEYSEAEIFEALKRVNLVSS 1494

Query: 562  DEI--RSVAKKCFCHGF-ITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
            +E+   S +     H   + KF +  E  +   G++LS GQ+Q I +AR+L++ PK+++L
Sbjct: 1495 EELGNPSTSDSTSVHSANMNKFLD-LENEVSEGGSNLSQGQRQLICLARSLLRCPKVILL 1553

Query: 619  DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            DEAT+++D  S+  I  T+     +   TI++IAHRL +I   + ++V+ + G V E   
Sbjct: 1554 DEATASIDYNSDSKIQATIREEFSNS--TILTIAHRLRSIIDYDKILVM-DAGEVKEYDH 1610

Query: 679  FKELYANDQSELFKLLND 696
               L  N  S  + +  D
Sbjct: 1611 PYSLLLNRDSIFYHMCED 1628

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 117/237 (49%), Gaps = 13/237 (5%)

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIE--PGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
            ++  ++ +F++     NQ F   N TI+   G    +VGP+G GK+++   LL   +  
Sbjct: 697 NKLGLQNATFTWDK--NNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELL 754

Query: 511 SGRIMIDGQNISK---LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSV 567
           +G++ +   N  +   +    +   +    Q   L++ ++R N+ +  N+    +   +V
Sbjct: 755 NGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILF--NAPYNENRYNAV 812

Query: 568 AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
              C           G +T IG +G +LSGGQKQR+++AR+L    + L+LD+  SA+D 
Sbjct: 813 ISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDS 872

Query: 628 ESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
            +   I  N   G LM  R  T + ++H ++   ++ + +++  +G V E G+  EL
Sbjct: 873 HTALWIYENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIMENGRVKEQGEPVEL 927

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 141/533 (26%), Positives = 238/533 (44%), Gaps = 71/533 (13%)

Query: 204  LGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXX 263
            LG K   ++  +++KK++H    FFD   +G +++R S D   + + +   V   F +  
Sbjct: 1133 LGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLV 1192

Query: 264  XXXXXXXXXXXXSASLTSALFLFAPP------LLVGALIY--GKKIRMISRELQE----S 311
                        S   T  L  F  P      +LV  L Y  G      SRE +     +
Sbjct: 1193 ------------SCVTTILLITFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSIT 1240

Query: 312  TGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
               + +   E L GV TI+AF  EG+ +    + I +           N  FF       
Sbjct: 1241 KSPIYQHFSETLVGVTTIRAFGDEGRFMQENLSKIDE----------NNRPFFYLWVANR 1290

Query: 372  DLSF-------LIVLAYGSHLV-----LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSE 419
             LSF       L+V   GS ++     +  G++   LT  + +TE        L   YS 
Sbjct: 1291 WLSFRIDMVGALVVFGSGSFIIWNIKNIDAGMAGISLTYAISFTE----GALWLVRLYSN 1346

Query: 420  LMKGAGAASRLFE---MTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKL 476
            +     +  RL E   +     +    +  P  P  G+I+  D+S  Y      ++   +
Sbjct: 1347 VEMNMNSVERLKEYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSLRY-AEGLPRVIKNV 1405

Query: 477  NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVV 536
             FT+ P + + +VG +G GKSTI + L R+ DP +G I ID  +I+ ++   LRR + ++
Sbjct: 1406 TFTVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINII 1465

Query: 537  QQEPMLMSGSIRYNLT-YGMNSEVTM------------DEIRSVAKKCFCHGFITKFPEG 583
             Q+P L +G+I+ NL  YG  S+  M            D   ++  +      + KF   
Sbjct: 1466 PQDPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFL-N 1524

Query: 584  YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
                I   G++LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +   S
Sbjct: 1525 LNNEISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNS 1584

Query: 644  RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
               TI++IAHRL ++   + ++V+ + G V E      L  N +S  + +  +
Sbjct: 1585 S--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKKSIFYNMCEN 1634

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 113/238 (47%), Gaps = 9/238 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P   +++F++ + S+ +   +     LN   + G    V+GP+G GK+++   LL     
Sbjct: 704 PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKI 763

Query: 510 NSGRIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
             G I++   D +    +        +    Q   L++ ++R N+ +  NS        S
Sbjct: 764 MEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILF--NSPYNEARYTS 821

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG +G +LSGGQKQR+++ARA+    + ++LD+  SA+D
Sbjct: 822 VIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVD 881

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
             +   I  N   G LM  R  T I ++H ++   ++ +++V+  DG V + G   EL
Sbjct: 882 SHTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQGDPMEL 937

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 149/555 (26%), Positives = 248/555 (44%), Gaps = 61/555 (10%)

Query: 168  PPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEF 227
            PP  Y +G++ F  +FA  +        G+  +L V+G      L    +K+I+H    +
Sbjct: 930  PPSFY-MGLYSFF-VFAAFIFMN-----GQYTILCVMGIMASKWLNLKAVKRILHTPMSY 982

Query: 228  FDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA 287
             D   +G +++R + D    + S+   +++  +                        +  
Sbjct: 983  IDTTPLGRILNRFTKD----TDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 288  PPLLVGALIYGKKIRMISRELQESTG--------NLTKVSEEQLSGVKTIQAFVAEGKEL 339
            P LLV  ++     +   RE++            NL +V    L G+ TI+A+ ++ + L
Sbjct: 1039 PFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFL 1094

Query: 340  HRYNNAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
             + +  I K+   G    +       F     I+   + ++ L   +        SVG L
Sbjct: 1095 AKSDFLINKMNEAGYLVVVLQRWVGVFLDMVAIV--FALIVTLLCVTRAFPISAASVGVL 1152

Query: 397  TAFMLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGE 454
              ++L      + +   ++   +++       S   E+       KP    P   PS GE
Sbjct: 1153 LTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESWPSKGE 1212

Query: 455  IKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGR 513
            I  E+V FSY  RPG   +   LN  IE G  + + G +G GKSTI S L R  + ++G+
Sbjct: 1213 IVLENVCFSY--RPGLPVVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGK 1270

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR-------S 566
            I+ID  +ISKL    LRR L ++ Q+P+L  G+IR NL      E T DE+        +
Sbjct: 1271 ILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFDERTDDELWDALVRGGA 1328

Query: 567  VAK------------KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPK 614
            +AK            K   HG + KF    +  +   G++ S G++Q +A+ RAL+++ K
Sbjct: 1329 IAKNDLSEAKLQKPDKNGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSK 1386

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSR-ELTIISIAHRLSTIRRSENVIVLGNDGSV 673
            ILILDEATS++D E++G I     R++    + TI+ IAHRL TI   + ++VL   G V
Sbjct: 1387 ILILDEATSSVDYETDGKIQ---ARIVEEFGDCTILCIAHRLQTIVNYDRILVL-EKGEV 1442

Query: 674  VEMGKFKELYANDQS 688
             E      L+  + S
Sbjct: 1443 AEFDTPWTLFTQENS 1457

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 121/243 (49%), Gaps = 29/243 (11%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  + + GP G GKS++ + +        G+I ++G     L C      
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG---DLLMCGY---- 656

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + +  +R N+ +G  S    ++   V + C     +   P G  T IG RG
Sbjct: 657 -------PWIQNAPVRDNIIFG--SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++  L  ++ ++  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE 711
            H+LS I R+  VIVLG DG  V++G   EL A +Q+ L KL        LQ  S+NS E
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKL--------LQFSSQNSKE 815

Query: 712 TKE 714
            ++
Sbjct: 816 EED 818

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 148/550 (26%), Positives = 249/550 (45%), Gaps = 51/550 (9%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            +LAI+  I V   +    + ++  + G     ++ + V+KK+++    FFD   +G +++
Sbjct: 1101 YLAIYFAIGVLHAVIASSKTIINFIAGLNASRKIFNLVLKKVLYAKLRFFDSTPIGRIMN 1160

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSAS-LTSALFLFAPPLLVGALIY 297
            R S D   V + +T  V   F +              +   L  A+F+     LVG   Y
Sbjct: 1161 RFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYITPGFLVVAIFIGFLYYLVGYF-Y 1219

Query: 298  GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFG 353
                R + R    S   + +   E L G+ TI+AF  E +     L + +   +  F   
Sbjct: 1220 MAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDERRFMLENLQKIDENNKPFFYLW 1279

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ-----GGLSVGDLTAFMLYTEYTGS 408
                + N        ++G     +V A G  ++L       GL+   LT  + +TE    
Sbjct: 1280 ----VANRWLAFRIDMIGAC---VVFAAGVFILLNIKKLDSGLAGISLTYAISFTE---- 1328

Query: 409  AVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP--SW---GEIKFEDVSFS 463
                L   YS +     +  RL E      + +PS+   + P   W   G+I+  D+S  
Sbjct: 1329 GALWLVRLYSNVEMTMNSVERLKEYM--VIEQEPSNDGAFNPPIEWPDQGKIEVNDLSLR 1386

Query: 464  YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
            Y T     I N ++FT++P   V +VG +G GKSTI + L R+ DP +G I ID  +I+ 
Sbjct: 1387 YATNLPRVIKN-VSFTVDPKCKVGIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITS 1445

Query: 524  LSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------------VTMDEIRSVAKK 570
            +  K LR+ + ++ Q+P L SG+++ NL  Y   ++            VT DE+  V   
Sbjct: 1446 IGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEYTDEQIFKALKRVNLVTADELDHVPDS 1505

Query: 571  CFCHGF----ITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
                      + KF +     I   GA+LS GQ+Q + +AR+L++ PKI++LDEAT+++D
Sbjct: 1506 ADNASVNSENVNKFLD-LRNEITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATASID 1564

Query: 627  VESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAND 686
              S+  I  T+       + TI++IAHRL +I   + ++V+ + G V E      L  N 
Sbjct: 1565 YSSDAKIQQTIRE--EFGDSTILTIAHRLRSIIDYDKILVM-DAGEVREYDHPYSLLLNK 1621

Query: 687  QSELFKLLND 696
             S  + +  D
Sbjct: 1622 SSIFYSMCED 1631

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 159/345 (46%), Gaps = 30/345 (8%)

Query: 357 ALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNF 416
           AL +  +F +  I+  +SF   + Y    VL   ++   L+ F L      + +  LS+ 
Sbjct: 602 ALMSLVWFITPSIVTSVSFAFYI-YVQGEVLTTPIAFTALSLFTLLR----NPLDQLSDM 656

Query: 417 YSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKL 476
            S +++   +  R+ E  D     K +       S  +I FE+ +F++  +  +     L
Sbjct: 657 LSFVIQSKVSLDRVQEFLDEEETEKYNQ---LTISRNKIAFENATFAWDKKNPSFKLKNL 713

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI---DGQNISKLSCKSLRRHL 533
           N   + G    V+G +G GK+++   LL   D   G++ +   D +    +    +   +
Sbjct: 714 NVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYVPSLDPREELVIESDGMTNSI 773

Query: 534 GVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGA 593
               Q   L++ ++R N+ +  NS       ++V + C           G +T IG +G 
Sbjct: 774 AYCSQAAWLLNDTVRNNILF--NSPYNETRYKAVVEACGLKRDFEILSAGDQTEIGEKGI 831

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISI 651
           +LSGGQKQR+++ARAL    + ++LD+  SA+D  +   I  N   G LM+ R  T I +
Sbjct: 832 TLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILV 889

Query: 652 AHRLS-TIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
           +H ++ T++ +E V+VL N       G+ K     DQ E   LLN
Sbjct: 890 SHNVALTLKNAEWVVVLDN-------GRIK-----DQGEPLDLLN 922

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  151 bits (381), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 78/569 (13%)

Query: 171  IYGLGMFDFLAIFAGILVFG-TIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD 229
            IY L  + F+ +   ++    TI NF       + G     ++ + ++KK+++    FFD
Sbjct: 1094 IYYLLFYFFIGVAQAVIASSKTIINF-------MAGLNASRKIFNLILKKVLYAKLRFFD 1146

Query: 230  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
               +G +++R S D   V + +T  V   F +               A +T   F  A  
Sbjct: 1147 STPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILI----AYITPDFFFVA-- 1200

Query: 290  LLVGALIY--GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
            + +G   Y  G      SREL+     S   + +   E L G+ TI+AF  E + +    
Sbjct: 1201 IFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAFGDERRFMQENL 1260

Query: 344  NAIRKVFSFGKKEALTNATFFSSTGILGDLSF-------LIVLAYGSHLVLQ-----GGL 391
              I +           N  FF        L+F        ++ A G  ++L       GL
Sbjct: 1261 TKIDE----------NNKPFFYLWVANRWLAFRIDMIGACVIFAAGIFVLLNIKSLDSGL 1310

Query: 392  SVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGK---PY 448
            +   LT  + +TE        L   YS +     +  RL E  +   +    S     P 
Sbjct: 1311 AGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHNPPPE 1366

Query: 449  VPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
             PS G+I+  D+S  Y P+ P  ++   + FT++P   V +VG +G GKSTI + L R+ 
Sbjct: 1367 WPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALFRFL 1424

Query: 508  DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE-------- 558
            DP SG I ID  +I+ +  K LR+ + ++ Q+P L +G+++ NL  Y   S+        
Sbjct: 1425 DPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFEALK 1484

Query: 559  ----VTMDEIRSVAKKCFCHGF-----ITKFPEGYETVIGPRGASLSGGQKQRIAIARAL 609
                VT +E+   A     +       + KF    E  I   G++LS GQ+Q + +AR+L
Sbjct: 1485 RVNLVTQEELDHAANPSPDNASAVSENVNKFL-FLENEISEGGSNLSQGQRQLVCLARSL 1543

Query: 610  IKKPKILILDEATSALDVESEGAINYTLGRLMRSR--ELTIISIAHRLSTIRRSENVIVL 667
            ++ PK+++LDEAT+++D +S+  I  T+    RS   + TI++IAHRL +I   + ++V+
Sbjct: 1544 LRSPKVMLLDEATASIDYQSDARIQQTI----RSEFSDSTILTIAHRLRSIIDYDKILVM 1599

Query: 668  GNDGSVVEMGKFKELYANDQSELFKLLND 696
             + G V E      L  N  S  + +  D
Sbjct: 1600 -DAGEVKEYDHPYSLLLNKNSIFYSMCED 1627

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 114/236 (48%), Gaps = 9/236 (3%)

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            +I FE+ +FS+  +  +     +N   + G    V+GP+G GK+++   LL   D   G
Sbjct: 687 NKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEG 746

Query: 513 RI---MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
           ++    +D +    +    +   +    Q   L++ +++ N+ +  +S        +V +
Sbjct: 747 KVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILF--SSPFNEGRYNAVIE 804

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
            C           G +T IG +G +LSGGQKQR+++ARAL    + L+LD+  SA+D  +
Sbjct: 805 ACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHT 864

Query: 630 EGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
              I  N   G LM  R  T I ++H ++   ++   +V   +G V + G+  ELY
Sbjct: 865 ALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  151 bits (381), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 145/554 (26%), Positives = 244/554 (44%), Gaps = 56/554 (10%)

Query: 177  FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDL 236
            F +L+I+  +     + +  +++L  + G K   ++ + ++KK+++    FFD    G +
Sbjct: 1124 FYYLSIYILLGTLRALISTVKVILSYISGLKASRKIFTLLLKKVLYAKLRFFDSTPTGRI 1183

Query: 237  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALI 296
            ++R S D   +   +       F +                 +T     FA  + V   I
Sbjct: 1184 MNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLI----GYITPVFLFFAIVICVSYYI 1239

Query: 297  YGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAE----GKELHRYNNAIRK 348
             G    + SRELQ     +   + +   E L GV TI+AF  E       L + +   R 
Sbjct: 1240 VGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGDERRFLADNLSKVDTHNRP 1299

Query: 349  VFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ-GGLSVGDLTAFMLYTEYTG 407
             F       +TN         +G     ++LA G  ++L    L  G     ++Y     
Sbjct: 1300 FFYLW----VTNRWLAFRIDFIGAF---VILASGIFILLNVNSLDAGLAGISLIYAISFT 1352

Query: 408  SAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSG----KPYVPSWGEIKFEDVSFS 463
                 L   YS +     +  RL E      +  PS+G     P  P  G+I+  ++S  
Sbjct: 1353 EGALWLVRLYSNVEMTMNSVERLKEYMKIEQE--PSTGLYEPPPEWPDRGKIEVNNLSLR 1410

Query: 464  YPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK 523
            Y +     I N + FT+EP S V +VG +G GKSTI + L R+ DP++G I +D  +I+ 
Sbjct: 1411 YASNLPKVIKN-VTFTVEPQSKVGIVGRTGAGKSTIITALFRFLDPDTGTIKLDNVDITS 1469

Query: 524  LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI------ 577
            +  K LR+ + ++ Q+P+L +G+I+ NL     SE   D I    K+      I      
Sbjct: 1470 IRLKRLRQSITIIPQDPVLFAGTIKSNL--DPYSEYADDRIFEALKRV---NLIVQEELT 1524

Query: 578  -TKFP-----EGYETV---------IGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
             T  P       +E V         I   G++LS GQ+Q + +AR+L++ PK ++LDEAT
Sbjct: 1525 PTDIPSSSSSLSFENVNKFLDLTSEITEGGSNLSQGQRQLVCLARSLLRNPKAILLDEAT 1584

Query: 623  SALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
            +++D  S+  I  T+         TI++IAHRL +I   + V+V+ + G + E      L
Sbjct: 1585 ASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVLVI-DSGELAEYDHPYTL 1641

Query: 683  YANDQSELFKLLND 696
              N  S  +++  D
Sbjct: 1642 LLNKGSLFYRMCED 1655

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 105/216 (48%), Gaps = 9/216 (4%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISK---LSCKSL 529
              LN   + G    +VGP+G GK+++   LL   + + G+I +   N  +   +    +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 530 RRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIG 589
              +G   Q   L++ ++R N+ +    E   +   +V   C     +     G +T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEA--NRYNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 590 PRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELT 647
            +G +LSGGQKQR+++ARA+  + + ++LD+  SA+D  +   I  +   G LM  R  T
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGR--T 905

Query: 648 IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
            + ++H  +   ++ + +V+  +  V   G+  EL+
Sbjct: 906 CVLVSHNTALTLKNADWVVILENAKVTAQGEPLELF 941

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  151 bits (381), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 134/530 (25%), Positives = 239/530 (45%), Gaps = 48/530 (9%)

Query: 196  GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV 255
            G+ +L  V G     ++ + ++ K++H    FFD    G +++R S D   + + +T  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 256  SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
               F +              +    S   + +         Y    R + R    S   +
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPI 1240

Query: 316  TKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
             +   E L GV TI+AF  EG+     L + +   +  F       + N        ++G
Sbjct: 1241 YQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLW----VANRWLAFRIDMIG 1296

Query: 372  DLSF----LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 427
             L      L +L+   HL    G++   LT  + +TE        L   YSE+     + 
Sbjct: 1297 SLVIFGAGLFILSNIDHL--DSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSV 1350

Query: 428  SRLFEMTDHTSQIKPSSGKPYVPSW---GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPG 483
             R+ E  +   +      +   P W   G+I+  D+S  Y P  P  ++   ++F+++  
Sbjct: 1351 ERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQ 1408

Query: 484  SNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLM 543
            S V +VG +G GKSTI + L R+ +P++G I ID  +IS +  + LRR + ++ Q+P L 
Sbjct: 1409 SKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLF 1468

Query: 544  SGSIRYNLT----------------YGMNSEVTMDE--IRSVAKKCFCHGF--ITKFPEG 583
            SG+I+ NL                   + SE  + +  +R VA          + KF + 
Sbjct: 1469 SGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLD- 1527

Query: 584  YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
             E+ +   G++LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  + 
Sbjct: 1528 LESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQG 1587

Query: 644  RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
               TI++IAHRL ++   + ++V+ + G V E      L  N QS  + +
Sbjct: 1588 S--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 111/233 (47%), Gaps = 9/233 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P+     FE+ + S+     +     LN   + G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 510 NSGRIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
            +G++++   D +    +        +    Q   L++ +++ N+ +  NS+      ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILF--NSQFNETRYKA 806

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             +   I  N   G LM  R  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 147/563 (26%), Positives = 256/563 (45%), Gaps = 82/563 (14%)

Query: 177  FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDL 236
            F +L+I+  I +  ++    + VL  VLG +   ++  +++ + +H    FFD   +G +
Sbjct: 1106 FYYLSIYFLIGLTQSLLAASKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRI 1165

Query: 237  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP------L 290
            ++R S D   V + +T  +   F                    T AL  F  P      +
Sbjct: 1166 MNRFSKDIESVDQELTPYLEAAFFCLVQCIA------------TMALITFITPQFLSVAI 1213

Query: 291  LVGALIY--GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK----ELH 340
            LVG L Y  G      SREL+     S   + +   E L GV TI+A+  E +     LH
Sbjct: 1214 LVGCLYYLVGYFYMAASRELKRFESISKSPIYQHFSETLVGVATIRAYGDESRFMLENLH 1273

Query: 341  RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF-------LIVLAYGSHLV-----LQ 388
            + +                N  FF        LSF        ++   G  ++     + 
Sbjct: 1274 KIDE--------------NNKPFFYLWVFNRWLSFRIDMIGAFVIFGAGVFILTNIKNID 1319

Query: 389  GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD----HTSQIKPSS 444
             G++   LT  + +TE        L  FY+++     +  RL E  +       + K + 
Sbjct: 1320 SGMAGISLTYAISFTE----GALWLVRFYADVEMNMNSVERLKEYMEIEQEPYDEYKDTL 1375

Query: 445  GKPYVPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL 503
                 PS G+I+ +D+S  Y P  P  ++   ++F +EP + + +VG +G GKSTI + +
Sbjct: 1376 LHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRTGAGKSTIITAM 1433

Query: 504  LRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE---- 558
             R+ +P SG I ID  NI+ ++   LRR + ++ Q+P L +G+I+ NL  Y   ++    
Sbjct: 1434 FRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIF 1493

Query: 559  --------VTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALI 610
                    VT +E+++   +        KF    E  I   G++LS GQ+Q + +AR+L+
Sbjct: 1494 EALKRVNLVTEEELQNNGTQTGTSENANKFL-NLENEITEGGSNLSHGQRQLVCLARSLL 1552

Query: 611  KKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGND 670
            + PKI++LDEAT+++D  S+  I  T+ +     + TI++IAHRL ++   + +IV+ + 
Sbjct: 1553 RNPKIILLDEATASIDYASDAKIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-DA 1609

Query: 671  GSVVEMGKFKELYANDQSELFKL 693
            G V E      L  +  S  + +
Sbjct: 1610 GEVKEYDHPYSLLLDKNSNFYSM 1632

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 113/232 (48%), Gaps = 17/232 (7%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I F++V+ ++     +     LN   +PG+   V+GP+G GK+++   LL       G I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 515 MIDGQN------ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVA 568
           ++   N      I K     L   +    Q   L++ ++R N+ +  NS    +   +V 
Sbjct: 771 IVPALNPRQDLVIDKFG---LTNSIAYCSQAAWLLNETVRNNILF--NSPYNEERYNAVI 825

Query: 569 KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
             C     +        T IG +G +LSGGQKQR+++ARAL    K ++LD+  SA+D  
Sbjct: 826 DACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSH 885

Query: 629 SEGAI--NYTLGRLMRSRELTIISIAHRLS-TIRRSENVIVLGNDGSVVEMG 677
           +   I  N   G LM  R  T I ++H ++ T++ +E V++L N G V + G
Sbjct: 886 TALWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILEN-GRVKDQG 934

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  150 bits (380), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 143/520 (27%), Positives = 236/520 (45%), Gaps = 64/520 (12%)

Query: 216  VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 275
            ++KK+++    FFD   +G +++R S D   V + +T  V   F +              
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILI--- 976

Query: 276  SASLTSALFLFAPPLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQA 331
             A +T   F+ A  + +   + G      SREL+     S   + +   E L G+ TI+A
Sbjct: 977  -AYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRA 1035

Query: 332  FVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF-------LIVLAYGSH 384
            F   G E       + K+          N  FF        L+F        ++ A G  
Sbjct: 1036 F---GDERRFMQENLEKIDE-------NNKPFFYLWVANRWLAFRIDMIGACVIFAAGIF 1085

Query: 385  LVL-----QGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ 439
            ++L       GL+   LT  + +TE        L   YS +     +  RL E  +   +
Sbjct: 1086 VLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQE 1141

Query: 440  IKPSSGK---PYVPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRG 495
                S     P  PS G+I+  D+S  Y P+ P  ++   ++FT++P   V +VG +G G
Sbjct: 1142 PHYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAG 1199

Query: 496  KSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YG 554
            KSTI + L R+ DP SG I ID  +I+ +  K LR+ + ++ Q+P L +G+++ NL  Y 
Sbjct: 1200 KSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYD 1259

Query: 555  MNSE------------VTMDEIRSVAKKCFCHGFI-----TKFPEGYETVIGPRGASLSG 597
              S+            +T +E+ S       +  I      KF    +  I   GA+LS 
Sbjct: 1260 EYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLR-LDNEITEGGANLSQ 1318

Query: 598  GQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSRELTIISIAHRLS 656
            GQ+Q + +AR+L++ PK+++LDEAT+++D  S+  I  T+ G    S   TI++IAHRL 
Sbjct: 1319 GQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLR 1375

Query: 657  TIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            +I   + ++V+ + G V E      L  N  S  + +  D
Sbjct: 1376 SIIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCED 1414

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 159/341 (46%), Gaps = 35/341 (10%)

Query: 357 ALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL--TAFMLYTEYTGSAVFGLS 414
           ALT   +F +  I+  +SF       +++ +QG +    +  TA  L+T    + +  LS
Sbjct: 385 ALTAFVWFVTPSIVTTVSF------ATYIYIQGEVLTTPVAFTALSLFT-LLRNPLDMLS 437

Query: 415 NFYSELMKGAGAASRL--FEMTDHT---SQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469
           +  S +++   +  R+  F   D T    QI  S  +        I FE+ +FS+  +  
Sbjct: 438 DMLSYVIQSKVSLDRVQVFLEEDETEKYDQITVSRKR--------IGFENATFSWDRK-- 487

Query: 470 NQIFNKLNFTIE--PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI---MIDGQNISKL 524
           N  F   N +IE   G    V+GP+G GK+++   LL   D   G++    +D +    +
Sbjct: 488 NPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIV 547

Query: 525 SCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGY 584
               +   +    Q   L++ +++ N+ +  +S        +V + C           G 
Sbjct: 548 ENDGMTNSIAYCSQGAWLLNDTVKNNILF--SSPFNEARYDAVVEACGLKRDFEILSAGD 605

Query: 585 ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMR 642
           +T IG +G +LSGGQKQR+++ARAL    + L+LD+  SA+D  +   I  N   G LM 
Sbjct: 606 QTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLME 665

Query: 643 SRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
            R  T I ++H ++   ++ + +V   +G V + G+  EL+
Sbjct: 666 GR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 148/556 (26%), Positives = 250/556 (44%), Gaps = 63/556 (11%)

Query: 168  PPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEF 227
            PP  Y +G++ F  +FA  +        G+  +L  +G      L    +K+I+H    +
Sbjct: 930  PPSFY-MGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKWLNLRAVKRILHTPMSY 982

Query: 228  FDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA 287
             D   +G +++R + D    + S+   +++  +                        +  
Sbjct: 983  IDTTPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 288  PPLLVGALIYGKKIRMISRELQESTG--------NLTKVSEEQLSGVKTIQAFVAEGKEL 339
            P LLV  ++     +   RE++            NL +V    L G+ TI+A+ ++ + L
Sbjct: 1039 PFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFL 1094

Query: 340  HRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL-----SFLIVLAYGSHLVLQGGLSVG 394
             + +  I K+   G    +         GI  D+     + +I L   +        SVG
Sbjct: 1095 AKSDFLINKMNEAGYLVVVLQ----RWVGIFLDMVAIAFALIITLLCVTRAFPISAASVG 1150

Query: 395  DLTAFMLYTE-YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSW 452
             L  ++L       + +  ++   +++       +   E+    S  KP    P   PS 
Sbjct: 1151 VLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSM 1210

Query: 453  GEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            GEI FE+V F+Y  RPG  I  K LN  I+ G  + + G +G GKSTI S L R  +  +
Sbjct: 1211 GEIIFENVDFAY--RPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTA 1268

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR------ 565
            G+I+ID  +IS+L    LRR L ++ Q+P+L  G+IR NL     +E T DE+       
Sbjct: 1269 GKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTDDELWDALVRG 1326

Query: 566  -SVAKKCF------------CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKK 612
             ++AK                HG + KF    +  +   G++ S G++Q +A+ RAL+++
Sbjct: 1327 GAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQ 1384

Query: 613  PKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
             KILILDEATS++D E++G I   +  +    + TI+ IAHRL TI   + ++VL   G 
Sbjct: 1385 SKILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGE 1441

Query: 673  VVEMGKFKELYANDQS 688
            V E      L++ + S
Sbjct: 1442 VAEFDTPWTLFSQEDS 1457

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 125/251 (49%), Gaps = 31/251 (12%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  + + GP G GKS++ + +        G++ ++G     L C      
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGD---LLMCGY---- 656

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + S+R N+ +G  S    ++   V + C     +   P G  T IG RG
Sbjct: 657 -------PWIQNASVRDNIIFG--SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++  L  ++ ++  T I  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK--TRILA 765

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE 711
            H+LS I R+  VIVLG DG  V++G   EL A +Q+    L+N      LQ  S+NS  
Sbjct: 766 THQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT----LIN-----LLQFSSQNS-- 813

Query: 712 TKENEVDDQVL 722
            KE+E  + V+
Sbjct: 814 EKEDEEQEAVV 824

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 143/536 (26%), Positives = 249/536 (46%), Gaps = 36/536 (6%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK-KIIHQDAEFFDRNKVGDLI 237
            +L I+ G+  F  ++   + ++L V      ++   N++   ++     FF+   +G ++
Sbjct: 989  YLLIYFGLGCFSALSTLIQTIILWVYCTIRGSKYLHNLMTVAVLRAPMTFFETTPIGRIL 1048

Query: 238  SRLSSDAY----VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAP-PLLV 292
            +R S+D Y    V+ R+ +Q   +  K                   T+  F+F   PL V
Sbjct: 1049 NRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIVI---------CFTTWQFIFIIIPLGV 1099

Query: 293  GALIYGKKIRMISRELQESTGNLTKVS-----EEQLSGVKTIQAFVAEGKELHRYNNAIR 347
              + Y +     SREL+    ++TK       +E L G+ TI+ +  + +  H     + 
Sbjct: 1100 FYIYYQQYFLRTSRELRR-LDSITKSPIFSHFQETLGGITTIRGYQQQHRFTHINQCRVD 1158

Query: 348  KVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTG 407
               S        N         +G L  L         + QG L+ G +   + Y     
Sbjct: 1159 NNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGLSLSYALQIT 1218

Query: 408  SAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP--SW---GEIKFEDVSF 462
             ++  +     E+     +  R+ E +D  S+  P+  + + P  +W   G+IKFE  S 
Sbjct: 1219 QSLNWIVRMTVEVETNIVSVERIKEYSDLKSE-APAVIEDHRPAETWPDEGDIKFEHYST 1277

Query: 463  SYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNI 521
             Y  RP  + I   +N  I+P   V +VG +G GKS++   L R  + +SGRI+ID   I
Sbjct: 1278 RY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRIVIDNVPI 1335

Query: 522  SKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSV-AKKCFCHGFITKF 580
            +++    LR  L ++ Q+  +  G++R N+     +E T ++I +V A        I+  
Sbjct: 1336 NEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLALSHLKDHIISMG 1393

Query: 581  PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640
             EG    +   G +LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T+   
Sbjct: 1394 DEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQETIRTA 1453

Query: 641  MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
             + R  TI++IAHR++TI  S+ +IVL N G++ E    ++L  N  S  + L  +
Sbjct: 1454 FKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENPSSLFYSLCQE 1506

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 107/466 (22%), Positives = 204/466 (43%), Gaps = 46/466 (9%)

Query: 278 SLTSALFLFAPPLLVGALIYGKKIRM------ISRELQESTGNL----TKVSEEQLSGVK 327
            L S   L    + VG LI    I +      + ++LQ+S        T+V  E L+ +K
Sbjct: 433 CLVSLYKLLGKSMWVGVLILVIMIPINSYLVRVQKKLQKSQMTYKDERTRVISEMLNNIK 492

Query: 328 TIQAFVAE-----GKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG 382
           +++ +  E       E  R N  ++ +   G   AL +  F     ++   +F     Y 
Sbjct: 493 SLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCCTF-AAFIYT 551

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIK 441
            +  L   L    LT F L        +  + N  + +++ + +  RLF  +T+   Q  
Sbjct: 552 ENRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTMIIETSVSIGRLFSFLTNEELQKD 607

Query: 442 PSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKS 497
                P V + G++     +D +F +  +P  ++    +NF  + G   C+VG  G GKS
Sbjct: 608 AVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKS 667

Query: 498 TIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNS 557
            +   +L       G   I G             ++  V Q   +M+G+++ N+ +G   
Sbjct: 668 AMIQSILGDLFRVKGFATIHG-------------NVAYVSQVAWIMNGTVKENILFGHKY 714

Query: 558 EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
           +   D  +   K C     +    +G +T++G +G SLSGGQK R+++ARA+  +    +
Sbjct: 715 D--EDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYL 772

Query: 618 LDEATSALDVE-SEGAINYTLGR--LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
           LD+  +A+D   +   + + LG   L+ ++  T +   +++S +  +++V +L N G +V
Sbjct: 773 LDDPLAAVDEHVARHLVEHVLGPNGLLHTK--TKVLATNKVSVLSIADSVSLLEN-GEIV 829

Query: 675 EMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ 720
           + G + E+  +D S L KL+ +       S S  +  T  + + +Q
Sbjct: 830 QQGTYDEIMKDDSSPLSKLITEYGKKSTDSTSNVTPSTSSSNIHEQ 875

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 145/550 (26%), Positives = 251/550 (45%), Gaps = 58/550 (10%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F   F+ IL   T + F  +  + VL  K +  LR+  +K+I+H    + D  
Sbjct: 965  FYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSYLDTT 1018

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFL--FA-- 287
             +G +++R + D   +   +T++V                       +   ++L  FA  
Sbjct: 1019 PLGRILNRFTKDTDSLDNELTESVR---------MLLYQFANIVGVCIMCIIYLPWFAIA 1069

Query: 288  -PPLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRY 342
             P L VG ++     +   RE++         +     E L G+ TI+++ +E + + + 
Sbjct: 1070 IPFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYRSENRFIAKS 1129

Query: 343  NNAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAF 399
            +  I K+   G          A F     +    + +I L   +        SVG L  +
Sbjct: 1130 DFLIDKMNEAGYLVVAVQRWVAIFLDVIAVC--FALIITLLCVTRAFPISAASVGVLLTY 1187

Query: 400  MLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGEIKF 457
            +L      + V   L+   +++       +   E+       KP    P   P+ GEI F
Sbjct: 1188 VLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPPEEWPTKGEIHF 1247

Query: 458  EDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            E+V FSY  RPG   +   L+  I+ G  + + G +G GKSTI S L R  + +SG+++I
Sbjct: 1248 ENVDFSY--RPGLPTVLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMII 1305

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY----------------GMNSEVT 560
            D  +IS +    LRR L ++ Q+P+L  G+IR NL                  G   +  
Sbjct: 1306 DDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQKE 1365

Query: 561  MDEIRSV-AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
            ++EI++    +   H  + KF    + ++   GA+ S G++Q +A+ RAL+++ +ILILD
Sbjct: 1366 LNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVRQARILILD 1423

Query: 620  EATSALDVESEGAINYTLGRLMRSR-ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            EATS++D E++G I     R++      TI+ IAHRL TI   + ++VL   G V E   
Sbjct: 1424 EATSSVDYETDGKIQ---ARIVEEFGHCTILCIAHRLKTILTYDRILVL-EKGEVAEFDT 1479

Query: 679  FKELYANDQS 688
             K L+A + S
Sbjct: 1480 PKTLFAQEDS 1489

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 108/212 (50%), Gaps = 22/212 (10%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ LNF I+ G  + +VGP G GK+++ +    + +  SGRI I+G     L C      
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING---DLLLCGY---- 701

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + S++ N+ +G  S     +   V + C     +   P G  T IG RG
Sbjct: 702 -------PWIQNASVKDNIIFG--SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RI +AR++ K+  I + D+  SA+D      I     LG L   ++ T I 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KDKTRIL 809

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
             H+LS + R+  VIVLGNDGS  ++G  +EL
Sbjct: 810 ATHQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 153/548 (27%), Positives = 253/548 (46%), Gaps = 44/548 (8%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR-LRSNVIKKIIHQDAEFFDRNKVGDLI 237
            FL ++A I + G   N  R + + + G    +R L + + K I+     FF+    G +I
Sbjct: 994  FLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTGRII 1053

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R SSD   V  ++ QNV   F                +  L    FL    LLV  L Y
Sbjct: 1054 NRFSSDMDSVDTTL-QNVFSLFFRSILDYIITVILVTFNMPL---FFLLNAGLLVIYLYY 1109

Query: 298  GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN--NAIRKVFS 351
                 ++SREL+     S   +  +  E LSG  TI A+    +++ R++  N  R  FS
Sbjct: 1110 QSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHLNYERIQFS 1165

Query: 352  FGKKEALTNATFFSSTGILGDLSFLIVLAYG----SHLVLQGGLSVGDLTAFMLYTEYTG 407
                    ++  + S   L  +  LIVL+ G    S L     LS G +   M Y     
Sbjct: 1166 INCFFNYRSSNRWLSVR-LQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVT 1224

Query: 408  SAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-----VPSWGEIKFEDVSF 462
            S++  +      +     +  R+ E  D + +  P   + +      P+ G+I+F++ S 
Sbjct: 1225 SSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIEFKNYST 1283

Query: 463  SYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
            SY     + +   +N  I PG  + VVG +G GKST++  L R  +P +G I ID  +I+
Sbjct: 1284 SY-RENLDPVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDIT 1342

Query: 523  KLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-----------YGMNSEVTMDEIRSVAKKC 571
             +  + LR H+ ++ Q+     G+IR NL            + +        + ++AK+ 
Sbjct: 1343 SIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEI 1402

Query: 572  FC---HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
                 +   ++     +  +   G++LS GQKQ + +ARAL+ K KIL+LDEAT+++DVE
Sbjct: 1403 NDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVE 1462

Query: 629  SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            ++  I  T+ +    R  TI++IAHRL T+  S+ +IVL + G V E  K + L     S
Sbjct: 1463 TDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDKPETLLEQKDS 1519

Query: 689  ELFKLLND 696
              +KL ++
Sbjct: 1520 IFYKLCDN 1527

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 108/222 (48%), Gaps = 18/222 (8%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGV- 535
           NF +   S +CVVG  G GKSTI   +L       G++     N   LS +       V 
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCIL-------GQLPCISGNNDHLSPQFQINATTVA 691

Query: 536 -VQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGAS 594
              QE  +M+ S++ N+ +G   +      ++  K C     I   P+G ET++G +G  
Sbjct: 692 YCPQEAWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIV 749

Query: 595 LSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSRELTIIS 650
           LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I   L     L++ +  +I+ 
Sbjct: 750 LSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDK--SIVL 807

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
             + +S ++ S  + +L N  S+ + G + ++  N Q    K
Sbjct: 808 ATNTISVLKHSTKIYLLEN-KSIAQEGNYDDIMNNQQDSKLK 848

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 151/552 (27%), Positives = 251/552 (45%), Gaps = 77/552 (13%)

Query: 181  AIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRL 240
            A+FAG     T+ NF       V G     R+   ++ K++H    F D   +G +++R 
Sbjct: 1121 ALFAGT---KTVINF-------VAGINASRRIFKKLLSKVLHSRLRFIDSTPIGRIMNRF 1170

Query: 241  SSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY--G 298
            S D   V + +T  +   F                  +  +  FLF   +LV  L Y  G
Sbjct: 1171 SKDIEAVDQELTPFLEAAFFCLVQCISTIILI-----TFITPQFLFVA-VLVCVLYYLVG 1224

Query: 299  KKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGK 354
                  SREL+     +   + +   E L+GV TI+AF   G E       IR +    +
Sbjct: 1225 YFYINTSRELKRIESITKSPIYQHFSETLTGVATIRAF---GDE-------IRFIMHNLE 1274

Query: 355  KEALTNATFFSSTGILGDLSF-------LIVLAYGSHLVL-----QGGLSVGDLTAFMLY 402
            K    N  FF        L+F       LI+   G  ++L       G++   LT  + +
Sbjct: 1275 KIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFILLNLNRIDSGMAGISLTYAISF 1334

Query: 403  TEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD------HTSQIKPSSGKPYVPSWGEIK 456
            TE        L  FYS +     +  RL E  D      +   I  S+  P   + G+I+
Sbjct: 1335 TE----GALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTITTSTNWP---TEGKIE 1387

Query: 457  FEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
             +D+S  Y      ++  +++F IEP + V +VG +G GKSTI + L R+ +P +G I I
Sbjct: 1388 VKDLSLRYAENLP-RVIKEVSFDIEPHNMVGIVGRTGAGKSTIITALFRFLEPETGSIKI 1446

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------------VTMDE 563
            DG +I+ +  ++LRR + ++ Q+P L +G+IR NL  +G   +            +  DE
Sbjct: 1447 DGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKYPDEEIFRVLHRVNLIDDDE 1506

Query: 564  I--RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEA 621
            +  +S          + KF    E  I   G +LS GQKQ + +ARAL++ PK+++LDEA
Sbjct: 1507 MTAQSSDNNSLSSDNVNKFL-NLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEA 1565

Query: 622  TSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            T+++D  S+  I  T+  +      T+++IAHRL ++   + ++V+ + G V+E  +   
Sbjct: 1566 TASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKILVM-DAGEVIEYDQPYT 1622

Query: 682  LYANDQSELFKL 693
            L  +  S  + +
Sbjct: 1623 LLLDKNSHFYSM 1634

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 161/366 (43%), Gaps = 19/366 (5%)

Query: 321 EQLSGVKTIQAFVAEGK---ELHRYNNA-IRKVFSFGKKEALTNATFFSSTGILGDLSFL 376
           E L  ++ I+ F  E     E+     A I+   +     A +   +F +  I+   SF 
Sbjct: 581 EALQAIRIIKFFSWEDNFFSEIDEIREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASFT 640

Query: 377 IVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH 436
           + + Y    VL   ++   L  F L  +     +  LSN  S +++   +  R+    D 
Sbjct: 641 VYI-YVQKQVLTAPVAFTALALFQLLKQ----PLDQLSNMLSYVIQSKVSLDRVQNFLDE 695

Query: 437 TSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGK 496
               K +  K   P   ++ FE+ + ++     +     L+   + G    V+GP+G GK
Sbjct: 696 EDTQKYNQLK-VAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGK 754

Query: 497 STIASLLLRYYDPNSGRIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553
           +++   LL      SGRI++   D ++   +    +   +    Q   L++ ++R N+ +
Sbjct: 755 TSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILF 814

Query: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
              S    D  + V   C        F  G +T IG +G +LSGGQKQRI++ARAL    
Sbjct: 815 --YSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNC 872

Query: 614 KILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDG 671
           + L+LD+  SA+D  +   I  N   G LM  R  T + ++H ++   ++  ++V+  +G
Sbjct: 873 RHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR--TCVLVSHNIALTLKNAELVVMLENG 930

Query: 672 SVVEMG 677
            +   G
Sbjct: 931 RITNRG 936

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  147 bits (370), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 131/531 (24%), Positives = 240/531 (45%), Gaps = 50/531 (9%)

Query: 196  GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV 255
            G+ +L  V G     ++ + ++ K++H    FFD    G +++R S D   + + +T  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 256  SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
               F +              +    S   + +         Y    R + R    S   +
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPI 1240

Query: 316  TKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
             +   E L GV TI+AF  EG+     LH+ +   +  F       + N        ++G
Sbjct: 1241 YQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLW----VANRWLAFRIDMIG 1296

Query: 372  DLSFLIVLAYGSHLV-----LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGA 426
             L   ++   G  ++     L  G++   LT  + +TE        L   YSE+     +
Sbjct: 1297 SL---VIFGAGLFILFNINNLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNS 1349

Query: 427  ASRLFEMTDHTSQIKPSSGKPYVPSW---GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEP 482
              R+ E  +   +      +   P W   G+I+  D+S  Y P  P  ++   ++F+++ 
Sbjct: 1350 VERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDA 1407

Query: 483  GSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPML 542
             S + +VG +G GKSTI + L R+ +P +G I ID  +IS +  + LRR + ++ Q+P L
Sbjct: 1408 QSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTL 1467

Query: 543  MSGSIRYNLT-YGMNSEVTMDE----IRSVAKKCFCHGF---------------ITKFPE 582
             SG+I+ NL  Y   S+  + E    +  ++++    G                + KF +
Sbjct: 1468 FSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLD 1527

Query: 583  GYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR 642
               + I   G++LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  +
Sbjct: 1528 -LSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQ 1586

Query: 643  SRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
                TI++IAHRL ++   + ++V+ + G V E      L  N QS  + +
Sbjct: 1587 GS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSAFYSM 1634

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 109/233 (46%), Gaps = 9/233 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P+     FE+ + S+     +     LN   + G    V+GP+G GK+++   LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 510 NSGRIMIDGQNISK---LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
            +G++++      +   +        +    Q   L++ +++ N+ +  NS       ++
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILF--NSPFNEARYKA 806

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             +   I  N   G LM  R  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 149/566 (26%), Positives = 256/566 (45%), Gaps = 73/566 (12%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F  +F G L       F  + ++ ++  K    L    +K+I+H    + D  
Sbjct: 934  FYMGLYSFF-VFGGYLFMNI--QFTMLCMMGIMASKW---LNLKAVKRILHAPMSYLDTT 987

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP-- 289
             +G +++R + D   +   +T+N+                       +    F  A P  
Sbjct: 988  PLGRILNRFTKDTDSLDNELTENIR-----LMMSQFANIIGVCVLCIVYLPWFAIAIPFL 1042

Query: 290  LLVGALI---YGKKIRMISR--ELQES--TGNLTKVSEEQLSGVKTIQAFVAEGKELHRY 342
            LLV  LI   Y    R I R   +Q S    NL +V    L G+ TI+A+ ++ + + + 
Sbjct: 1043 LLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEV----LGGMDTIKAYKSQDRYMTKM 1098

Query: 343  NNAIRKVFSFGKKEALTNATFFSSTGILGDLS-FLIVLAYGSHLVL-------QGGLSVG 394
            +  I K+          N   +    +   ++ FL ++A    L++       Q  +S  
Sbjct: 1099 DFLINKM----------NEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPS 1148

Query: 395  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP--SW 452
             +   + Y       +  +    ++      +A RL        Q        Y P  +W
Sbjct: 1149 AVGVLLTYVLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDNW 1208

Query: 453  ---GEIKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYD 508
               GE+ FEDVSF+Y  RPG   +   +N +I  G  + + G +G GKSTI + L R  +
Sbjct: 1209 PTNGEVIFEDVSFAY--RPGLPTVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNE 1266

Query: 509  PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT----YGMNS------- 557
              SGRI IDG +  KL    LRR L ++ Q+P+L  G+IR NL     +  +S       
Sbjct: 1267 LTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIR 1326

Query: 558  --EVTMDEIRSVA----KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIK 611
               +  D++  +      K   +  + KF    + ++   GA+ S G++Q +A+ RAL++
Sbjct: 1327 GGAIEKDDLEDIKHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVR 1384

Query: 612  KPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDG 671
            + KILILDEATS++D E++G I   +      ++ TI+ IAHRL TI   + ++VL   G
Sbjct: 1385 QSKILILDEATSSVDYETDGKIQTRIA--TEFQDCTILCIAHRLKTILNYDRILVL-EKG 1441

Query: 672  SVVEMGKFKELYANDQSELFKLLNDK 697
             V E  K + L+ N++S +F+ + D+
Sbjct: 1442 EVAEFDKPEILFNNEKS-IFRSMCDR 1466

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 112/217 (51%), Gaps = 20/217 (9%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ LNF I+ G  + + GP G GKS++ + +  +    +G + I+G     L C      
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGH---MLLCGY---- 669

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + ++R N+ +G  S    ++ + V + C     I   P G  T IG RG
Sbjct: 670 -------PWIQNATVRDNIIFG--SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +AR++ K   I + D+  SA+D    +  ++    + ++S+  T I  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            H+LS I +++ VIVL  +GS V++G  +EL   +Q+
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEELKTRNQT 814

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 144/550 (26%), Positives = 250/550 (45%), Gaps = 58/550 (10%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F  +FAG L   +     +  LL  +G +    L    + +I+H    + D  
Sbjct: 950  FYMGLYSFF-VFAGYLFTSS-----QFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTT 1003

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFL--FA-- 287
             +G +++R + D   +   +T+++                       +   ++L  FA  
Sbjct: 1004 PLGRILNRFTKDTDSLDNELTESIR---------LMLFQTANIVGVCVMCIIYLPWFAIA 1054

Query: 288  -PPLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRY 342
             P L +G  +     +   RE++         +     E L G+ TI+++ +E + L + 
Sbjct: 1055 IPFLFIGFTLITDHYQSTGREVKRLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKS 1114

Query: 343  NNAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAF 399
            +  I K+   G          A F     +    + +I L   +       +SVG L  +
Sbjct: 1115 DYLINKMNEAGYLSVALQRWVAIFLDLVAVC--FALIITLLCVTRAFHISAVSVGVLLTY 1172

Query: 400  MLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGEIKF 457
            +L      + V   L+   +++       S   E+    +  +P    P   PS G+I+F
Sbjct: 1173 VLQLPGLLNGVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPPENWPSEGKIEF 1232

Query: 458  EDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            + V FSY  RPG  I  K L+  I+ G  + + G +G GKSTI S L R  + + G I+I
Sbjct: 1233 KHVDFSY--RPGLPIVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILI 1290

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY----------------GMNSEVT 560
            D  +ISKL    LRR L ++ Q+P+L  G+IR NL                  G      
Sbjct: 1291 DNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERAA 1350

Query: 561  MDEIRSV-AKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
            +++I++    K   H  + KF    + ++   GA+ S G++Q +A+ RAL+++ K+LILD
Sbjct: 1351 LNKIKNQKVDKDGTHADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILD 1408

Query: 620  EATSALDVESEGAINYTLGRLMRSR-ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            EATS++D E++G I     R+++   + TI+ IAHRL+TI   + ++VL   G V E  K
Sbjct: 1409 EATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEK 1464

Query: 679  FKELYANDQS 688
             K L+  + S
Sbjct: 1465 PKVLFDQEDS 1474

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 103/218 (47%), Gaps = 22/218 (10%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ +   I+ G  + +VGP G GK++  + L  + +   GRI ++G     L C      
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG---DLLLCGY---- 679

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + ++R N+ +G  S     +   V + C     +   P G  T IG RG
Sbjct: 680 -------PWIQNATVRDNILFG--SPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RI +AR + KK  I + D+  SA+D      I     LG L   +  T I 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KNETRIL 787

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
             H+LS + R+  VIVLG DGS  E+G    L   +Q+
Sbjct: 788 ATHQLSLLERASRVIVLGTDGS-FEIGPVDVLKRTNQT 824

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  145 bits (367), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 142/518 (27%), Positives = 232/518 (44%), Gaps = 63/518 (12%)

Query: 211  RLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 270
            ++ S ++ K +H +  FFD   +G +++R S D      ++ Q +    +A         
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDM----EAVDQELVPYLEAALYCIIDIS 1194

Query: 271  XXXXXSASLTSALFLFAPPLLVGALIYGKKIRMI--SRELQE----STGNLTKVSEEQLS 324
                    +T    + A  +LV  L Y   +  +  SREL+     +   + +   E L 
Sbjct: 1195 STILLITYITPEFLIIA--ILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLV 1252

Query: 325  GVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF-------LI 377
            GV T++A+  E + +      I +           N  FF        L+F       L+
Sbjct: 1253 GVTTVRAYGDEARFMRENLKMIDE----------NNKPFFYLWVSNRWLAFRIDVVGALV 1302

Query: 378  VLAYGSHLVLQ-----GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE 432
            +   G  ++L       GL+   L+  + +TE    +   L   YS L     +  RL E
Sbjct: 1303 IFGSGVFVLLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLME 1358

Query: 433  MTDHTSQIKPSSGKPYVPSW---GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCV 488
              +   +   SS      SW   G+I+  DVS  Y P  P  ++     FT++P   V +
Sbjct: 1359 YMEVEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGI 1416

Query: 489  VGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIR 548
            VG +G GKSTI + L R+ DP +G I ID  +IS +  K LRR + ++ Q+P L SG+I+
Sbjct: 1417 VGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIK 1476

Query: 549  YNLT-YGMNSE------------VTMDEIRS--VAKKCFCHGFITKFPEGYETVIGPRGA 593
             NL  Y   SE            VT  E+ S    ++    G   KF       I   G+
Sbjct: 1477 SNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFL-NVNNEISEGGS 1535

Query: 594  SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
            +LS GQ+Q + +AR+L++ PK+++LDEAT+++D  S+  I  T+       + TI++IAH
Sbjct: 1536 NLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAH 1593

Query: 654  RLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
            RL T+   + ++V+ + G V E      L  N  S  +
Sbjct: 1594 RLRTVIDYDKILVM-DAGEVKEFDHPYSLLLNKNSIFY 1630

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 112/231 (48%), Gaps = 9/231 (3%)

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            +I F++ + ++     +     ++   + G    ++GP+G GK+++   LL   D   G
Sbjct: 701 NKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDG 760

Query: 513 RIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
            I++   D +   KL    L   +    Q   L++ ++R N+ +  NS    +   +V +
Sbjct: 761 EIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILF--NSPYCEERYNAVVE 818

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
                        G  T IG RG +LSGGQKQR+++ARAL    K L+LD+  SA+D  +
Sbjct: 819 ASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSHT 878

Query: 630 EGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
              I  N   G LM +R  T I ++H ++   R+ + +V   +G +VE G+
Sbjct: 879 ATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  145 bits (366), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 143/554 (25%), Positives = 247/554 (44%), Gaps = 59/554 (10%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F  +FA  +        G+  +L  +G      L    +K+I+H    + D  
Sbjct: 934  FYMGLYSFF-VFAAFIFMN-----GQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTT 987

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R + D    + S+   +++  +                        +  P LL
Sbjct: 988  PLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLL 1043

Query: 292  VGALIYGKKIRMISRELQESTG--------NLTKVSEEQLSGVKTIQAFVAEGKELHRYN 343
            +  ++     +   RE++            NL +V    L G+ TI+A+ ++ + L + +
Sbjct: 1044 IIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSD 1099

Query: 344  NAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFM 400
              I K+   G    +       F     I+   + +I L   +        SVG +  ++
Sbjct: 1100 FLINKMNEAGYLVVVLQRWVGIFLDMVAIV--FALIITLLCVTRAFPISAASVGVMLTYV 1157

Query: 401  LYTE-YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGEIKFE 458
            L       + +  L+   +++       S   E+       KP    P   PS GEI F+
Sbjct: 1158 LQLPGLLNTLLRALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESWPSKGEIAFK 1217

Query: 459  DVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
            +V FSY  RPG   +   LN  I+ G  + + G +G GKSTI S L R  + + G I+ID
Sbjct: 1218 NVDFSY--RPGLPVVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILID 1275

Query: 518  GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR-------SVAKK 570
              NIS++    LRR L ++ Q+P+L  G+IR NL     +E T DE+        ++AK 
Sbjct: 1276 DVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFNERTEDELWDALVRGGAIAKN 1333

Query: 571  CF------------CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
                           HG + KF    +  +   G++ S G++Q +A+ RAL+++ KILIL
Sbjct: 1334 DLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILIL 1391

Query: 619  DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            DEATS++D E++G I   +  +    + TI+ IAHRL TI   + ++VL   G V E   
Sbjct: 1392 DEATSSVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDT 1448

Query: 679  FKELYANDQSELFK 692
               L++ + S +FK
Sbjct: 1449 PWALFSQEDS-IFK 1461

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 108/217 (49%), Gaps = 20/217 (9%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  L+F I+ G  + + GP G GKS++ + +        G+I ++G     L C      
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG---DLLMCGY---- 656

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + +++ N+ +G  S    ++   V   C     +   P G  T IG RG
Sbjct: 657 -------PWIQNATVKDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  L  L+ ++  T +  
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVLA 765

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            H+LS I ++  VIVLG DG  V++G   EL A +Q+
Sbjct: 766 THQLSLIEKASRVIVLGTDGD-VDIGTVDELKARNQT 801

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 144/543 (26%), Positives = 239/543 (44%), Gaps = 42/543 (7%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +L I+  +    ++AN  + ++L +     G K   +L S++   I      FF+   +G
Sbjct: 985  YLFIYFTLGFASSLANLIQTIILWIFCTIQGSK---QLHSSMTSSIFRAPMSFFETTPIG 1041

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +++R S+D Y +   + ++ S  F+                 S T        P+    
Sbjct: 1042 RILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVVI----CSTTWQFIFLIIPMAFLY 1097

Query: 295  LIYGKKIRMISRELQ--ESTGN--LTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVF 350
            + Y +     SREL+  +ST    L    +E L GV TI+ F  + + +H   + +    
Sbjct: 1098 IYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRFIHINQSRVDSNM 1157

Query: 351  SFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAV 410
                    +N         LG L  L         +  G L+ G +   M Y      ++
Sbjct: 1158 MAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIGLSMSYALQVTQSL 1217

Query: 411  FGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPT 466
              +     ++     +  R+ E +   S+    I+ +      PS G I+F++ S  Y  
Sbjct: 1218 NWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPSKGAIEFKNYSTRY-- 1275

Query: 467  RPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLS 525
            RP  + +   +N  I P   V +VG +G GKS++   L R  + +SG I IDG NI++L 
Sbjct: 1276 RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSGSIEIDGVNINELG 1335

Query: 526  CKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF----P 581
               LR  L ++ Q+  +  GSIR N+      + +  EI +  +       I K     P
Sbjct: 1336 LYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQFSEQEIWNALEMAHLKPHILKMNEISP 1393

Query: 582  EG-----------YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 630
            E             +  I   G++LS GQ+Q I +ARAL+    +LILDEAT+A+DVE++
Sbjct: 1394 ESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLILDEATAAVDVETD 1453

Query: 631  GAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSEL 690
              I +T+    + R  TI++IAHR++TI  S+ +IVL N G V E  K + L  N  S  
Sbjct: 1454 ELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFDKPEILLTNKNSLF 1510

Query: 691  FKL 693
            + L
Sbjct: 1511 YSL 1513

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 155/327 (47%), Gaps = 37/327 (11%)

Query: 409 AVFGLSNF--------YSELMKGAGAASRLFE-MTDHTSQIKPSSGKPYVPSWGEIKF-- 457
            +F L NF         S  ++ + + SRL+  +T+   Q       P+V   GE     
Sbjct: 557 TLFNLLNFPLVAVPITISAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKI 616

Query: 458 -EDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            ++ +F +  +P  ++    +NF    G   C+VG  G GKS     +L           
Sbjct: 617 GDNATFLWKRKPEYKVALKNINFEARKGELACIVGKVGSGKSAFIQSIL----------- 665

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575
             G         S+  ++  V Q   +M+G+++ N+ +G   +    E     K C    
Sbjct: 666 --GDLFRVKGFASIHGNVAYVSQLAWIMNGTVKDNIIFGHRYDPEFYE--KTIKACALTI 721

Query: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAIN 634
            ++  P+G +T++G +G SLSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I 
Sbjct: 722 DLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQ 781

Query: 635 YTLGR--LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
             LG   L++S+  T I   +++  +  ++++ +L N G + E G + ++ A + S L K
Sbjct: 782 NVLGAKGLLKSK--TRILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSK 838

Query: 693 LLND---KKPTQLQSQSRNSVETKENE 716
           L+ +   KK +     ++++V ++ +E
Sbjct: 839 LITEYGKKKDSSESEAAKDNVNSESDE 865

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 146/540 (27%), Positives = 238/540 (44%), Gaps = 41/540 (7%)

Query: 179  FLAIFAGILVFGTIANFGR-IVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLI 237
            F+ I+  I +     N  R IVLL V   +   +L  ++   ++     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R SSD   V  ++   +S                          LFL     L+G  +Y
Sbjct: 1076 NRFSSDMNSVDDNVQYVIS-----FFLISILDYVVVVVIIGYQVPLFLLVNAALLGIYLY 1130

Query: 298  GKKIRM-ISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK------ELHRYNNAI 346
             +   + +SREL+     S   +  +  E L+G   I AF    +      E  ++N  I
Sbjct: 1131 YQVFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNIEAVQFN--I 1188

Query: 347  RKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYT 406
              VF+F       +    S   ++   + L+ LA  +       LS G +   M Y    
Sbjct: 1189 NCVFNFRSTNRWLSIRLESIGALMILTTALLSLATTTG---DKALSTGMVGLLMSYALQV 1245

Query: 407  GSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKP--SSGKPY--VPSWGEIKFEDVSF 462
             + +  +     +L     +  R+ E  D   +  P     +P    P+ G + F+D S 
Sbjct: 1246 TNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSA 1305

Query: 463  SYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
             Y     + +  KLN  I P   + +VG +G GKST++  L R  +P  G I+IDG +I+
Sbjct: 1306 RY-RENLDPVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDIT 1364

Query: 523  KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF-- 580
            K+    LR HL ++ Q+     GS+R NL      + + DEI    +       I K   
Sbjct: 1365 KIGLADLRSHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHILKMAN 1422

Query: 581  ---PEG----YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
               PE      ET I   G++LS GQ+Q + ++RAL+ + +IL+LDEAT+A+D E++  I
Sbjct: 1423 EEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLI 1482

Query: 634  NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
              T+    + R  TI++IAHR+ T+  S+ ++VL + G V E      L A+  +  + L
Sbjct: 1483 QETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLADKNTIFYNL 1539

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 116/487 (23%), Positives = 209/487 (42%), Gaps = 65/487 (13%)

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVF--SFGKK 355
            +KI+++ ++  E      K   E L+ VKT++ +  E   L R ++   ++   SF K 
Sbjct: 458 SRKIKVLIKKQMEYKDARIKTVTEILNSVKTVKLYAWEEPMLKRLDHVRNELELESFKKI 517

Query: 356 EALTNATFFS--STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
             + N T F+     IL   S  ++ A    + L   +    L+ F +  +   +    +
Sbjct: 518 AVMNNLTLFAWNCVPILVASSTFLIYALVMDVPLTPQIVFPSLSLFDILNDCIYTIPRTI 577

Query: 414 SNFYSELMKGAGAASRLF--EMTDHTSQIKPSSGKPYVPSWGEIKFEDVSF--SYPTRPG 469
            NF    +        L   E+     + +     P VP    I+  + +F  + PT+  
Sbjct: 578 INFIETGVSMGRLKDFLLAKELDKSFIEFESLPDDPNVPV---IEVHNATFLRNLPTKAT 634

Query: 470 NQ---------------IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           ++               + N   F    G  VCVVG  G GKST    LL      S   
Sbjct: 635 SEENYDEEAMIESSRVALKNIDGFQALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS- 693

Query: 515 MIDGQNISKLS--CKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCF 572
               Q   K+   C S+     +  Q+  +++ S++YN+ +G   +      ++  + C 
Sbjct: 694 --HDQATPKMHFRCDSV----ALCSQQAWILNASVKYNVLFGHKYDEA--SYKATIEACQ 745

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEG 631
               +    +G ET++G +G SLSGGQK RI++ARA+  +  + +LD+  SA+D E  + 
Sbjct: 746 LLPDLGILADGDETLVGEKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKR 805

Query: 632 AINYTLGR---LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            I++ L R   L++++  T+I   + +S ++ S+++  L N G +VE G F E+ + D  
Sbjct: 806 IIDHVLSRKTGLLKNK--TVILTTNSISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAE 862

Query: 689 ELFKLL------------------NDKKPTQLQSQSRNSVETKENEVDDQVLEQVANDFN 730
              K L                    K P  LQ    +++   E E++ +V  ++ N F+
Sbjct: 863 SKLKTLIAEFGSDSSAVKDDEPIPEQKPPVDLQEVEDDAL---EEEINPEVPFELDNAFS 919

Query: 731 LDQKSSK 737
            D +S K
Sbjct: 920 SDFRSRK 926

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 155/542 (28%), Positives = 249/542 (45%), Gaps = 60/542 (11%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
            N   IV+L     +   +L  N+ K +I     FF+   VG +I+R SSD   V  S+  
Sbjct: 1036 NLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 254  NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQE--- 310
              S  FK+                      F+F   LLV  + Y     ++SREL+    
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYN----MPWFFVFNMFLLVIYIYYQTFYIVLSRELKRLIS 1151

Query: 311  -STGNLTKVSEEQLSGVKTIQA------FVAEGKELHRYNNAIRKVFSFGKKEALTNATF 363
             S   +  +  E L+G   I A      F+    E  +YN  I  VF+F       +   
Sbjct: 1152 ISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDFVFNFRSTNRWLSVRL 1209

Query: 364  --FSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELM 421
                +T +L   + L +    +   L  G+ VG L ++ L  E TGS  + +    + +M
Sbjct: 1210 QTIGATIVLAT-AMLALTTMNTKKQLSSGM-VGLLMSYSL--EVTGSLTWIVR---TTVM 1262

Query: 422  KGAGAAS--RLFEMTDHTSQ---IKPSSGKP--YVPSWGEIKFEDVSFSYPTRPGNQIFN 474
                  S  R+ E  +  S+   I P + +P    PS G I+F++ S  Y     + +  
Sbjct: 1263 IETNIVSVERIVEYCELPSEARSINPEN-RPDESWPSKGSIEFKNYSTKYRENL-DPVLK 1320

Query: 475  KLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLG 534
             +N  I+P   + +VG +G GKST++  L R  +P  G I+ID  NIS L    LR HL 
Sbjct: 1321 DINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLA 1380

Query: 535  VVQQEPMLMSGSIRYNLT------------------YGMNSEVTMD-EIRSVAKKCFCHG 575
            ++ Q+     G++R NL                    G + E  +D EIR        +G
Sbjct: 1381 IIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENG 1440

Query: 576  FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
             ++   +     I   G +LS GQ+Q + +ARAL+ + KIL+LDEAT+++D+E++  I  
Sbjct: 1441 NVS---DVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQD 1497

Query: 636  TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            T+ R  + R  TI++IAHR+ T+  S+ +IVL ++G+V E     +L + D++ +F  L 
Sbjct: 1498 TIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLS-DKASIFYSLC 1553

Query: 696  DK 697
            +K
Sbjct: 1554 EK 1555

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 111/479 (23%), Positives = 223/479 (46%), Gaps = 56/479 (11%)

Query: 299 KKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR--KVFSFGKKE 356
           +K++ +S+   +      K   E L+ +K+I+ +  E   + R N+     ++ +F K  
Sbjct: 455 RKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERLNHVRNDMELQNFRKIG 514

Query: 357 ALTNATFFS--STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
            ++N  +F+     ++   S   + +  S   L   +    L+ F +      SA++ + 
Sbjct: 515 IVSNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSLFNI----LNSAIYSVP 570

Query: 415 NFYSELMKGAGAASRL--FEMTDHTS-----QIKPSSGKPYVPSWGEIKFEDVSFSYPTR 467
           +  + +++ + +  RL  F ++D        +I PS  +  +P    I+  +++F + ++
Sbjct: 571 SMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLPV---IEMNNITFLWKSK 627

Query: 468 P--------GNQ--------------IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLR 505
                    GN               + N  +F  + G  VCVVG  G GKST    +L 
Sbjct: 628 EALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKGILG 687

Query: 506 YYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR 565
                SG     G    KL  ++    L    QE  +M+ S+R N+ +G   +    ++ 
Sbjct: 688 QLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWIMNSSVRENILFGHKFDKAYYDL- 741

Query: 566 SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSAL 625
              K C     +   P+G ET++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+
Sbjct: 742 -TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAV 800

Query: 626 DVE-SEGAINYTL-GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
           D E S+  + Y L G+    +  TII   + +  ++ S+ +  L N G ++E G ++ + 
Sbjct: 801 DAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIYALEN-GEIIEQGNYEGVM 859

Query: 684 --ANDQSELFKLLNDKKPTQLQSQSRNSVETK---ENEVDDQVLEQVANDFNLDQKSSK 737
              N  S+L KLL ++  + + + S++ ++T+   E+++D+ +  +V      D+ +++
Sbjct: 860 NRENTNSKLKKLL-EEFDSPIDNGSKSDIQTEHRSESDMDEPLQLKVVESETEDEIATE 917

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 154/554 (27%), Positives = 248/554 (44%), Gaps = 70/554 (12%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F  +F G  +F T     +  ++  +G     +L  + +++I+H    F D  
Sbjct: 918  FYMGLYSFF-VFGG-YIFMT----SQFTIVCFIGVNASKKLNLSAVRRILHTPMAFLDTT 971

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP-- 289
             +G +++R + D   +   +T+NV                       +    F  A P  
Sbjct: 972  PLGRILNRFTKDTDSLDNELTENVR-----LMLAQFANIIGVCVMCIIYLPWFAIAIPFI 1026

Query: 290  LLVGALI---YGKKIRMISR--ELQES--TGNLTKVSEEQLSGVKTIQAFVAEGKELHRY 342
            LL+  L+   Y    R I R   +Q S    NL +V    L G+ TI+ + +E + + + 
Sbjct: 1027 LLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEV----LGGMDTIRFYNSEERFMAKS 1082

Query: 343  NNAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAF 399
            +  I K+   G          A       +    + +I L   +        SVG L  +
Sbjct: 1083 DYLIDKMNEAGYLVVCVQRWVAVLLDMIAVC--FALIIALLCVTRQFHISASSVGVLLTY 1140

Query: 400  MLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKP-SSGKPYVPSWGEIKF 457
            +L      + V   L+   +++       S   E+    +  KP SS  P  P  G+I F
Sbjct: 1141 VLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAYRKPESSPDPSWPQEGKIDF 1200

Query: 458  EDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            E+VSF+Y  RPG   +   L+ +I  G  + + G +G GKSTI S L R  +  SGRI+I
Sbjct: 1201 EEVSFAY--RPGLPAVLKNLSMSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIII 1258

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHG 575
            DG NIS +    LRR L ++ Q+P+L  G+IR NL  +G  S+   DE+     +    G
Sbjct: 1259 DGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSD---DELWDALSR---GG 1312

Query: 576  FITKFPEGYETV----------------------IGPRGASLSGGQKQRIAIARALIKKP 613
             I K  E  E V                      +   G++ S G++Q +A+ARAL++  
Sbjct: 1313 SIDK--ESLEEVKTQKSTGNSKVQELHKFHLDQEVEEEGSNFSLGERQLLALARALVRNS 1370

Query: 614  KILILDEATSALDVESEGAINYTLGRLMRS-RELTIISIAHRLSTIRRSENVIVLGNDGS 672
            K+LILDEATS++D E++  I     R++ +  E TI+ IAHRL TI   + ++VL   G 
Sbjct: 1371 KVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EKGE 1426

Query: 673  VVEMGKFKELYAND 686
            + E      LY  D
Sbjct: 1427 IAEFDSPYNLYKMD 1440

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 104/223 (46%), Gaps = 32/223 (14%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  +N  I  G  + + GP G GK+++ + +    +   G + I+G+ +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
              +   P + + ++R N+ +G  S     +   V K C     +   P G  T IG RG
Sbjct: 653 ---MGGYPWIQNATVRDNIIFG--SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL------ 646
            +LSGGQK RI +AR + K   I + D+  SA+D          +G+L+    L      
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSR--------VGKLIMDECLLGLLNG 759

Query: 647 -TIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            T +   H+LS +  +  VIVLGNDGS V++G  +EL   +Q+
Sbjct: 760 KTRVLATHQLSLVENASRVIVLGNDGS-VDIGTVEELKKRNQT 801

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 141/548 (25%), Positives = 248/548 (45%), Gaps = 80/548 (14%)

Query: 205  GEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 264
            G +   ++ ++++  ++H    FFD   VG +++R S D       + Q +    +    
Sbjct: 1067 GMQASKKIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDI----EGIDQELIPYLEVTVF 1122

Query: 265  XXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVS----- 319
                          +T   F  A  + +     GK     SR+L+    ++TK       
Sbjct: 1123 CLIQCSSILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKR-IDSITKSPIFQHF 1181

Query: 320  EEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSF---- 375
             E L GV TI+AF  E           R +    +K    N  FF  +  +   +F    
Sbjct: 1182 SETLVGVCTIRAFGDEK----------RFILENMEKIDQNNKAFFYLSVAVKWFAFRVDM 1231

Query: 376  ---LIVLAYGSHLV-----LQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 427
                IVL  GS ++     +  GL+   LT  +L+T+    +   L   YS       + 
Sbjct: 1232 IGAFIVLGSGSFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSV 1287

Query: 428  SRLFEMT------------DHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNK 475
             RL E +            DH   +  SS     P  G+I+ E++S  Y +     +   
Sbjct: 1288 ERLKEYSSIVQEKYLGYDEDHIQALNDSSW----PKHGKIEVENLSLRYASNLP-LVLKN 1342

Query: 476  LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGV 535
            + F ++P S V +VG +G GKSTI + L R  +P +G I ID Q+ISK+   +LRR + +
Sbjct: 1343 VCFKVDPQSKVGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITI 1402

Query: 536  VQQEPMLMSGSIRYN----------------LTYGMNSEVTMDEIRSVAKKCFCHGFITK 579
            + Q+P+L +G+I+ N                L   + S +   ++ ++ +    H    K
Sbjct: 1403 IPQDPVLFAGTIKSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHN---K 1459

Query: 580  FPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 639
            F    ++ I   G +LS G++Q + IAR+L+++ KI++LDEATS++D +S+  I      
Sbjct: 1460 FL-NLQSEIVEGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----S 1514

Query: 640  LMRSR--ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
            ++RS+  + TI++IAHRL ++   + ++V+ + G + E G   EL  N++S  +++  D 
Sbjct: 1515 IIRSKFNKSTILTIAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKNERSTFYRMCRDS 1573

Query: 698  KPTQLQSQ 705
               +L  Q
Sbjct: 1574 GDLELLKQ 1581

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 100/212 (47%), Gaps = 9/212 (4%)

Query: 476 LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG---QNISKLSCKSLRRH 532
           LN     G    V+G +G GKS +   LL   D  SG I+I G   ++        L   
Sbjct: 688 LNIIFSIGKLNLVLGSTGSGKSALLMSLLGELDLVSGFIIIPGLEPRHDLIPDHDGLTNS 747

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                Q   L+S +I+ N+ +  N        + V   C  +  +   P G  T IG +G
Sbjct: 748 FAYCSQSAWLVSDTIKNNIVF--NGSYDKSRYKKVIDACGLNRDLNILPAGDLTEIGEKG 805

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQKQRI++ARA+    K ++LD+  SA+D  +   I  N   G+LM++R  T I 
Sbjct: 806 ITLSGGQKQRISLARAVYSHAKHVLLDDCLSAVDSHTAVWIYENCITGQLMKNR--TCIL 863

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
           + H +    R+ +  ++  DG V   G  KEL
Sbjct: 864 VTHNVPLAIRNAHFAIILEDGKVKNQGTIKEL 895

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 149/552 (26%), Positives = 245/552 (44%), Gaps = 48/552 (8%)

Query: 170  IIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD 229
            +++ +G++ F+++ A +L     +N   IVLL V   K   +L   +   +I     FF+
Sbjct: 1004 VLFYVGIYVFISLSAALL-----SNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFE 1058

Query: 230  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
               VG +I+R SSD   +  S+ Q V   F                   L     +    
Sbjct: 1059 TTPVGRIINRFSSDMNSLDDSV-QYVMSFFLVSILDYLVVVIIIGYQVPL---FLIVNAV 1114

Query: 290  LLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK------EL 339
            LLV    Y      +SREL+     S   +  +  E L+G   I AF    +      E 
Sbjct: 1115 LLVIYFYYQVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDRFDYLNVEN 1174

Query: 340  HRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAY--GSHLVLQGGLSVGDLT 397
             ++N  I  +F+F       +    S   ++   + L+ LA   G H      LS G + 
Sbjct: 1175 VQFN--INCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGH-----ALSTGMVG 1227

Query: 398  AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKP--SSGKP--YVPSWG 453
              M Y     + +  +     +L     +  R+ E  D   +  P     +P    PS G
Sbjct: 1228 LLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQG 1287

Query: 454  EIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGR 513
             I+F++ S  Y     + +   L+  I+P   + +VG +G GKST++  L R  +P+ G 
Sbjct: 1288 LIRFKNYSTRYRANL-DPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGT 1346

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFC 573
            I IDG +ISK+  K LR +L ++ Q+     G++R NL      + + +EI    +    
Sbjct: 1347 IDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHL 1404

Query: 574  HGFITKF------PEGYE----TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATS 623
               I K       PE  E    T I   G++LS GQ+Q + ++RAL+ + +IL+LDEAT+
Sbjct: 1405 KPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATA 1464

Query: 624  ALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELY 683
            A+D E++  I  T+    + R  TI++IAHR+ T+  S+ ++VL + G V E      L 
Sbjct: 1465 AVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSNLL 1521

Query: 684  ANDQSELFKLLN 695
            A   S  + L +
Sbjct: 1522 AQKDSIFYNLCD 1533

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 113/224 (50%), Gaps = 20/224 (8%)

Query: 478 FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR--HLGV 535
           F +  G  VCVVG  G GKST    LL       G++     + S  S     R   + +
Sbjct: 649 FQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFRANSVAL 701

Query: 536 VQQEPMLMSGSIRYNLTYGMN-SEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGAS 594
             Q+  +M+ S++ N+ +G    E T    ++  + C     +    +G ET++G +G S
Sbjct: 702 CSQQSWIMNASVKDNVLFGHRFDEATY---KATLEACQLVPDLEILADGDETLVGEKGIS 758

Query: 595 LSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSRELTIIS 650
           LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I   L +   L++++  T+I 
Sbjct: 759 LSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTGLLKNK--TVIL 816

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
             + +S ++ S+++  L  DG +VE G F ++   D S   K L
Sbjct: 817 TTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRL 859

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 137/526 (26%), Positives = 242/526 (46%), Gaps = 38/526 (7%)

Query: 188  VFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAY-- 245
            +F  I      V   + G + +  L +N +   +     FF+   +G +++R S+D Y  
Sbjct: 1007 LFTLIQTVILWVFCTIQGSRYLHTLMTNAV---LRAPMSFFETTPIGRILNRFSNDIYKV 1063

Query: 246  --VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA-PPLLVGALIYGKKIR 302
              V+ R+ +Q   +  K                  +T+  F+F   PL V  + Y +   
Sbjct: 1064 DSVLGRTFSQFFVNAVKVSFTIGVI---------CVTTWQFIFVIVPLGVFYIYYQQYYL 1114

Query: 303  MISRELQESTGNLTKVS-----EEQLSGVKTIQAFVAEGKELHRYNNA-IRKVFSFGKKE 356
              SREL+    ++T+       +E L G+ TI+ +  + K   + N   +    S     
Sbjct: 1115 RTSRELRR-LDSITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQINQCRVDNNMSAFYPS 1172

Query: 357  ALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNF 416
               N        ++G +  L         + QG L+ G +   + Y      ++  +   
Sbjct: 1173 VNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLSYALQITQSLNWIVRM 1232

Query: 417  YSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRPG-NQ 471
              E+     +  R+ E  D  S+    I+    +   P  G+IKFE  S  Y  RP  + 
Sbjct: 1233 TVEVETNIVSVERIKEYADLKSEAPEIIEDHRPQETWPEEGDIKFEHYSTRY--RPELDL 1290

Query: 472  IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR 531
            +   +NF I+P   + +VG +G GKS++   L R  + + G I+ID  +IS +    LR 
Sbjct: 1291 VLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRH 1350

Query: 532  HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI-TKFPEGYETVIGP 590
             L ++ Q+  +  G+IR N+     ++ T ++I  V +       I T   +G +T +  
Sbjct: 1351 KLSIIPQDSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNE 1408

Query: 591  RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
             G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  T+    + R  TI++
Sbjct: 1409 GGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKVLQETIRTSFKDR--TILT 1466

Query: 651  IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            IAHR++TI  ++ ++VL N GS+ E  + K+L  N  S  + L  +
Sbjct: 1467 IAHRINTIMDNDRIMVLDN-GSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 95/392 (24%), Positives = 176/392 (44%), Gaps = 36/392 (9%)

Query: 316 TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGIL 370
           T+V  E L+ +K+++ +  E       E  R N  ++ +   G   AL +  F +    L
Sbjct: 483 TRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQF-NVVPFL 541

Query: 371 GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 430
              S   V  Y     L   L    LT F L        +  + N  + L++ + +  RL
Sbjct: 542 VSCSTFAVFVYTEDRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTALIECSVSVGRL 597

Query: 431 FE-MTDHTSQIKPSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSN 485
           F  +T+   Q       P V   G++     +D +F +  +P  ++    +NF  + G  
Sbjct: 598 FSFLTNEELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKVALKNVNFQAKKGEL 657

Query: 486 VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG 545
            C+VG  G GKS +   +L       G   I G             ++  V Q   +M+G
Sbjct: 658 TCIVGRVGSGKSALIQSILGDLFRVKGFATIHG-------------NVAYVSQVAWIMNG 704

Query: 546 SIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAI 605
           +++ N+ +G   +    E     K C     ++   +G +T++G +G SLSGGQK R+++
Sbjct: 705 TVKDNILFGHKYDAEFYE--KTIKACALTIDLSVLVDGDQTLVGEKGISLSGGQKARLSL 762

Query: 606 ARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSRELTIISIAHRLSTIRRSE 662
           ARA+  +    +LD+  +A+D   +   I + LG   L+ ++  T +   +++S +  ++
Sbjct: 763 ARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVSVLSVAD 820

Query: 663 NVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
           +V +L N G +V+ G + E+  +  S+L KL+
Sbjct: 821 SVSLLEN-GEIVQQGSYDEIMKDGASQLNKLI 851

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 144/538 (26%), Positives = 247/538 (45%), Gaps = 64/538 (11%)

Query: 177  FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDL 236
            F +L+++  I V  ++ +  + VL  V G     ++ + ++ K++H    FFD   +G +
Sbjct: 1089 FYYLSLYFLIGVIQSVLSALKTVLSFVAGINASRKIFNLLLSKVMHAKLRFFDSTPIGRI 1148

Query: 237  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALI 296
            ++R S D     + +T  +   F +                +  +  FLF   +LV  L 
Sbjct: 1149 MNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLI-----TFITPQFLFVA-ILVAVLY 1202

Query: 297  Y--GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAI 346
            Y  G      SREL+     S   + +   E L GV TI+AF  E +     L + +   
Sbjct: 1203 YFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGDESRFMRENLQKIDENN 1262

Query: 347  RKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVL--------QGGLSVGDLTA 398
            R  F       + N        ++G L   ++   G  ++L        + G+S   LT 
Sbjct: 1263 RPFFYLW----VANRWLSFRIDMIGAL---VIFGAGIFVLLNIDHIDSGKAGIS---LTY 1312

Query: 399  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ-IKPSSGKPYV--PSWGEI 455
             + +TE        L   YS +     +  RL E  D   +    S   P V  P  G I
Sbjct: 1313 AITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTPPVEWPQQGRI 1368

Query: 456  KFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
            +  D+S  Y P  P  ++   ++FT++P S V +VG +G GKSTI + L R+ DP +G I
Sbjct: 1369 EVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIITALFRFLDPETGNI 1426

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------------VTM 561
             ID  +I+ +  + LRR + ++ Q+P L +G+I+ NL  Y   ++            VT 
Sbjct: 1427 KIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYTDQQIFEALKRVNLVTQ 1486

Query: 562  DEIR---SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
            +E+    +          I KF +   + I   G ++S GQ+Q + +AR+L++ PKI++L
Sbjct: 1487 EELDRRPTSESSSVSSENINKFLD-LSSEISEGGGNISQGQRQLVCLARSLLRSPKIILL 1545

Query: 619  DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEM 676
            DEAT+++D  S+  I  T+ +       TI++IAHRL ++   + ++V+ + G V E 
Sbjct: 1546 DEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKILVM-DAGEVKEF 1600

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 113/231 (48%), Gaps = 11/231 (4%)

Query: 454 EIKFEDVSFSYPT-RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
           +I FE+ + ++   RP  ++ N LN   + G    ++GP+G GK+++   LL      SG
Sbjct: 695 KIGFENATITWDAERPDFKLKN-LNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLVSG 753

Query: 513 RIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
           +I++   D +    +    +   +    Q   L++ +++ N+ +  NS        +V +
Sbjct: 754 KIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILF--NSPYNEGRYEAVVE 811

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
            C      +    G  T IG RG +LSGGQKQRI++AR+L    + ++LD+  SA+D  +
Sbjct: 812 ACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDSHT 871

Query: 630 EGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
              I  N   G LM  R  T I ++H  +   R+  ++V   +G V   G+
Sbjct: 872 ASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQGE 920

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  142 bits (358), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 146/563 (25%), Positives = 250/563 (44%), Gaps = 79/563 (14%)

Query: 183  FAGILVFGTIANFG----RIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            + G+ +F    N+     +  +L  +G      L    +K+++H    F D   +G +++
Sbjct: 895  YIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGRVLN 954

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYG 298
            R + D   +   +T++V                     A +     ++ P   +     G
Sbjct: 955  RFTKDTDTLDNELTESVR-----------LFVYQTANIAGVIIMCIIYLPWFAIAVPFLG 1003

Query: 299  KKIRMISRELQESTGNLTKVS-----------EEQLSGVKTIQAFVAEGKELHRYNNAIR 347
                +++   Q S   + ++             E LSG+ TI+A+ +E + L + +  I 
Sbjct: 1004 LIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLIN 1063

Query: 348  KVFSFGK-KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFML----- 401
            ++   G    A+      S   I    + +I L   +        SVG L  ++L     
Sbjct: 1064 RMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGL 1123

Query: 402  ---------YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSW 452
                       E   ++V  + N+ +EL +   AA R  EMT           +P+ PS 
Sbjct: 1124 LNGLLRAMTQAENDMNSVERIVNYATELPQ--EAAYRKPEMTPQ---------EPW-PSN 1171

Query: 453  GEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            GE+ F++VS SY  RPG  +  K ++  I+ G  + + G +G GKSTI S L R  + N 
Sbjct: 1172 GEVVFDNVSLSY--RPGLPLVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNE 1229

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE------------ 558
            GR++IDG + SKL    LRR L ++ Q+P+L  GSIR NL  +G   +            
Sbjct: 1230 GRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGT 1289

Query: 559  VTMDEIRSVAKK----CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPK 614
            +  +E+  V  +          + KF    E  +   G + S G++Q +A+ RAL+++ K
Sbjct: 1290 IEAEEVEKVKNQHRDESGSSTGLHKFHLDQE--VEDDGTNFSLGERQLLALTRALVRQSK 1347

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            ILILDEATS++D E++  I   + +       TI+ IAHRL TI   + ++VL N G+V 
Sbjct: 1348 ILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVLDN-GTVK 1404

Query: 675  EMGKFKELYANDQSELFKLLNDK 697
            E    + L+   +  +F+ + DK
Sbjct: 1405 EFDTPRSLF-RIKDTIFREMCDK 1426

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 128/269 (47%), Gaps = 35/269 (13%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  V + G  G GKS++ + L  +     G I  +G   S L C      
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---SLLLCGY---- 623

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFCHGFITKFPEGYETVIGP 590
                  P + + ++R N+ +G     + D++R   V + C     +   P G  T IG 
Sbjct: 624 -------PWIQNTTVRDNILFGS----SFDDVRYKEVIRVCALQADLDILPAGDFTEIGE 672

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTII 649
           RG +LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  L  ++  +  T I
Sbjct: 673 RGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK--TRI 730

Query: 650 SIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNS 709
              H+LS I R+  VI LG  GS  ++G  +EL   + S   KL+      +  +Q++++
Sbjct: 731 LATHQLSLIERASRVIFLGAGGS-FDIGTVEELKERN-SGFVKLM------EFSTQTKSA 782

Query: 710 VETKENEVDDQVLEQVANDFNLDQKSSKL 738
              +  EVDD   E +    N  Q+ +KL
Sbjct: 783 --NQREEVDDHAEENLGQ--NCQQEIAKL 807

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 130/521 (24%), Positives = 234/521 (44%), Gaps = 22/521 (4%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI-KKIIHQDAEFFDRNKVGDLI 237
            +LAI+  + +   +A   + ++L V      ++   N++   ++     FF+   +G ++
Sbjct: 992  YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMANSVLRAPMAFFETTPIGRIL 1051

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R S+D Y V   + +  S  F                  + T        PL V  + Y
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFF----VNAVKVIFTITVICATTWQFIFIIIPLGVCYIYY 1107

Query: 298  GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
             +     SREL+     +   +    +E L G+ T++ +  + +  H     I    S  
Sbjct: 1108 QQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAF 1167

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
                  N        ++G +  L         + QG L+ G     + Y       +  +
Sbjct: 1168 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMAGISLSYALQITQTLNWI 1227

Query: 414  SNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469
                 E+     +  R+ E  D  S+    I+        PS G+IKF + S  Y  RP 
Sbjct: 1228 VRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPE 1285

Query: 470  -NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             + +   +N  I+P   + +VG +G GKS++   L R  + ++G I+IDG  I+++    
Sbjct: 1286 LDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYD 1345

Query: 529  LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEI-RSVAKKCFCHGFITKFPEGYETV 587
            LR  L ++ Q+  +  GS+R N+     ++ T + I R++         ++   +G +  
Sbjct: 1346 LRHRLSIIPQDSQVFEGSLRENI--DPTNQYTDEAIWRALELSHLKEHVLSMSNDGLDAQ 1403

Query: 588  IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT 647
            +   G +LS GQ+Q + +ARA++   KILILDEAT+A+DVE++  +  T+    + R  T
Sbjct: 1404 LTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQETIRTAFKDR--T 1461

Query: 648  IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            I++IAHRL+TI  S+ +IVL N G+V E     +L +N +S
Sbjct: 1462 ILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSNSES 1501

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 113/460 (24%), Positives = 206/460 (44%), Gaps = 63/460 (13%)

Query: 304 ISRELQESTGNL----TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGK 354
           I ++LQ+S        T+V  E L+ +K+++ +  E       E  R N  ++ +   G 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGC 528

Query: 355 KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
             A+T+  F     ++   +F  V  Y     L   L    LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 415 NFYSELMKGAGAASRLFEMTDHTSQIKPSSGK--PYVPSWGEIKF---EDVSFSYPTRPG 469
           +F    ++ + +  RLF    +  +++P S +  P V ++G++     +D +F +  +P 
Sbjct: 588 SF----IEASVSIGRLFTFFTN-EELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPE 642

Query: 470 NQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
            ++    +NF  + G   CVVG  G GK+ + S +L       G   + G          
Sbjct: 643 YKVALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFRVKGFATVHGS--------- 693

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
               +  V Q P +M+G++  N+ +G   +V   E     K C     +    +G +T++
Sbjct: 694 ----VAYVSQVPWIMNGTVMENILFGHKYDVEFYE--KTIKACALTIDLAILMDGDKTLV 747

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG--------- 638
           G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +   I + LG         
Sbjct: 748 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKT 807

Query: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND-- 696
           RL+ + +++ +SIA          + + L ++G +++ G + E+  +  S L+KLLND  
Sbjct: 808 RLLATNKVSALSIA----------DSVALLDNGEIIQKGTYDEITKDADSPLWKLLNDYG 857

Query: 697 ----KKPTQLQSQSRNSVETKENEVDDQVLEQVANDFNLD 732
                K       S+NSV      V+ + LEQ+    +LD
Sbjct: 858 KKNNNKRNDSGDSSKNSVRESSIPVEGE-LEQLQKLDDLD 896

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 130/530 (24%), Positives = 239/530 (45%), Gaps = 48/530 (9%)

Query: 196  GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV 255
            G+ +L  V G     ++ + ++ K++H    FFD    G +++R S D   + + +T  +
Sbjct: 1121 GKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 256  SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
               F +              +    S   + +         Y    R + R    S   +
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPI 1240

Query: 316  TKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
             +   E L GV TI+AF  EG+     L + +   +  F       + N        ++G
Sbjct: 1241 YQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLW----VANRWLAFRIDMIG 1296

Query: 372  DLSF----LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 427
             L      L +L   +HL    G++   LT  + +TE        L   Y+E+     + 
Sbjct: 1297 SLVIFGAGLFILFNINHL--DSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSV 1350

Query: 428  SRLFEMTDHTSQIKPSSGKPYVPSW---GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPG 483
             R+ E  +   +      +   P W   G+I+  D+S  Y P  P  ++   ++F+++  
Sbjct: 1351 ERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQ 1408

Query: 484  SNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLM 543
            S + +VG +G GKSTI + L R+ +P +G I ID  +IS +  + LRR + ++ Q+P L 
Sbjct: 1409 SKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLF 1468

Query: 544  SGSIRYNLT-YGMNSEVTMDE----IRSVAKKCFCHGF---------------ITKFPEG 583
            SG+I+ NL  Y   S+  + E    +  ++++    G                + KF + 
Sbjct: 1469 SGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLD- 1527

Query: 584  YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
              + +   G++LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  + 
Sbjct: 1528 LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKEFQG 1587

Query: 644  RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
               TI++IAHRL ++   + ++V+ + G V E      L  N QS  + +
Sbjct: 1588 S--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/233 (26%), Positives = 109/233 (46%), Gaps = 9/233 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P+     FE+ + S+     +     LN   + G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 510 NSGRIMIDGQNISK---LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
            SG++++      +   +        +    Q   L++ +++ N+ +  NS       ++
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILF--NSPFNEARYKA 806

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             +   I  N   G LM  R  T I ++H ++   R+  ++VL  DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 132/534 (24%), Positives = 239/534 (44%), Gaps = 56/534 (10%)

Query: 196  GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNV 255
            G+ +L    G     ++ + ++ K++H    FFD    G +++R S D   + + +T  +
Sbjct: 1121 GKTILNFAAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYI 1180

Query: 256  SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNL 315
               F +              +    S   + +         Y    R + R    S   +
Sbjct: 1181 QGAFYSLIECLSTVILITFITPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPI 1240

Query: 316  TKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILG 371
             +   E L GV TI+AF  EG+     L + +   +  F       + N        ++G
Sbjct: 1241 YQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLW----VANRWLAFRIDMIG 1296

Query: 372  DLSF----LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAA 427
             L      L +L    H+    G++   LT  + +TE        L   YSE+     + 
Sbjct: 1297 SLVIFGAGLFILFNIDHI--DSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSV 1350

Query: 428  SRLFEMT-------DHTSQIKPSSGKPYVPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFT 479
             R+ E         +   ++ PS      P  G+I+  D+S  Y P  P  ++ N ++F+
Sbjct: 1351 ERVKEYMKIEQEPYNQHKEVPPSQW----PQDGKIEVNDLSLRYAPNLP--RVINNVSFS 1404

Query: 480  IEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQE 539
            ++  S + +VG +G GKSTI + L R+ +P +G I ID  +IS +  + LRR + ++ Q+
Sbjct: 1405 VDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQD 1464

Query: 540  PMLMSGSIRYNLT-YGMNSEVTMDE----IRSVAKKCFCHGF---------------ITK 579
            P L SG+I+ NL  Y   S+  + E    +  ++++    G                I K
Sbjct: 1465 PTLFSGTIKTNLDPYDEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINK 1524

Query: 580  FPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 639
            F +   + +   G++LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +
Sbjct: 1525 FLD-LSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRK 1583

Query: 640  LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
              +    TI++IAHRL ++   + ++V+ + G V E      L  N QS  + +
Sbjct: 1584 EFQGS--TILTIAHRLRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSIFYSM 1634

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 109/233 (46%), Gaps = 9/233 (3%)

Query: 450 PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
           P+      E+ + S+     +     LN   + G    V+GP+G GK+++   LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 510 NSGRIMIDGQNISK---LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
            +G+I++      +   +        +    Q   L++ +I++N+ +  NS       ++
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILF--NSPFNEARYKA 806

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
           V + C           G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 627 VESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
             +   I  N   G LM  R  T I ++H ++   R+  ++VL  DG + + G
Sbjct: 867 SHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQG 917

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 143/541 (26%), Positives = 245/541 (45%), Gaps = 46/541 (8%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +LA++    +F  ++   + V+L V     G K    L + +   +      FF+   +G
Sbjct: 998  YLAVYLAFGIFSALSTLIQTVVLWVYCTIHGSKY---LHAGMANSVFRAPMRFFETTPIG 1054

Query: 235  DLISRLSSDAYVVS----RSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPL 290
             +++R S+D + V     R+ +Q V++  K                   T    LF  PL
Sbjct: 1055 RILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFT--------TWQFTLFVIPL 1106

Query: 291  LVGALIYGKKIRMISRELQ--ESTGN--LTKVSEEQLSGVKTIQAFVAEGKELH----RY 342
             +  + Y +     SREL+  +ST    +    +E L G+ TI+ +  + + +H    R 
Sbjct: 1107 GILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGYNQQRRFIHINQSRM 1166

Query: 343  NNAIRKVF-SFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFML 401
            +N +   + S      L     F  T I+   S L +L   S     G L+ G +   + 
Sbjct: 1167 DNNMSAYYPSVNANRWLAYRLEFIGTIIIFGASSLSILRLKS-----GSLTPGMIGLSLS 1221

Query: 402  YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKF 457
            Y      ++  +     E+     +  R+ E ++  S+    I+     P  P+ G I+F
Sbjct: 1222 YALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIPSEAPYLIEDRRPSPNWPTDGAIQF 1281

Query: 458  EDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            +  S  Y  RPG + I   +N  I+P   + +VG +G GKS++   L R  +   GRI+I
Sbjct: 1282 QHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGRIVI 1339

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGF 576
            DG  I ++    LR  L ++ Q+  +  GS+R N+      + + +EI  V         
Sbjct: 1340 DGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVLDLSHLKNH 1397

Query: 577  ITKF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
            +     +G  T +   G +LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  
Sbjct: 1398 VLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKVLQE 1457

Query: 636  TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN 695
            T+      R  TI++IAHRL+TI  S+ ++VL + G V E    + L  N  +  + L  
Sbjct: 1458 TIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNPGTMFYGLCQ 1514

Query: 696  D 696
            D
Sbjct: 1515 D 1515

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 121/515 (23%), Positives = 217/515 (42%), Gaps = 57/515 (11%)

Query: 205 GEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXX 264
           G  L + L S + KK +   +E  D +  GD+++ +S D         Q + D       
Sbjct: 378 GMNLKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDV--------QRLQD---LAQW 426

Query: 265 XXXXXXXXXXXSASLTSALFLFAPPLLVGALIY------GKKIRMISRELQE----STGN 314
                         LTS   L    + VG +I          +  + + LQ+    +   
Sbjct: 427 CHLIWSGPFQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQ 486

Query: 315 LTKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGI 369
            T++  E L+ +K+++ +  E       E  R    ++ +   G   A+ N  F +    
Sbjct: 487 RTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQF-NIVPF 545

Query: 370 LGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASR 429
               S   V  Y     L   L    LT F L + +  + V  + N Y E     G   R
Sbjct: 546 FVSCSTFAVFVYTEDRPLTTDLVFPALTLFGLLS-FPLAVVPLVLNSYIEASVSIG---R 601

Query: 430 LFE-MTDHTSQIKPSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGS 484
           L+  +T+   Q       P V + G++     ++ +F +  +P  ++    +NF  + G 
Sbjct: 602 LYSFLTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGE 661

Query: 485 NVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMS 544
             CVVG  G GKS +   LL       G   + G             ++  V Q   +M+
Sbjct: 662 LNCVVGRVGSGKSALIQSLLGDLFRVKGFATVHG-------------NIAYVSQVAWIMN 708

Query: 545 GSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIA 604
           G+++ N+ +G   +    E     K C     +   P+G +T++G +G SLSGGQK R++
Sbjct: 709 GTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLS 766

Query: 605 IARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSRELTIISIAHRLSTIRRS 661
           +ARA+  +  I +LD+  +A+D   S   I++ LG   L++++  T I   +++S +  +
Sbjct: 767 LARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKISALSIA 824

Query: 662 ENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
           ++V +L N G +++ G F E+     S L KL+ +
Sbjct: 825 DSVTLLEN-GEIIQQGTFCEITKAADSPLSKLIKE 858

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 148/545 (27%), Positives = 243/545 (44%), Gaps = 52/545 (9%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +L I+ G  V    A   + V+L V     G K    L S+++  I+     FF+   +G
Sbjct: 999  YLLIYFGFGVTSAFATLCQTVVLWVFCTIHGSKY---LHSSMVSSILRAPMTFFETTPIG 1055

Query: 235  DLISRLSSDAY----VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPL 290
             +++R S+D Y    V+ RS +Q   +  K                   T    L   P+
Sbjct: 1056 RILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILVICWN--------TWQFILLVIPM 1107

Query: 291  LVGALIYGKKIRMISRELQESTGNLTKVS-----EEQLSGVKTIQAFVAEGKELHRYNNA 345
             V  L Y +     SREL+    ++TK       +E L G+ TI+ +  + + +H     
Sbjct: 1108 GVLYLYYQQYYLRTSRELRR-LDSITKSPIYAHFQESLGGLATIRGYEQQKRFIHINQAR 1166

Query: 346  IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQ---GGLSVGDLTAFMLY 402
            +    S       +N         LG L   I+    S  +L+   G L+ G +   + Y
Sbjct: 1167 VDNNMSAYYPSINSNRWLAYRLEFLGSL---IIFGAASLSILKLRDGTLTAGMIGLSLSY 1223

Query: 403  TEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFE 458
                  ++  +     E+     +  R+ E  +  S+    I+        P  G IKFE
Sbjct: 1224 ALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPLIIEEKRPSENWPERGAIKFE 1283

Query: 459  DVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
            + S  Y  RP  + +   ++  I+P   V +VG +G GKS++   L R  +   G I++D
Sbjct: 1284 NYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVD 1341

Query: 518  GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577
            G NIS++    LR  L ++ Q+  +  G+IR N+     +  T ++I +  +       I
Sbjct: 1342 GLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNIYTDEQIWNALELSHLKQHI 1399

Query: 578  TKFPE----GYE-----TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
             +  E    G E     T +   G +LS GQ+Q + +ARAL+   KILILDEAT+A+DVE
Sbjct: 1400 LRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLARALLVPSKILILDEATAAVDVE 1459

Query: 629  SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            ++  I  T+    + R  TI++IAHRL+TI  S+ ++VL + G V E    + L  N +S
Sbjct: 1460 TDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGEVAEFDTPQNLLKNTES 1516

Query: 689  ELFKL 693
              + L
Sbjct: 1517 LFYSL 1521

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 101/403 (25%), Positives = 180/403 (44%), Gaps = 54/403 (13%)

Query: 316 TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGIL 370
           T+V  E L+ +K+++ +  E       E  R    ++ +   G   A+TN  F +    L
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 371 GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 430
              S   V  Y     L   L    LT F L T    +    ++ F    ++ + + SRL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRL 599

Query: 431 FE-MTDHTSQIKPSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSN 485
           F  MT+   Q       P V   G+I     ++ +F +  +P  ++    + F  + G  
Sbjct: 600 FSFMTNEELQTDAIQRLPPVKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGEL 659

Query: 486 VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG 545
            C+VG  G GKS     +L       G   I G             ++  V Q P +M+G
Sbjct: 660 ACIVGKVGSGKSAFIQSILGDLFRVKGFATIHG-------------NVAYVSQLPWIMNG 706

Query: 546 SIRYNLTYG--MNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
           +++ N+ +G   N E     +R+    C     ++  P+G +T++G +G SLSGGQK R+
Sbjct: 707 TVKDNILFGHKYNQEFYEKTLRA----CALTIDLSILPDGDQTLVGEKGISLSGGQKARL 762

Query: 604 AIARALIKKPKILILDEATSALDVE-SEGAINYTLG---------RLMRSRELTIISIAH 653
           ++ARA+  +  + +LD+  +A+D   S+  I + +G         R++ + +++++SIA 
Sbjct: 763 SLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLATNKISVLSIAD 822

Query: 654 RLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
                      I L +DG +V+ G + E+  N  S L KL+++
Sbjct: 823 N----------ITLLDDGEIVQQGTYNEVTDNINSPLCKLISE 855

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 147/565 (26%), Positives = 244/565 (43%), Gaps = 77/565 (13%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            +L I+  I +  +I    + ++    G     ++   ++ K++H    FFD   +G +++
Sbjct: 1097 YLTIYFCIGLLQSIVGAAKTLISYYFGINASRKIFRKLLDKVLHAKLRFFDSTPIGRIMN 1156

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYG 298
            R S D   + + +       F +                +    +    P  L  A+I G
Sbjct: 1157 RFSKDMEGIDQDLAPYFQGAFYSFIE-----------CITTIILITFITPQFLSVAIIVG 1205

Query: 299  KKIRMI-------SRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR 347
                MI       SREL+     +   + +   E L GV TI+AF  E + L      I 
Sbjct: 1206 MLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFGDESRFLRENLLKID 1265

Query: 348  KVFSFGKKEALTNATFFSSTGILGDLSFLI-----VLAYGSHLVLQGGLSVGD------- 395
            +           N  FF        LSF I     ++ +GS + +   ++  D       
Sbjct: 1266 E----------NNRPFFYLWVANRWLSFRIDVIGALVVFGSGIFILTNINTIDSGMAGIS 1315

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTS-----QIKPSSGKPYV 449
            LT  + +TE        L  FYSE+     +  R+ E MT         Q+  S      
Sbjct: 1316 LTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPADW 1371

Query: 450  PSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDP 509
            P  G I+  D+S  Y       I N + F ++P + V VVG +G GKSTI + L R+ + 
Sbjct: 1372 PEEGRIEVSDLSLRYAAHLPKVIKN-VTFNVDPRAKVGVVGRTGAGKSTIITALFRFLEA 1430

Query: 510  NSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE---------- 558
             +G I IDG +I+ ++   LRR + ++ Q+P L SG+I+ NL  Y    +          
Sbjct: 1431 ETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRRV 1490

Query: 559  --VTMDEIRSVAKK-----CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIK 611
              VT +E+ S  +            I +F +  E+ I   G + S GQ+Q I +AR+L++
Sbjct: 1491 NLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEGGTNFSQGQRQLICLARSLLR 1549

Query: 612  KPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDG 671
             PKIL+LDEAT+++D +S+  +  T+       E TI++IAHRL ++   + ++V+G  G
Sbjct: 1550 SPKILLLDEATASIDYDSDAKVQETIR--TEFSESTILTIAHRLRSVIDYDKILVMGA-G 1606

Query: 672  SVVEMGKFKELYANDQSELFKLLND 696
             V E      L  N  S  + +  +
Sbjct: 1607 EVKEYDHPYSLLLNKNSIFYSMCEN 1631

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 118/251 (47%), Gaps = 15/251 (5%)

Query: 432 EMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGP 491
           E TD  +Q+  ++ K       +I F++ + ++     +     LN   + G    ++GP
Sbjct: 684 EDTDKYNQLTVATNK------NQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGP 737

Query: 492 SGRGKSTIASLLLRYYDPNSGRIMIDGQNISK---LSCKSLRRHLGVVQQEPMLMSGSIR 548
           +G GK+++   LL   +   G+I++   N      +        +    Q   L++ ++R
Sbjct: 738 TGSGKTSLLMALLGEMNLLEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVR 797

Query: 549 YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
            N+ +  NS        +V + C           G  T IG +G +LSGGQKQRI++ARA
Sbjct: 798 NNILF--NSPYNETRYHNVVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARA 855

Query: 609 LIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
           L    + ++LD+  SA+D  +   +  N   G LM  R  T I ++H ++   R+ +++V
Sbjct: 856 LYSNSRHVLLDDCLSAVDAHTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVV 913

Query: 667 LGNDGSVVEMG 677
           +  DG V + G
Sbjct: 914 MLEDGQVKDQG 924

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 145/560 (25%), Positives = 249/560 (44%), Gaps = 64/560 (11%)

Query: 168  PPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEF 227
            PP  Y +G++ F  +FA  +        G+  +L  +G      L    +++I+H    +
Sbjct: 930  PPSFY-MGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKCLNLRAVRRILHTPMSY 982

Query: 228  FDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA 287
             D   +G +++R + D    + S+   +++  +                        +  
Sbjct: 983  IDTTPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAI 1038

Query: 288  PPLLVGALIYGKKIRMISRELQESTG--------NLTKVSEEQLSGVKTIQAFVAEGKEL 339
            P LLV  ++     +   RE++            NL +V    L G+ TI+A+ ++ + L
Sbjct: 1039 PFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFL 1094

Query: 340  HRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL-----SFLIVLAYGSHLVLQGGLSVG 394
             + +  I K+   G    +         GI  D+     + +I L   +        SVG
Sbjct: 1095 AKSDFLINKMNEAGYLVVVLQ----RWVGIFLDMVAIAFALIITLLCVTRAFPISAASVG 1150

Query: 395  DLTAFMLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSW 452
             L  ++L      + +   ++   +++       S   ++       KP    P   PS 
Sbjct: 1151 VLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPPESWPSK 1210

Query: 453  GEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            G+I FE+V F+Y  RPG  I  K  N  I+ G  + + G +G GKSTI S L R  +  +
Sbjct: 1211 GKIVFENVDFAY--RPGLPIVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTA 1268

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR------ 565
            G+I ID  +IS+L    LR+ L ++ Q+P+L  G+IR NL      E T DE+       
Sbjct: 1269 GQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNL--DPFDERTDDELWDALVRG 1326

Query: 566  -SVAKKCF------------CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKK 612
             ++AK                HG + KF    +  +   G++ S G++Q +A+ RAL+++
Sbjct: 1327 GAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQ 1384

Query: 613  PKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
             KILILDEATS++D E++G I   +  +    + TI+ IAHRL TI   + ++VL   G 
Sbjct: 1385 SKILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGE 1441

Query: 673  VVEMGKFKELYANDQSELFK 692
            V E      L++ + S +FK
Sbjct: 1442 VAEYDTPWALFSQEDS-IFK 1460

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 115/237 (48%), Gaps = 27/237 (11%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  + + GP G GKS++ + +        G+I ++G     L C      
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG---DLLMCGY---- 656

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + ++R N+ +G  S    ++   V   C     +   P G  T IG RG
Sbjct: 657 -------PWIQNATVRDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIA 652
            +LSGGQK RI +AR++ KK  I + D+  SA+D      I       M S +  I++  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILA-T 766

Query: 653 HRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNS 709
           H+LS I R+  VIVLG DG  V++G  +EL A +++    L+N      LQ  S+NS
Sbjct: 767 HQLSLIERASRVIVLGTDGK-VDIGTVEELKARNKT----LIN-----LLQFSSQNS 813

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 146/572 (25%), Positives = 247/572 (43%), Gaps = 94/572 (16%)

Query: 177  FDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDL 236
            F +L+I+ GI    +     R ++    G     ++  +++  ++H    FFD   +G +
Sbjct: 1125 FYYLSIYFGIGALQSSLAAIRNIINFTTGLNASRKIFKSLLHTVLHSKLRFFDATPIGRI 1184

Query: 237  ISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALI 296
            ++R S D   V + +T  +   F                 A +T    + A  + +G L 
Sbjct: 1185 MNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLI----AFITPQFLILA--IFIGFLY 1238

Query: 297  Y--GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAI 346
            Y  G      SREL+     +   + +   E L G+ TI+A+  E +     LH+ +   
Sbjct: 1239 YLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRAYGDEKRFMLENLHKIDE-- 1296

Query: 347  RKVFSFGKKEALTNATFFSSTGILGDLSF-------LIVLAYGSHLVLQ-----GGLSVG 394
                         N  FF        LSF       L+V   G  ++L       GL+  
Sbjct: 1297 ------------NNKPFFYLWAFNRWLSFRIDMIGSLVVFGAGVFIILNIDNLDSGLAGI 1344

Query: 395  DLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY------ 448
             LT  + +TE    A   L  FY+++     +  RL E  +   +       PY      
Sbjct: 1345 SLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQE-------PYEEHLER 1393

Query: 449  -----VPSW---GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTI 499
                 V +W   G+I+  ++S  Y P  P  ++   + F +EP   V VVG +G GKSTI
Sbjct: 1394 SEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGAGKSTI 1451

Query: 500  ASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEV 559
             + L R+ D  +G I ID  +I+ ++   LRR + ++ Q+P L SG+IR NL     +E 
Sbjct: 1452 ITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNL--DPYNEF 1509

Query: 560  TMDEIRSVAKKC------------------FCHGFITKFPEGYETVIGPRGASLSGGQKQ 601
            + D I    ++                        + KF    +  I   G +LS GQ+Q
Sbjct: 1510 SDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFL-NLKNEITEGGNNLSHGQRQ 1568

Query: 602  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRS 661
             + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +    +E TI++IAHRL ++   
Sbjct: 1569 LVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKESTILTIAHRLRSVCDY 1626

Query: 662  ENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
            + ++V+ + G V E      L  N  S  + +
Sbjct: 1627 DKILVM-DAGEVKEYDHPYSLLLNKNSIFYSM 1657

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/228 (27%), Positives = 111/228 (48%), Gaps = 9/228 (3%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I F++ + ++  +        LN   +PG    V+GP+G GKS++   LL      +G I
Sbjct: 731 IAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNI 790

Query: 515 MI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
           ++   D ++   +    +   +    Q   L++ ++R N+ +  NS        +V + C
Sbjct: 791 IVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILF--NSPYNEARYNAVVEAC 848

Query: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
                      G  T IG +G +LSGGQKQR+++ARAL    + ++LD+  SA+D  +  
Sbjct: 849 CLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTAL 908

Query: 632 AI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
            I  N   G LM +R  T I ++H ++   R+  ++V+  DG V + G
Sbjct: 909 WIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 139/511 (27%), Positives = 239/511 (46%), Gaps = 58/511 (11%)

Query: 216  VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 275
            ++ K++H    FFD   +G +++R S D   + + +T  V    ++              
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 276  SASLTSALFLFAPPLLVGALIYGKKIRMIS--RELQ--ESTGN--LTKVSEEQLSGVKTI 329
               +T+   + A  LLV  L Y   +  +S  REL+  EST    + +   E L GV TI
Sbjct: 1192 ITYITNGFIVVA--LLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTI 1249

Query: 330  QAFVAEGKELHRYNNAIRKVFSFGKK---EALTNATFFSSTGILGDLSFLIVLAYGSHLV 386
            +A+   G E+      + K+    K      + N        I+G L   ++   G  ++
Sbjct: 1250 RAY---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSL---VIFGAGVLVL 1303

Query: 387  LQ-----GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIK 441
            +       GL+   LT  + +TE    +   L   YS +     +  R+ E  D   Q  
Sbjct: 1304 MNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMD-IEQEP 1358

Query: 442  PSSGKPYV----PSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGK 496
             S+G   V    PS G+I+  D+S  Y P+ P  ++   ++FT+EP   V VVG +G GK
Sbjct: 1359 YSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGK 1416

Query: 497  STIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMN 556
            STI + L R+ DP +G I ID  +I+ +  K LR+ + ++ Q+P L +G+I+ NL     
Sbjct: 1417 STIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNL--DPY 1474

Query: 557  SEVTMDEIRSVAKKC--------------FCHGFITKFPEGYETVIGPRGASLSGGQKQR 602
            +E   D+I    ++                    + KF    ++ I   G++LS GQ+Q 
Sbjct: 1475 NEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSENVNKFL-NLQSEISEGGSNLSQGQRQL 1533

Query: 603  IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSE 662
            + +AR+L++ P I++LDEAT+++D  S+  I  T+      ++ TI++IAHRL ++   +
Sbjct: 1534 MCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYD 1591

Query: 663  NVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
             ++V+ + G V E      L  N  S  + +
Sbjct: 1592 KILVM-DAGEVKEYDHPYSLLLNKNSIFYSM 1621

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 114/231 (49%), Gaps = 11/231 (4%)

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            +I  E+V+ S+  +  +     LN   + G    V+GP+G GK+++   LL       G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 513 RIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
           +I +   D +         L   +    Q   L++ +++ N+ +  N+E   +   +V  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILF--NAEYNEERYLAVIS 813

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
            C           G  T IG RG +LSGGQKQRI++ARAL    K ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 630 EGAI--NYTLGRLMRSRELTIISIAHRLS-TIRRSENVIVLGNDGSVVEMG 677
              I  N  +G LM +R  T I ++H ++ T++ +E VI++ N G +  +G
Sbjct: 874 AAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMIDN-GKISHIG 921

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 138/528 (26%), Positives = 229/528 (43%), Gaps = 88/528 (16%)

Query: 216  VIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXX 275
            ++ ++++    FFD   +G +++R S D  V+   +   +   F                
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 276  SAS-LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVA 334
            +   L  A+F+    + +G L Y    R + R    S   + +   E LSG+ TI+AF  
Sbjct: 1199 TPKFLIIAIFIICSSITIGYL-YLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRAFGN 1257

Query: 335  EGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLI-------VLAYGSHLVL 387
            E K L    + I +           N  FF    +   LSF I       V   G+ ++L
Sbjct: 1258 EIKFLKENLDFIDE----------NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGAFILL 1307

Query: 388  QG-----GLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ--- 439
                   GL+   LT  + +TE+       +  FYS +     +  RL E  +   +   
Sbjct: 1308 NADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEEEALA 1363

Query: 440  ----IKPSSGKPYVPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGR 494
                I PS   P     G I F + S  Y P  P   +  +LN  I+ GS + VVG +G 
Sbjct: 1364 DPGAITPSENWPVQ---GAITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTGA 1418

Query: 495  GKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIR------ 548
            GKSTI S L R+ D +SG+I+ID  +IS+++ + LR  L ++ Q+P L  G+IR      
Sbjct: 1419 GKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPN 1478

Query: 549  -----------------------YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYE 585
                                    NL Y  N++V  DE          + F+       +
Sbjct: 1479 EEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDE----------NIFL-----NLD 1523

Query: 586  TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRE 645
            + I   G +LS GQ+Q I +AR+++   KI++LDEAT+++D +S+  +  T+      + 
Sbjct: 1524 SPISEGGINLSQGQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK- 1582

Query: 646  LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
             TI++IAHR+ ++   + ++VL + G  +E      L  N  S  + +
Sbjct: 1583 -TILTIAHRIKSVIDYDKILVL-DAGQALEFDHPYVLLQNKSSIFYSM 1628

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 109/210 (51%), Gaps = 13/210 (6%)

Query: 476 LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC----KSLRR 531
           +N   E G    V+GP+G GK+++   LL      SG++ +     SK +      +L  
Sbjct: 735 INAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLE-SKFNLIPESDNLLN 793

Query: 532 HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
            +    Q P + + +IR N+ + M  +   D   +V   C           G +T++G +
Sbjct: 794 SIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILNLGDKTIVGDK 851

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI-NYTL-GRLMRSRELTII 649
           G+ LSGGQKQRI++ARAL  K + LILD+  SA+D  S   I N  + G LM+ R  T I
Sbjct: 852 GSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWIYNVCITGPLMQGR--TCI 909

Query: 650 SIAHRLS-TIRRSENVIVLGNDGSVVEMGK 678
            ++H +S TI+++  V ++ N G +V  G+
Sbjct: 910 LVSHNVSLTIKKASKVFMIEN-GYIVASGR 938

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  139 bits (349), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 128/526 (24%), Positives = 237/526 (45%), Gaps = 22/526 (4%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI-KKIIHQDAEFFDRNKVGDLI 237
            +L I+  + +   +A   + ++L V      ++   N++   ++     FF+   +G ++
Sbjct: 992  YLGIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA-PPLLVGALI 296
            +R S+D Y V   + +  S  F                   +T+  F+F   PL V  + 
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFF-----VNAVKVTFTITVICVTTWQFIFIIVPLGVFYIY 1106

Query: 297  YGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSF 352
            Y +     SREL+     +   +    +E L G+ T++ +  + +  H     I    S 
Sbjct: 1107 YQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSA 1166

Query: 353  GKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFG 412
                   N        ++G +  L         + QG L+ G +   + Y       +  
Sbjct: 1167 FYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNW 1226

Query: 413  LSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRP 468
            +     E+     +  R+ E  D  S+    I+        P  G+IKF   S  Y  RP
Sbjct: 1227 IVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RP 1284

Query: 469  G-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCK 527
              + +  +++  I+P   + +VG +G GKS++   L R  + ++G I+IDG  I+++   
Sbjct: 1285 ELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLY 1344

Query: 528  SLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETV 587
             LR  L ++ Q+  +  G++R N+   +N        R++         ++   +G ++ 
Sbjct: 1345 DLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMWRALELSHLKEHILSMSNDGLDSQ 1403

Query: 588  IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT 647
            +   G++LS GQ+Q + +ARA++ + KIL+LDEAT+A+DVE++  I  T+    + R  T
Sbjct: 1404 LTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--T 1461

Query: 648  IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
            I++IAHRL+TI  S+ +IVL N G V E     +L  N +S  + L
Sbjct: 1462 ILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLLTNTKSLFYSL 1506

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/411 (23%), Positives = 188/411 (45%), Gaps = 42/411 (10%)

Query: 304 ISRELQESTGNL----TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGK 354
           I ++LQ+S        T+V  E L+ +K+++ +  E       E  R N  +  +   G 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGC 528

Query: 355 KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
             A+T+  F     ++   +F  V  Y     L   L    LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 415 NFYSELMKGAGAASRLFEMTDHTSQIKPSSGK--PYVPSWGEIKF---EDVSFSYPTRPG 469
           +F    ++ + +  RLF    +  +++P S +  P V + G+I     +D +F +  +P 
Sbjct: 588 SF----IEASVSIGRLFSFFTN-EELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPE 642

Query: 470 NQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
            ++    +NF  + G   CVVG  G GK+ + S  L             G         S
Sbjct: 643 YKVALKNINFQAKKGELTCVVGKVGSGKTALLSSTL-------------GDLFRVKGFAS 689

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
           +   +  V Q P +M+G+++ N+ +G   +    E     K C     +    +G +T++
Sbjct: 690 VHGSVAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDQTLV 747

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSRE 645
           G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +   + + LG   L+ ++ 
Sbjct: 748 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTK- 806

Query: 646 LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            T +   +++S +  ++++ +L N G +++ G + ++  +  S L+KL+ D
Sbjct: 807 -TKLLATNKVSALSVADSIALLDN-GEIIQQGTYDDITKDADSPLWKLIKD 855

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 126/523 (24%), Positives = 234/523 (44%), Gaps = 20/523 (3%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI-KKIIHQDAEFFDRNKVGDLI 237
            +LAI+  + +   +A   + ++L V      ++   N++   ++     FF+   +G ++
Sbjct: 992  YLAIYFALGIGSALATLIQTIILWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1051

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R S+D Y V   + +  S  F                  + T        PL V  + Y
Sbjct: 1052 NRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLGVFYIYY 1107

Query: 298  GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
             +     SREL+     +   +    +E L G+ T++ +  + +  H     I    S  
Sbjct: 1108 QQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAF 1167

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
                  N        ++G +  L         + QG L+ G +   + Y       +  +
Sbjct: 1168 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWI 1227

Query: 414  SNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469
                 E+     +  R+ E  D  S+    I+        P+ G+I+F + S  Y  RP 
Sbjct: 1228 VRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGDIRFNNYSTRY--RPE 1285

Query: 470  -NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             + +  ++N  I+P   V +VG +G GKS++   L R  + + G I+IDG +I+++    
Sbjct: 1286 LDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYD 1345

Query: 529  LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
            LR  L ++ Q+  +  G++R N+   +N        R++         ++   +G +  +
Sbjct: 1346 LRHKLSIIPQDSQVFEGTVRENID-PINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQL 1404

Query: 589  GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTI 648
               G++LS GQ+Q + +ARA++   KIL+LDEAT+A+DVE++  +  T+    + R  TI
Sbjct: 1405 SEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TI 1462

Query: 649  ISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
            ++IAHRL+TI  S+ +IVL N G V E     +L +N +S  +
Sbjct: 1463 LTIAHRLNTIMDSDRIIVLDN-GKVAEFDTPGQLLSNSKSLFY 1504

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 114/453 (25%), Positives = 212/453 (46%), Gaps = 49/453 (10%)

Query: 304 ISRELQESTGNL----TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGK 354
           I ++LQ+S        T+V  E L+ +K+++ +  E       E  R N  ++ +   G 
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 528

Query: 355 KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
             A+T+  F     ++   +F  V  Y     L   L    LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 415 NFYSELMKGAGAASRLFEMTDHTSQIKPSSGK--PYVPSWGEIKF---EDVSFSYPTRPG 469
           +F    ++ + +  RLF    +  +++P S +  P V + G+I     +D +F +  +P 
Sbjct: 588 SF----IEASVSIGRLFSFFTN-EELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPE 642

Query: 470 NQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
            ++    ++F    G+  C+VG  G GK+ + S +L       G   + G       C  
Sbjct: 643 YKVALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG-------C-- 693

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
               +  V Q P +M+G+++ N+ +G   +    E     K C     +    +G +T++
Sbjct: 694 ----IAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDKTLV 747

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSRE 645
           G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +   I + LG   L+ ++ 
Sbjct: 748 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK- 806

Query: 646 LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND--KKPTQLQ 703
            T I   +++S +  ++++ +L N G +++ G + ++  +  S L+KLLND  KK    Q
Sbjct: 807 -TRILATNKVSALSIADSIALLDN-GEIIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQ 864

Query: 704 SQ----SRNSVETKENEVDDQVLEQVANDFNLD 732
           S+    S+NSV      V+ + LEQ+    +LD
Sbjct: 865 SEECDSSKNSVRESSIPVEGE-LEQLQKLNDLD 896

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 148/555 (26%), Positives = 253/555 (45%), Gaps = 58/555 (10%)

Query: 176  MFDFLAIFAGILVFGTIAN-FGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            ++ F+A++A I +     N F  I++L     +    L  ++ K II    +FF+   +G
Sbjct: 1001 VWKFVAVYALIGLGSAAFNIFRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIG 1060

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +I+R SSD   V  ++    S  F++                S+    FL    L++  
Sbjct: 1061 RVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVIL-----VSVAMPWFLLFNALIMII 1115

Query: 295  LIYGKKIRMI-SRELQESTG----NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKV 349
              Y +K+ ++ SREL+  T      +  +  E L G   I A          YN++  K+
Sbjct: 1116 YFYYEKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISA----------YNHS--KM 1163

Query: 350  FSFGKKEALT---NATF-FSSTGI-----LGDLSFLIVLAYG----SHLVLQGGLSVGDL 396
            F F   E +    N  F F ST       L  +   I+L  G    + L     +  G +
Sbjct: 1164 FKFMNIERVQYNLNVLFTFRSTNRWLSIRLQSIGAFIILCTGLLALTTLRTSSPIGSGLI 1223

Query: 397  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMT----DHTSQIKPSSGKPYVPSW 452
               M Y     SA+  +     ++     +  R+ E      +    I  +  +   P  
Sbjct: 1224 GLLMSYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQR 1283

Query: 453  GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            G I+F++ + +Y       +   ++ TI P   V +VG +G GKST++  L R  +   G
Sbjct: 1284 GSIEFKNYTTTYRANLS-PVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEG 1342

Query: 513  RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKC 571
             I IDG +IS++    LR ++ ++ Q+     G++R NL  +  +++V   E+ +V +  
Sbjct: 1343 TIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKHTDV---ELWNVIELS 1399

Query: 572  FCHGFITKFPE---------GYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
                 + +  E         G +  I   G++LS GQ+Q + +ARAL+ + K+L+LDEAT
Sbjct: 1400 HLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEAT 1459

Query: 623  SALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
            +A+DVE++  I  T+    + R  TI++IAHRL TI  ++ ++VL + G V E    K L
Sbjct: 1460 AAVDVETDKIIQETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNL 1516

Query: 683  YANDQSELFKLLNDK 697
             + D+S LF  L DK
Sbjct: 1517 LS-DESTLFYQLCDK 1530

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 104/451 (23%), Positives = 204/451 (45%), Gaps = 62/451 (13%)

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEA 357
            KK++ +++   +      K   E L+ +K+I+ +  E   + + ++ +R     G  + 
Sbjct: 447 SKKVKTLTKTQMKYKDARIKTITEILNSMKSIKLYAWEKPMMQKLDH-VRNDLEIGNLKK 505

Query: 358 L---TNATFFSSTGI--LGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFG 412
           +   +N  +F+   +  L   S   +    S   L   L    L+ F +  E    A++ 
Sbjct: 506 IGIASNLIYFAWNCVPLLVTCSTFGIFTLISDEPLTPELVFPALSLFNILNE----AIYA 561

Query: 413 LSNFYSELMKGAGAASRL--FEMTDHTSQ-IKPSSGKP---YVPSWGEIKFEDVSFSYPT 466
           + +  + +++   + +RL  F +++   +     +GKP   Y+P+   ++ E+ +F + +
Sbjct: 562 IPSTINTMIEVTVSLNRLKKFLLSEELDRSFIEQTGKPANEYIPA---VEIENATFLWKS 618

Query: 467 RPGNQIFNKLN-------------------FTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
           +   Q+ N  N                   FT  P S  CV+G  G GK+T+   +L   
Sbjct: 619 QA--QLINSENDDSEANIETTQVALKNIDHFTASPKSLTCVIGKVGSGKTTLLKAILGQL 676

Query: 508 DPNSGRIMIDGQNIS-KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
              SG      ++IS KLS +     +    QE  +M+ +I+ N+ +G   + T   +  
Sbjct: 677 PCISG----SKESISPKLSIRG--ESIAYCPQEAWIMNDTIKENILFGHKFDETYYTLTV 730

Query: 567 VAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
            A  C         P+G +T++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+D
Sbjct: 731 AA--CELLADFDILPDGDQTLVGEKGISLSGGQKARVSLARAVYSRADIYLLDDILSAVD 788

Query: 627 VE-----SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
                   E  ++   G L   R  T+I   + +S ++ S+ +  L N G +VE G + +
Sbjct: 789 AGVSKKIVENVLDSNSGLL---RNKTVILSTNTVSVLKHSQLIYALEN-GIIVERGNYND 844

Query: 682 LY----ANDQSELFKLLNDKKPTQLQSQSRN 708
           +     ++D+S++  LL     +  + +S N
Sbjct: 845 IIESANSDDESKISALLKQFDVSLAKRESSN 875

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 150/573 (26%), Positives = 265/573 (46%), Gaps = 70/573 (12%)

Query: 171  IYGLGMFDFLAIFAGILV-FGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFD 229
            +Y L M+  + I   +L    T+A F       + G +   ++ +N++  ++H +  FFD
Sbjct: 1040 VYYLSMYFLIGIIQALLGGIKTMATF-------LSGLQASKKIFNNMLDLVLHANIRFFD 1092

Query: 230  RNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP 289
               VG +++R + D       + Q +    +                  +T    + A  
Sbjct: 1093 VTPVGRIMNRFAKDI----EGVDQELIPYLEVTIFCLIQCLSIIFLITIITPRFLVVAVV 1148

Query: 290  LLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNA 345
            +LV     GK      REL+     +   + +   E L+GV TI+AF  E + +    + 
Sbjct: 1149 VLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIRAFGDEKRFILENMDK 1208

Query: 346  IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGG----LSVGDLTAFML 401
            I +           N  FF  +  +   +F + +  G+ +VL  G    L++GD+ + + 
Sbjct: 1209 IDQ----------NNRAFFYLSVAVKWFAFRVDII-GAFIVLGSGSFILLNIGDIDSSLA 1257

Query: 402  YTEYTGSAVF-----GLSNFYSELMKGAGAASRLFEMT---------DHTSQIKPSSGKP 447
                T S +F      L   YS       +  RL E +         +H   ++ S    
Sbjct: 1258 GISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQENYNENHIQALQNSLW-- 1315

Query: 448  YVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
              P  G+I+ +++S  Y +     I N ++FT++P + + +VG +G GKSTI + L R  
Sbjct: 1316 --PEHGKIEVDNLSLRYASNLPPVIKN-VSFTVDPQTKIGIVGRTGAGKSTIITALFRLL 1372

Query: 508  DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL----------TYGMNS 557
             P +G I IDG +ISK+   +LRR + ++ Q+P+L +G+I+ NL           + + S
Sbjct: 1373 KPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDPYDEYDERRIFKVLS 1432

Query: 558  EVTMDEIR----SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
            +V +   R    ++ ++    G   +F     T I   G +LS G+KQ + IAR+L+++P
Sbjct: 1433 QVNLISSRELEETLNREENFSGVHNRFL-NLRTEIVEGGLNLSQGEKQLLFIARSLLREP 1491

Query: 614  KILILDEATSALDVESEGAINYTL-GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
            KI++LDEATS++D +S+  I   +     RS   TI++IAHRL ++   + V+V+ + G 
Sbjct: 1492 KIILLDEATSSIDYDSDHLIQGIIRNEFSRS---TILTIAHRLRSVIDYDKVLVM-DAGE 1547

Query: 673  VVEMGKFKELYANDQSELFKLLNDKKPTQLQSQ 705
            V E     EL  N++S  + +  D    QL  Q
Sbjct: 1548 VKEYDHPYELLKNERSIFYSMCRDSGDLQLLKQ 1580

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 97/387 (25%), Positives = 171/387 (44%), Gaps = 41/387 (10%)

Query: 321 EQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNAT----FFSSTGILGDLSFL 376
           E L  ++ ++ F  E    +   ++ +K   F  +++L  A     +F +  ++  ++F 
Sbjct: 530 ECLQNIRIVKYFAWENNISNDIKSSRQKELKFLFRKSLLWAVSSFLWFVTPTLVTSVTFA 589

Query: 377 IVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDH 436
           + + +     L   L+   L+ F L      + +  LSN  S + +   +  R+ E  + 
Sbjct: 590 VYI-FVQQQELNAPLAFTTLSLFTL----LKTPLDQLSNMLSFMNQSKVSLERIVEFLNE 644

Query: 437 TSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNK-----LNFTIEPGSNVCVVGP 491
               K +      P   +IKF+  +  +     +   NK     LN     G    ++G 
Sbjct: 645 EDTAKYNQ-LTVSPDKNKIKFKKATLVWNENDND--INKFRLCDLNINFRIGKLNLILGS 701

Query: 492 SGRGKSTIASLLLRYYDPNSGRIMIDG-----QNISKLSCKSLRRHLGVVQQEPMLMSGS 546
           +G GKS +   LL      SG I++ G       I  L+   L        Q   L++G+
Sbjct: 702 TGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGT 759

Query: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
           +R N+ +  N     +  ++V   C     +   P G  T IG +G +LSGGQKQRI++A
Sbjct: 760 VRNNIIF--NGVYDENRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLA 817

Query: 607 RALIKKPKILILDEATSALDVESEGAINYTL---GRLMRSRELTIISIAHRLS-TIRRSE 662
           RA+    K ++LD+  SA+D  +   I Y +   G LM++R  T I + H +S  IR++ 
Sbjct: 818 RAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAY 874

Query: 663 NVIVLGN-----DGSVVEM---GKFKE 681
             ++L N      G++ E+   G FKE
Sbjct: 875 FAVILENGKVKSQGTITELKNKGVFKE 901

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 130/491 (26%), Positives = 223/491 (45%), Gaps = 33/491 (6%)

Query: 227  FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF 286
            FF+   +G +++R S+D Y V   + +  S  F                  S T      
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFF----VNAVKVSFTIIVICSSTWQFVFV 1075

Query: 287  APPLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELH-- 340
              PL    + Y +     SREL+     +   +    +E L G+ TI+ +  +G+ LH  
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHIN 1135

Query: 341  --RYNNAIRKVF-SFGKKEALT-NATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
              R +N +   + S      L     F  S  ILG  +  +        + QG L+ G +
Sbjct: 1136 QARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFR------LKQGALTPGMI 1189

Query: 397  TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKP--SSGKPY--VPSW 452
               + Y      ++  +     E+     +  R+ E  + T +      S +P    P+ 
Sbjct: 1190 GLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWPTH 1249

Query: 453  GEIKFEDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            G IKFE+ S  Y  RP   +    +N  I+P   + +VG +G GKS++   L R  +   
Sbjct: 1250 GAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAE 1307

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
            GRI+IDG     +  + LR HL ++ Q+  +  G++R N+     +E T +EI    +  
Sbjct: 1308 GRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI--DPTNEYTDEEIWHALELA 1365

Query: 572  FCHGFITKF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 630
                 I     +  E+++   G +LS GQ+Q + +ARAL+   +IL+LDEAT+A+DVE++
Sbjct: 1366 HLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETD 1425

Query: 631  GAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSEL 690
              I  T+    ++R  TI++IAHR++TI  S+ ++VL + G + E    + L  N +S  
Sbjct: 1426 QVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKNRESLF 1482

Query: 691  FKLLNDKKPTQ 701
            + L  +   T+
Sbjct: 1483 YSLCQEAGVTK 1493

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 150/321 (46%), Gaps = 41/321 (12%)

Query: 433 MTDHTSQIKPSSGKPYVPSWGEIKFE---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCV 488
           +T+   Q      KP V   GE+      D +F +  +P  ++    +NF  + G   C+
Sbjct: 587 LTNEELQRDSVQRKPKVTKTGEVAINVGADATFLWQRKPEYKVALKNINFQAKKGELTCI 646

Query: 489 VGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIR 548
           VG  G GKS +   +L             G         S+   +  V Q P +M+G+++
Sbjct: 647 VGKVGSGKSALIQGIL-------------GDLFRVKGFASVHGSIAYVSQVPWIMNGTVK 693

Query: 549 YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARA 608
            N+ +G   +   D   +  + C     ++  P+G ET++G +G SLSGGQK RI++ARA
Sbjct: 694 ENILFGHKYDA--DFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARA 751

Query: 609 LIKKPKILILDEATSALDVE-SEGAINYTLG---------RLMRSRELTIISIAHRLSTI 658
           +  +    +LD+  +A+D   ++  I + LG         +++ + +++++SIA  +S  
Sbjct: 752 VYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLATNKISVLSIADHIS-- 809

Query: 659 RRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE--TKENE 716
                   L  +G +++ G ++E+ ++  S L K++ +    Q + +   S E  T ++E
Sbjct: 810 --------LLENGEIIQQGSYEEVTSDKSSALSKIIANYGKKQTKGKGDESPESSTPDSE 861

Query: 717 VDDQVLEQVANDFNLDQKSSK 737
           V +  ++    D  L Q  S+
Sbjct: 862 VAEASIDLQKLDDKLVQDDSR 882

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 136/555 (24%), Positives = 252/555 (45%), Gaps = 65/555 (11%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            +L+I+ GI V  +     + +L    G     ++ ++++K  +H    FFD   +G +++
Sbjct: 1137 YLSIYFGIGVLHSSIFAIKDILCTYAGLAASRKMFNSLLKNSLHAKLRFFDSTPLGRIMN 1196

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSAS-LTSALFLFAPPLLVGALIY 297
            R S D   V + +   +   F                +   L  A+F+      VGA +Y
Sbjct: 1197 RFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLITPQFLGVAIFIAVFYWFVGA-VY 1255

Query: 298  GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGK----ELHRYNNAIRKVFSFG 353
                R + R    +   + +   E L+G+ T++A+  E +     L + +   +  F   
Sbjct: 1256 ISGSRELKRFDSITKSPIYQHFSETLAGITTVRAYGDESRFMRENLEKIDENNKPFFYMW 1315

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLV----LQGGLSVGDLTAFMLYTEYTGSA 409
                ++N      T I+G  +F+I+ A G  +     +  GL+   LT  + +++    A
Sbjct: 1316 ----VSNRWLSFRTQIIG--AFVILGAGGFSIWNINKIDSGLAGISLTYALTFSD----A 1365

Query: 410  VFGLSNFYSELMKGAGAASRLFEMTD------HTSQIKPSSGKPYVPSWGEIKFEDVSFS 463
               L  FY +      +  R+ E  +      +   ++P +  P     G+I+  DVS  
Sbjct: 1366 ALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWP---ENGKIEINDVSLR 1422

Query: 464  Y-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
            Y P  P  ++   ++FT++  S V +VG +G GKSTI + L R+ +P +G I ID  +I 
Sbjct: 1423 YAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIV 1480

Query: 523  KLSCKSLRRHLGVVQQEPMLMSGSIRYNL---TYGMNSEV-------------------- 559
             +  + LRR + ++ Q+P L +G+IR NL   T   + E+                    
Sbjct: 1481 SIDLQKLRRSISIIPQDPTLFTGTIRSNLDPYTQYSDKEIFDSLICVNLVSREELAQVQS 1540

Query: 560  -TMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILIL 618
             + ++  S+  + F H          E  +   G+++S GQ+Q + +AR+L+ KPKI++L
Sbjct: 1541 PSSNDTSSIVSENFNHFL------DLEYNVSEGGSNISQGQRQLLCLARSLLGKPKIILL 1594

Query: 619  DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            DEAT+++D ES+  I  T+     +   TI++IAHRL ++   + ++V+ + G V E   
Sbjct: 1595 DEATASIDYESDKKIQETIRNEFGNS--TILTIAHRLRSVIDYDKILVM-DAGEVEEYDH 1651

Query: 679  FKELYANDQSELFKL 693
               L  N  S  + +
Sbjct: 1652 PYSLLLNKNSIFYSM 1666

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 107/230 (46%), Gaps = 9/230 (3%)

Query: 453 GEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            ++ F++ + S+     +     L+   + G    V+GP+G GK+++   LL       G
Sbjct: 756 NKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEG 815

Query: 513 RIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
           +I I   D ++   +        +    Q   L++ ++R N+ +  NS    D   +   
Sbjct: 816 QINIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILF--NSPYNKDRYDAAIV 873

Query: 570 KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
                        G  T IG RG +LSGGQKQRI++ARAL    + ++LD+  SA+D  +
Sbjct: 874 AAGLKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHT 933

Query: 630 EGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
              I  N   G LM  R  T + ++H ++   ++ +++V+  +G V + G
Sbjct: 934 AAWIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 126/525 (24%), Positives = 232/525 (44%), Gaps = 20/525 (3%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVI-KKIIHQDAEFFDRNKVGDLI 237
            +LAI+  + +   +A   + ++L V      ++   N++   ++     FF+   +G ++
Sbjct: 991  YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRIL 1050

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R S+D Y V   + +  S  F                  + T        PL V  + Y
Sbjct: 1051 NRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFIIIPLSVFYIYY 1106

Query: 298  GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
             +     SREL+     +   +    +E L G+ T++ +  + +  H     I    S  
Sbjct: 1107 QQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAF 1166

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
                  N        ++G +  L         + QG L+ G +   + Y       +  +
Sbjct: 1167 YPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWI 1226

Query: 414  SNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRPG 469
                 E+     +  R+ E  D  S+    ++        PS G+IKF + S  Y  RP 
Sbjct: 1227 VRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RPE 1284

Query: 470  -NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             + +   +N  I+P   V +VG +G GKS++   L R  + + G I+ID   I+++    
Sbjct: 1285 LDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYD 1344

Query: 529  LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
            LR  L ++ Q+  +  G++R N+   +N        R++         ++   +G +  +
Sbjct: 1345 LRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQL 1403

Query: 589  GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTI 648
               G +LS GQ+Q + +ARA++   KIL+LDEAT+A+DVE++  +  T+    + R  TI
Sbjct: 1404 TEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TI 1461

Query: 649  ISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
            ++IAHRL+TI  S+ +IVL N G V E     +L ++++S  + L
Sbjct: 1462 LTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLLSDNKSLFYSL 1505

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 98/411 (23%), Positives = 191/411 (46%), Gaps = 42/411 (10%)

Query: 304 ISRELQESTGNL----TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGK 354
           I ++LQ+S        T+V  E L+ +K+++ +  E       E  R N  ++ +   G 
Sbjct: 468 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 527

Query: 355 KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS 414
             A+T+  F     ++   +F  V  Y     L   L    LT F L +         L+
Sbjct: 528 YMAVTSFQFNIVPFLVSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 586

Query: 415 NFYSELMKGAGAASRLFEMTDHTSQIKPSSGK--PYVPSWGEIKF---EDVSFSYPTRPG 469
           +F    ++ + +  RLF    +  +++P S +  P V + G++     +D +F +  +P 
Sbjct: 587 SF----IEASVSIGRLFTFFTN-EELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPE 641

Query: 470 NQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
            ++    +NF  + G+  C+VG  G GK+ + S +L       G   + G          
Sbjct: 642 YKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGS--------- 692

Query: 529 LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
               +  V Q P +M+G+++ N+ +G   +    E     K C     +    +G +T++
Sbjct: 693 ----VAYVSQVPWIMNGTVKENILFGHRYDAEFYE--KTIKACALTIDLAILMDGDKTLV 746

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSRE 645
           G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   +   I + LG   L+ ++ 
Sbjct: 747 GEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK- 805

Query: 646 LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            T +   +++S +  ++++ +L N G + + G + E+  +  S L+KLLN+
Sbjct: 806 -TKVLATNKVSALSIADSIALLDN-GEITQQGTYDEITKDADSPLWKLLNN 854

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 132/542 (24%), Positives = 241/542 (44%), Gaps = 37/542 (6%)

Query: 176  MFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSN-VIKKIIHQDAEFFDRNKVG 234
            ++ ++A++A I V  +     R +++ +      ++L  N +   ++     FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGA 294
             +++R SSD   +       +S  F++                +++   FL    +L+G 
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVII-----TVSMPWFLLFNTILLGI 1144

Query: 295  LIYGKKIRMI-SRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYN-----N 344
              Y + + ++ SREL+     S   +  +  E L G   I A+       + YN      
Sbjct: 1145 YYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY-KHANIFNYYNFENIQT 1203

Query: 345  AIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTE 404
             I  +F+F       +    +   ++  ++ L+ LA    L     +S G +   M Y  
Sbjct: 1204 NINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALA---SLGTSNPISAGLIGLLMSYAL 1260

Query: 405  YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDV 460
               S++  +      +     +  R+ E  D   +    I+ S      P  GEI FE  
Sbjct: 1261 QVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHY 1320

Query: 461  SFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQN 520
            +  Y     + +   ++  I+    + VVG +G GKST+   L R  +P  G+I IDG +
Sbjct: 1321 TTKY-RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGID 1379

Query: 521  ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAK-KCFCHGFIT 578
            IS L    LRR L ++ Q+     G++R NL  +  +++  + +   ++  K      ++
Sbjct: 1380 ISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVS 1439

Query: 579  KFPEG-------YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
            + P+         +T I   G +LS GQ+Q + ++RAL+   KILILDEAT+A+D E++ 
Sbjct: 1440 ELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDK 1499

Query: 632  AINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
             I  T+    + R  TI++IAHR+ T+  S+ ++VL + G V E      L  N +S  +
Sbjct: 1500 IIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKEFDTPDNLLKNKESLFY 1556

Query: 692  KL 693
             L
Sbjct: 1557 GL 1558

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 93/404 (23%), Positives = 187/404 (46%), Gaps = 51/404 (12%)

Query: 317 KVSEEQLSGVKTIQAFVAEGKELHRYNNAIR--KVFSFGKKEALTNATFFSS--TGILGD 372
           K   E L+ +K+I+ +  E   L R N+     ++ +  K   ++N  FF      +L  
Sbjct: 469 KTVTEILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVT 528

Query: 373 LSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL-- 430
            S  ++ +Y +  VL   +    LT F +  +    A+F +    S +++   +  RL  
Sbjct: 529 CSTFVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKG 584

Query: 431 FEMTDH--TSQIKPSSGKPYVPSWGEIKFEDVSFSYPT-----------------RPGNQ 471
           + + +   TS I+ +      P+   ++  +  F + +                  PG  
Sbjct: 585 YLLAEELDTSFIEHARATASDPT---VEISNAVFLWKSPKSAASSEDTDEEAEISSPGVA 641

Query: 472 IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI-MIDGQNISKLSCKSLR 530
           + +  NF+ +     C+VG  G GKST    +L       G++  +   + S +  K + 
Sbjct: 642 LKSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVI 694

Query: 531 R--HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVI 588
           R  +L    Q+P +M+ S++ N+ +G   +  M   +   K C     +   P+G +T++
Sbjct: 695 RADNLAYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIKACQLLPDLEILPDGDQTLV 752

Query: 589 GPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSR 644
           G +G SLSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+  L R   L++++
Sbjct: 753 GEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK 812

Query: 645 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
             T+I   + ++ +  S+ + +L N G +VE   ++E+ + D++
Sbjct: 813 --TVILTTNAVNVLVHSDMIYLLKN-GKIVESNSYEEVMSKDRN 853

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 138/551 (25%), Positives = 244/551 (44%), Gaps = 53/551 (9%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +GM+ F  +F   L         +  LL  LG +    L    +++I+H    + D  
Sbjct: 899  FYMGMYSFF-VFGAYLFMNL-----QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTT 952

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R + D   +   +T+++                       +    F  A P L
Sbjct: 953  PLGRILNRFTKDTDSLDNELTESIR-----LMLSQVGNLIGVIVMCIVYLPWFAIAVPFL 1007

Query: 292  VGALI-----YGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346
            +   +     Y    R I R        +     E L G+ TI+A+ ++ + L + +  I
Sbjct: 1008 LIIFVLICDHYQSTGREIKRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLI 1067

Query: 347  RKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYT 403
             K+   G          A    S  ++  L  + +L       +  G SVG L  ++L  
Sbjct: 1068 NKMNEAGYLIVAVQRWVAILLDSVAVVFAL-IITLLCVTRAFPISAG-SVGVLLTYVLQL 1125

Query: 404  EYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSW---GEIKFED 459
                + +   L+   +++       +   E+    +  KP    P   SW   G+I F D
Sbjct: 1126 PGLLNTILRALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPP--ESWPEKGDIDFID 1183

Query: 460  VSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
            V+F+Y  RPG   +   +N  I  G  + + G +G GKSTI S L R  + + G+I+IDG
Sbjct: 1184 VNFAY--RPGLPVVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDG 1241

Query: 519  QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT----------------YGMNSEVTMD 562
             +I K+    LR+ L ++ Q+P+L  G+IR NL                  G+     ++
Sbjct: 1242 VDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLN 1301

Query: 563  EIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
            +I+ + K    + +        + ++   G++ S G++Q +A+ RAL++  KILILDEAT
Sbjct: 1302 DIK-LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEAT 1360

Query: 623  SALDVESEGAINYTLGRLMRSR-ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            S++D E++G I     R++    + TI+ IAHRL TI   + ++VL   G + E  K  E
Sbjct: 1361 SSVDYETDGKIQ---SRIVSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWE 1416

Query: 682  LYANDQSELFK 692
            L+ ND++ +F+
Sbjct: 1417 LF-NDKNSIFR 1426

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 118/238 (49%), Gaps = 29/238 (12%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LN  I  G  + V GP G GK+++ + +  +    SGR+ ++G+    L C      
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE---LLLCGY---- 633

Query: 533 LGVVQQEPMLMSGSIRYNLTYGM-NSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
                  P +++ ++R N+ +G    E   +EI  V   C     +   P G  T IG R
Sbjct: 634 -------PWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIIS 650
           G +LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++  L  +++ +  T I 
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRIL 741

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRN 708
             H+LS I R++ +IV+G +GS  + G   EL   +Q+ L  LL      Q  SQ+++
Sbjct: 742 ATHQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQT-LVSLL------QYSSQTKD 791

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 139/504 (27%), Positives = 231/504 (45%), Gaps = 61/504 (12%)

Query: 227  FFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF 286
            FF+   +G +I+R SSD   V R++  N +  FK                        +F
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYN----MPWFLVF 1132

Query: 287  APPLLVGALIYGKKIRMISRELQESTGN----LTKVSEEQLSGVKTIQAFVAEGKELHRY 342
               LLV  + Y      +SREL+  +      +  +  E L G   I AF    +  H  
Sbjct: 1133 NAGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF-RHSERFHFL 1191

Query: 343  NNAIRKVFSFGKKEALTNATF-FSST------------GILGDLSFLIVLA-YGSHLVLQ 388
            N        F K +   +A F   ST            G +  ++ L+ LA  G+   + 
Sbjct: 1192 N--------FNKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMT 1243

Query: 389  GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSS 444
             GL VG L +++L  + T S ++ +    + +     +  R++E     S+    I+ S 
Sbjct: 1244 AGL-VGLLMSYVL--QVTNSLMW-IVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSR 1299

Query: 445  GKPYVPSWGEIKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL 503
             +   PS GEI F+D S  Y  RP  + +  K+N +I+P   + VVG +G GKS+++  L
Sbjct: 1300 PEKSWPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLAL 1357

Query: 504  LRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDE 563
             R  +   G I IDG +ISK+    LR HL ++ Q+     G++R NL     ++ ++ E
Sbjct: 1358 FRLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNL--DPFNQYSVQE 1415

Query: 564  IRSVAKKCFCHGFITKF----------PE----GYETVIGPRGASLSGGQKQRIAIARAL 609
            I    +       I K           PE      +  I   G ++S GQ+Q + ++RAL
Sbjct: 1416 IWKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRAL 1475

Query: 610  IKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGN 669
            + K K+L+LDEAT+A+D+E++  I  T+    + +  TI++IAHR+ T+  S+ ++VL +
Sbjct: 1476 LSKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-D 1532

Query: 670  DGSVVEMGKFKELYANDQSELFKL 693
             G V E      L  +++S  + L
Sbjct: 1533 KGEVKEFESPDTLLKDEKSLFYGL 1556

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 131/259 (50%), Gaps = 24/259 (9%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG-RIMIDGQNISKLSCKSLRRHLGV 535
           +F  + G+  CVVG  G GKST+   +L      SG +  I  + + +       R +  
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILVR------ARSVAY 714

Query: 536 VQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASL 595
             Q P +M+ SI+ N+ +G   + T   +    K C     +    EG ET++G +G SL
Sbjct: 715 CPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISL 772

Query: 596 SGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSRELTIISI 651
           SGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+  LG    L++ +  TII  
Sbjct: 773 SGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILT 830

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYAN-DQSELFKLLNDKKPTQLQSQSRNSV 710
            + +S ++ S N+I     G +VE G +++  +  D S L KL+      +  + + N  
Sbjct: 831 TNAVSVLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIK-----EFDTFAENPS 884

Query: 711 ETKENEVDDQVLEQVANDF 729
           + K++E +D     ++ DF
Sbjct: 885 DKKKDEENDS--HSISEDF 901

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  135 bits (340), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 126/485 (25%), Positives = 220/485 (45%), Gaps = 31/485 (6%)

Query: 227  FFDRNKVGDLISRLSSDAY----VVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSA 282
            FF+   +G +++R S+D Y    ++ R+ +Q   +  K                   T+ 
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAVICA---------TTW 1089

Query: 283  LFLFAP-PLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK 337
             F+F   PL V  + Y +     SREL+     +   +    +E L G+ TI+ +  E +
Sbjct: 1090 QFIFVIIPLGVFYIYYQQYYLRTSRELRRLDSITRSPVYSHFQETLGGITTIRGYNQEKR 1149

Query: 338  ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLT 397
              H     +    S        N        ++G +  L         + +G L+ G + 
Sbjct: 1150 FGHINQCRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVG 1209

Query: 398  AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWG 453
              + Y       +  +     E+     +  R+ E     S+    ++        P+ G
Sbjct: 1210 LSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWPTEG 1269

Query: 454  EIKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            +IKFE+ S  Y  RP  + +   +N  I P   V +VG +G GKS++   L R  +  +G
Sbjct: 1270 DIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAG 1327

Query: 513  RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCF 572
             I+IDG  I+++    LR  L ++ Q+  +  G++R N+     +  T +EI  V +   
Sbjct: 1328 NIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSH 1385

Query: 573  CHGFITKF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
                +     +G +  +   G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++ 
Sbjct: 1386 LKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDK 1445

Query: 632  AINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691
             +  T+    + R  TI++IAHRL+TI  S+ +IVL + G +VE     EL A  +S  +
Sbjct: 1446 IVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKPESLFY 1502

Query: 692  KLLND 696
             L N+
Sbjct: 1503 SLCNE 1507

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 97/424 (22%), Positives = 194/424 (45%), Gaps = 40/424 (9%)

Query: 290 LLVGALIYGKKIRMISRELQESTGNL----TKVSEEQLSGVKTIQAFVAEGKELHRYNNA 345
           +LV  +     +  I R+LQ+         T V  E L+ +K+++ +  E     + N+ 
Sbjct: 451 ILVFMIFLNSYLVRIQRKLQKQQMQFKDERTGVISEILNNIKSLKLYAWEVPYQTKLNHV 510

Query: 346 -----IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFM 400
                +  +   G   A+T+  F +    L   +   V  Y  +  L   L    LT F 
Sbjct: 511 RNDKELHNLTKLGCYMAVTSFQF-NIVPFLVSCATFAVFVYTENKPLTTDLVFPALTLFN 569

Query: 401 LYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIKPSSGKPYVPSWGEIKF-- 457
           L +      +  + N  +  ++ + + +RLF  +T+   Q       P V + G++    
Sbjct: 570 LLS----FPLMVVPNVITSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINL 625

Query: 458 -EDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            ++ +F +  +P  ++    +NF  + G   C+VG  G GKS +   +L       G   
Sbjct: 626 GDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSILGDLFRVKGFAT 685

Query: 516 IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHG 575
           + G             ++  V Q P +M+G+++ N+ +G   +    E     K C    
Sbjct: 686 VHG-------------NVAYVSQVPWIMNGTVKENILFGHKYDQEFYE--KTIKACALTI 730

Query: 576 FITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAIN 634
            +    +G +T++G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   S+  + 
Sbjct: 731 DLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVE 790

Query: 635 YTLGR--LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
           + LG   L+ S+  T +   +++S +  ++++ +L N G +V+ G ++E+ +++ S LFK
Sbjct: 791 HVLGPTGLLHSK--TKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFK 847

Query: 693 LLND 696
           L+ +
Sbjct: 848 LIKE 851

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  135 bits (340), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 152/567 (26%), Positives = 249/567 (43%), Gaps = 85/567 (14%)

Query: 175  GMFDFLAIFAGILVFGTIANFGRIV-LLRVLGEKLVARLRSN-VIKKIIHQDAEFFDRNK 232
            G F +LAI+  +L+  T A+   +  ++ V+     +R   N V+ KI+H    FFD   
Sbjct: 1073 GTFYYLAIY--VLIGLTTASLSALKNIISVMAGLYASRKIFNLVLWKILHAKMRFFDATP 1130

Query: 233  VGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA---PP 289
             G +++RLS D   V + +       F A                   S L L A   P 
Sbjct: 1131 TGRIMNRLSKDLEAVDQELIPYFEGSFAAV--------------VQCISTLVLIAYVTPQ 1176

Query: 290  LLVGALIYGKKIRMI-------SRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK- 337
             L+ A+  G    +I       SREL+     +   + +   E L G+ +I+A+  E + 
Sbjct: 1177 FLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRAYGDERRF 1236

Query: 338  ---ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL-----SFLIVLAYGSHLVLQG 389
                L R ++  R  F       + N        +LG L        I L  G    L  
Sbjct: 1237 MLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGALVTFFSGLFIYLNIGK---LDA 1289

Query: 390  GLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD-------HTSQIKP 442
            GL+   LT  + +TE  G+  F     YS +     +  RL E  +         +Q+ P
Sbjct: 1290 GLAGISLTYAIFFTE--GALWF--VRHYSNVEMTMNSFERLKEYMEIEQEPYNENAQLPP 1345

Query: 443  SSGKPYVPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIAS 501
             +     P  G I   D+S  Y P  P  ++   +NF++EP   V +VG +G GKSTI +
Sbjct: 1346 DNW----PQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTIIT 1399

Query: 502  LLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVT 560
             + R+ DP +G + ID  +I+ +    LR+ + ++ Q+P L +G+++  L  Y   S+  
Sbjct: 1400 AMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQ 1459

Query: 561  MDE--------------IRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIA 606
            + E                S          I KF +     +   GA+LS GQ+Q + +A
Sbjct: 1460 IYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLD-LNNEVTEGGANLSQGQRQLVCLA 1518

Query: 607  RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIV 666
            R+L++ PKI++LDEAT+++D  S+  I  T+      R+ TI++IAHRL +I   + V+V
Sbjct: 1519 RSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLV 1576

Query: 667  LGNDGSVVEMGKFKELYANDQSELFKL 693
            + + G V E      L  N  +  + +
Sbjct: 1577 M-DAGEVKEYDHPYSLLLNKNTIFYNM 1602

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 104/229 (45%), Gaps = 9/229 (3%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + FE+ + ++   P +     ++     G      GP+G GKS++   LL       G+I
Sbjct: 672 LAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKI 731

Query: 515 MI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
            +   D +    +    L   +    Q   L++ + R N+ +  NS         V + C
Sbjct: 732 YVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILF--NSPYNEQRYNDVLEAC 789

Query: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
                      G  T IG +G +LSGGQKQRI++ARAL    + L+LD+  SA+D  +  
Sbjct: 790 GLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTAL 849

Query: 632 AI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            I  N  +G LM  R  T + ++H ++   R+ + +V+  +G V   G+
Sbjct: 850 LIYENCIIGPLMEGR--TCVLVSHNVALTMRNADWVVILENGRVKAQGE 896

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 138/537 (25%), Positives = 240/537 (44%), Gaps = 38/537 (7%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +L I+  + V   ++   + V+L V     G K +  + +N +         FF+   +G
Sbjct: 996  YLLIYFALGVGSALSTLIQTVILWVFCTIHGSKYLHTVMTNAV---FRAPMSFFETTPIG 1052

Query: 235  DLISRLSSDAYVVS----RSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAP-P 289
             +++R S+D Y V     R+ +Q + +  K                   T+  F+F   P
Sbjct: 1053 RILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIVI---------CWTTWQFIFIIGP 1103

Query: 290  LLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNA 345
            L V  + Y +     SREL+     +   +    +E L G+ TI+ +  + +  H  +  
Sbjct: 1104 LGVLYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGMSTIRGYNQQRRFDHINHCR 1163

Query: 346  IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEY 405
            I    S        N         +G +  L       + + QG L+ G +   + Y   
Sbjct: 1164 IDNNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTAGMVGLSLSYALQ 1223

Query: 406  TGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVS 461
                +  +     E+     +  R+ E ++  S+    I+      + P  G+I+F+  S
Sbjct: 1224 ITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHWPDSGDIRFDHYS 1283

Query: 462  FSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQN 520
              Y  RP  + +   +N  I+P   + +VG +G GKS++   L R  + +SG I+IDG  
Sbjct: 1284 TRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGGIVIDGVR 1341

Query: 521  ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF 580
            I ++    LR +L ++ Q+  +  G+IR N+        T DEI  V +    +  +   
Sbjct: 1342 IDEIGLHDLRHNLSIIPQDSQVFQGTIRENV--DPTETYTDDEIWRVLELSHLNRHVESM 1399

Query: 581  -PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 639
             P G    +   G++LS GQ+Q + +ARAL+   KILILDEAT+A+DVE++  I  T+  
Sbjct: 1400 GPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDQVIQETIRS 1459

Query: 640  LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
              R R  TI++IAHR++TI  S+ ++VL + G V E      L  N+ S+   L  +
Sbjct: 1460 AFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTNLLRNEGSQFHSLCQE 1513

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 107/441 (24%), Positives = 193/441 (43%), Gaps = 44/441 (9%)

Query: 278 SLTSALFLFAPPLLVGALIY------GKKIRMISRELQESTGNL----TKVSEEQLSGVK 327
            L S   L  P + +G +I          +  I + LQ+S        T V  E L+ +K
Sbjct: 435 CLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEILNNIK 494

Query: 328 TIQAFVAE---GKELH--RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG 382
           +++ +  E    K+L   R +  ++ +   G   A+T+  F     ++   +F  V  Y 
Sbjct: 495 SLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTF-AVFVYT 553

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIK 441
               L   L    LT F L +      +F + N  +  ++ + + +RLF  +T+   Q  
Sbjct: 554 EDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNEELQKD 609

Query: 442 PSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKS 497
                P V + G++     +D +F +  +P  ++    +NF  + G   CVVG  G GKS
Sbjct: 610 SVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRVGSGKS 669

Query: 498 TIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNS 557
            +   L              G         ++   +  V Q   +M+G+++ N+ +G   
Sbjct: 670 ALIQSL-------------SGDLFRVKGFATVHGSVAYVSQVAWIMNGTVKENILFGHRY 716

Query: 558 EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
           +    +     K C     +    +G ET++G +G SLSGGQK R+++ARA+  +    +
Sbjct: 717 DPEFYD--KTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYARADTYL 774

Query: 618 LDEATSALDVESEGA--INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVE 675
           LD+  +A+D E  G   + + LG     R  T I   +++S +  ++ + +L N G +VE
Sbjct: 775 LDDPLAAVD-EHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADRIALLEN-GEIVE 832

Query: 676 MGKFKELYANDQSELFKLLND 696
            G + E+ A+  S L KL+ D
Sbjct: 833 QGSYDEVTADGDSALSKLIRD 853

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 137/529 (25%), Positives = 230/529 (43%), Gaps = 22/529 (4%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR-LRSNVIKKIIHQDAEFFDRNKVGDLI 237
            +L I+  + +   ++   + V+L V      +R L   +   ++     FF+   +G ++
Sbjct: 976  YLGIYFALGIGSALSTLVQTVVLWVFCTIHGSRYLHDAMASSVLRAPMSFFETTPIGRIL 1035

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY 297
            +R S+D Y V   + +  S  F                  + T    L   PL V  + Y
Sbjct: 1036 NRFSNDIYKVDELLGRTFSQFF----VNVVKVTFTIVVICTSTWQFILVVLPLSVLYIYY 1091

Query: 298  GKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
             +     SREL+     +   +    +E L GV TI+ +  + +  H     I    S  
Sbjct: 1092 QQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGYGQQKRFAHINQARIDNNMSAF 1151

Query: 354  KKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
                  N         LG +  L         + QG L+ G +   + Y      ++  +
Sbjct: 1152 YPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLSYALQITQSLNWI 1211

Query: 414  SNFYSELMKGAGAASRL---FEMTDHTSQIKPSSGKPY-VPSWGEIKFEDVSFSYPTRPG 469
                 E+     +  R+    E+      I  SS  P   PS G+I+FE  S  Y  RP 
Sbjct: 1212 VRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDIRFEHYSTRY--RPE 1269

Query: 470  NQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             Q I   +N  I+    V +VG +G GKS++   L R  +   G I IDG +   +    
Sbjct: 1270 LQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLAD 1329

Query: 529  LRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF-PEGYETV 587
            LR  L ++ Q+  + +G++R N+      E T +EI    +       +     +G +T+
Sbjct: 1330 LRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTM 1387

Query: 588  IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT 647
            +   G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T+    ++R  T
Sbjct: 1388 LTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQETIRTAFKNR--T 1445

Query: 648  IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            I++IAHR++TI  S+ +IVL N+G V E    + L     S  + L  +
Sbjct: 1446 ILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLCKE 1493

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 107/455 (23%), Positives = 203/455 (44%), Gaps = 71/455 (15%)

Query: 278 SLTSALFLFAPPLLVGALI-------------YGKKIRMISRELQESTGNLTKVSEEQLS 324
            L S   L  P + VG +I             Y K ++ I  + ++     T+V  E L+
Sbjct: 427 CLISLYSLLGPCMWVGVIIMVVMIPINSIIMKYQKNLQKIQMKNKDER---TRVISEILN 483

Query: 325 GVKTIQAFVAE---GKELHRYNNA--IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVL 379
            +K+++ +  E    K+L    N   ++ +   G   AL +  F     ++   +F + +
Sbjct: 484 NIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVFV 543

Query: 380 AYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS---NFYSELMKGAGAASRLFE-MTD 435
                  L   L    LT F L +       F L+   N  +  ++ + + +RL   +T+
Sbjct: 544 MTQKGRALTTDLVFPALTLFNLLS-------FPLAVVPNAITSFIEASVSVNRLHSFLTN 596

Query: 436 HTSQIKPSSGKPYVPSWGEIKFE---DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGP 491
              Q    S +P V S G+I  +   D +F +  +P  ++    +NF  + G   C+VG 
Sbjct: 597 EELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGR 656

Query: 492 SGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL 551
            G GKS +   +L       G   I G              +  V Q P +M+G+++ N+
Sbjct: 657 VGSGKSALIQSILGDLFRVKGFATIHGS-------------VAYVSQIPWIMNGTVKENI 703

Query: 552 TYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIK 611
            +G   + +  E     K C  +  ++  P+G +T++G +G SLSGGQK R+++ARA+  
Sbjct: 704 LFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYS 761

Query: 612 KPKILILDEATSALDVE-SEGAINYTLG---------RLMRSRELTIISIAHRLSTIRRS 661
           +    +LD+  +A+D   ++  ++  LG         +++ + ++T++SIA         
Sbjct: 762 RADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIA--------- 812

Query: 662 ENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            + I L  +G +V+ G + E+  +D S L KL+++
Sbjct: 813 -DSIALLENGEIVQQGSYDEVVRDDGSALSKLIHE 846

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  134 bits (336), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 133/486 (27%), Positives = 219/486 (45%), Gaps = 39/486 (8%)

Query: 227  FFDRNKVGDLISRLSSDAYVVS----RSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSA 282
            FF+   +G +++R S+D + V     R+  Q   +  K                   T  
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIKVSFTIIVICFS--------TWQ 1077

Query: 283  LFLFAPPLLVGALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKE 338
              L   P+    + Y +     SREL+     +   +    +E L G+ TI+ +  + + 
Sbjct: 1078 FILVILPMGTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGYNQQKRF 1137

Query: 339  LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVL---QGGLSVGD 395
            +H     +    S        N         +G +   I+LA  S  VL   QG L+ G 
Sbjct: 1138 VHINQARVDNNMSAYYPSVNANRWLAFRLEFIGSV---IILAASSLSVLRLKQGALTPGM 1194

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKP--SSGKPY--VPS 451
            +   + Y      ++  +     E+     +  R+ E  +  S+      S +P    PS
Sbjct: 1195 IGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPSEDWPS 1254

Query: 452  WGEIKFEDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
             G IKFE+ S  Y  RP  ++    +N  I+P   + +VG +G GKS++   L R  +  
Sbjct: 1255 QGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIEAA 1312

Query: 511  SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
            SGRI IDG  I  +  + LR HL ++ Q+  L  G+IR N+     +E T ++I    + 
Sbjct: 1313 SGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTNEYTDEQIWRALEL 1370

Query: 571  CFCHGFITKFPEGYETVIGPR---GASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
                  +     G E +  P    G++LS GQ+Q + +ARAL+   KIL+LDEAT+A+DV
Sbjct: 1371 SHLKDHVKGL--GKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDV 1428

Query: 628  ESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ 687
            E++  I  T+    ++R  TI++IAHR++TI  S+ ++VL + G V E      L  N +
Sbjct: 1429 ETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKNPE 1485

Query: 688  SELFKL 693
            S  + L
Sbjct: 1486 SLFYSL 1491

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/290 (22%), Positives = 135/290 (46%), Gaps = 49/290 (16%)

Query: 459 DVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
           D +F +  +P  ++    +NF  + G   CVVG  G GKS +   +L             
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL------------- 667

Query: 518 GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577
           G         S+   +  V Q P +M+G+++ N+ +G   + +   +    K C     +
Sbjct: 668 GDLFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDL 725

Query: 578 TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYT 636
              P+G +T++G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   ++  + + 
Sbjct: 726 AVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHV 785

Query: 637 LG---------RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ 687
           LG         +++ + ++T++SIA            I L  +G +++ G + ++ +   
Sbjct: 786 LGPNGLLASKTKVLATNKITVLSIADH----------IALLENGEIIQQGSYDDVTSAKS 835

Query: 688 SELFKLLND--KKPTQLQSQSRNSVETKE-----------NEVDDQVLEQ 724
           S L K+++   KKP + ++       T E            ++DD+++++
Sbjct: 836 SALSKIISTFGKKPEKSKTGENTVATTPELGAIAGSEIDLKKLDDKLIQE 885

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 133/500 (26%), Positives = 225/500 (45%), Gaps = 35/500 (7%)

Query: 212  LRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXX 271
            L  +++  ++     FF+   +G +++R S+D Y V   + +  S  F            
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 272  XXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVS-----EEQLSGV 326
                +   T     F  PL +  + Y +     SREL+    ++TK       +E L+GV
Sbjct: 1063 ICVTTWQFT----FFVIPLAMLYIYYQQYYLKTSRELRR-LDSVTKSPVYAHFQETLNGV 1117

Query: 327  KTIQAFVAEGKELH----RYNNAIRKVF-SFGKKEALTNATFFSSTGILGDLSFLIVLAY 381
             +I+ +    + +H    R NN     + S      L     F  + I+   + L V   
Sbjct: 1118 SSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATLSVFRL 1177

Query: 382  GSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIK 441
             S     G L+ G +   + Y      ++  +     E+     +  R+ E  +   +  
Sbjct: 1178 AS-----GSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPE-A 1231

Query: 442  PSSGKPYVPS--W---GEIKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRG 495
            P      VPS  W   GEIKFE+ S  Y  RPG + I   +N  I+P   V +VG +G G
Sbjct: 1232 PQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAG 1289

Query: 496  KSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGM 555
            KS++A  L R  +   G I IDG  I  +    LR+ L ++ Q+  +  G++R N+    
Sbjct: 1290 KSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--DP 1347

Query: 556  NSEVTMDEIRSVAKKCFCHGFITKF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPK 614
              + T ++I    +       +     +G +T +   G +LS GQ+Q + +ARAL+   +
Sbjct: 1348 TKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFR 1407

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            IL+LDEAT+A+DVE++  I  T+      R  TI++IAHR++TI  S+ ++VL + G+V 
Sbjct: 1408 ILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVA 1464

Query: 675  EMGKFKELYANDQSELFKLL 694
            E    + L    +  +F  L
Sbjct: 1465 EFDTPENLLKKKEESIFYTL 1484

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 119/590 (20%), Positives = 255/590 (43%), Gaps = 76/590 (12%)

Query: 136 VGMTIPKVIGIVLDAVKNASGGFSGPMTLEDLPPIIYG----LGMFDFLAIFAGILVFGT 191
           +  T P+++ +++  V   S    G ++ E+  P++ G    +GMF    +   +L    
Sbjct: 290 LAFTQPQLLRLLIKFVTEYSKA-RGDISAEEDVPLVRGFMLAVGMFLVSVVQTTVLQQYF 348

Query: 192 IANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSM 251
           +  F         G  L + + S + KK +H   E    +  GD+++ +S DA  + R +
Sbjct: 349 LQAFDT-------GTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDL 400

Query: 252 TQ--NV--SDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY---------- 297
           TQ  NV  S  F+                  L S   L  P + VG ++           
Sbjct: 401 TQWGNVIWSGPFQ--------------LCLCLYSLHRLLGPCIWVGVVLLLFTLPLNSYI 446

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFV-----AEGKELHRYNNAIRKVFSF 352
            + ++ + +E  ++    T++  E L+ +K+++ +       E  +  R    ++ +   
Sbjct: 447 SRVLKRLQKEQMKNKDERTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKM 506

Query: 353 GKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFG 412
           G   A  N  +     ++   +F + +       L   L    LT F L +         
Sbjct: 507 GLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIA 566

Query: 413 LSNFYSELMKGAGAASRLFE-MTDHTSQIKPSSGKPYVPSWGEIKF---EDVSFSYPTRP 468
           +++F    ++ + A  RL   +T    Q    + +P V + G +     ++ +F +  +P
Sbjct: 567 ITSF----IEASVAIGRLTNFLTAEELQRDAITREPAVKAPGGVAVALADNATFLWQRKP 622

Query: 469 GNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCK 527
             ++    +NF  +     C++G  G GKS +   +L           ++G  +      
Sbjct: 623 EYKVALKNINFRAKKSELTCIIGKVGSGKSALIQAML------GDLFRVNGSAV------ 670

Query: 528 SLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETV 587
            +R ++  V Q   +M+G++R N+ +G   +      +   K C     ++  P+G  T 
Sbjct: 671 -VRGNVAYVSQVAWIMNGTVRDNILFGHKYDAKF--YQQTIKACALTVDLSILPDGDNTF 727

Query: 588 IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSR 644
           +G +G SLSGGQK R+++ARA+  +    +LD+  +A+D   ++  +    G   L++S+
Sbjct: 728 VGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSK 787

Query: 645 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
              + +  ++++ +  ++++++L N G +V+ G F E+ +++ S + KL+
Sbjct: 788 ARVLTT--NKITALEIADHIVLLEN-GEIVQQGTFSEVISDEDSAISKLV 834

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 143/545 (26%), Positives = 238/545 (43%), Gaps = 52/545 (9%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F   F     F T + F    +L  +G      L    +K+++H    F D  
Sbjct: 927  FYMGLYTFFVFFN---YFATTSQFS---VLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTT 980

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDG-FKAXXXXXXXXXXXXXXSASLTSALFLFAPPL 290
             +G +++R + D   +   +T++V    F+A                   +  FL    L
Sbjct: 981  PIGRVLNRFTKDTDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAVPFL----L 1036

Query: 291  LVGALI---YGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR 347
            L+ A +   Y    R I R       ++     E LSG+ TI+A+  E + L + +  I 
Sbjct: 1037 LIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSDFLIN 1096

Query: 348  KVFSFGK-KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYT 406
            K+   G    A+      +   I    + +I L   +        SVG L  ++L     
Sbjct: 1097 KMNEAGYVVVAIQRWVSIALDMIAMAFALIITLLCVTRQFSISAASVGVLLTYVL----- 1151

Query: 407  GSAVFGLSNFYSELM----KGAGAASRLFEM-TD---HTSQIKPSSGKPY-VPSWGEIKF 457
               + GL N     M        +A RL    TD     +  +P +  P   PS G I F
Sbjct: 1152 --QLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESWPSEGAIDF 1209

Query: 458  EDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            + VS +Y  RPG   + + ++  +  G  + + G +G GKSTI S L R  + + G I I
Sbjct: 1210 DHVSLAY--RPGLPLVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITI 1267

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE-------------VTMD 562
            DG +I++L    LR  L ++ Q+P+L  G +R NL  +   S+              T D
Sbjct: 1268 DGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGAIATED 1327

Query: 563  EIRSVAKKCFCHGFITKFPEGY-ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEA 621
            E  + A      G +T   + + E  +   G++ S G++Q +A+ RAL++  +ILILDEA
Sbjct: 1328 EAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEA 1387

Query: 622  TSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            TS++D E++  I   +       E T++ IAHRL+TI   + ++VL + G V E      
Sbjct: 1388 TSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQGRVCEFDTPHA 1444

Query: 682  LYAND 686
            L+  +
Sbjct: 1445 LFVRN 1449

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 99/215 (46%), Gaps = 28/215 (13%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LN  I  G  V V G  G GKS++ + +  +    SG I  +G   S L C      
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---SLLLCGY---- 646

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR--SVAKKCFCHGFITKFPEGYETVIGP 590
                  P + + +++ N+ +G       DE R     + C     +   P G +T IG 
Sbjct: 647 -------PWIQNTTVKDNILFGS----PFDEARYKETIRVCSLQADLDLLPAGDKTEIGE 695

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLM-RSRELT 647
           RG +LSGGQK RI +AR++ KK  I + D+  SA+D      I     +G L  ++R L 
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGKTRVLA 755

Query: 648 IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
                H+LS I R+  VI +  DG+ V+ G   EL
Sbjct: 756 ----THQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 149/573 (26%), Positives = 244/573 (42%), Gaps = 67/573 (11%)

Query: 175  GMFDFLAIFAGI-LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKV 233
             ++ F+ ++A I ++     N   IV+L     +   +L  N+   +++    FF+   +
Sbjct: 1012 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1071

Query: 234  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
            G +I+R S D   V   +    S  F++                      F+F   L+V 
Sbjct: 1072 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVI 1127

Query: 294  ALIYGKKIRMISRELQESTG----NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR-K 348
               Y     + SREL+  T      +  +  E L+G   I A          YN+A R  
Sbjct: 1128 YFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKRFS 1177

Query: 349  VFSFGKKEALTNATF-FSSTGI-----LGDLSFLIVLAYG----SHLVLQGGLSVGDLTA 398
             F+F   +   +  F F ST       L  +  LIVLA G    S +     L+ G +  
Sbjct: 1178 YFNFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGL 1237

Query: 399  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ-------IKPSSGKPYVPS 451
             M Y+    +++  +     ++     +  R+ E  +   +        KP    P   +
Sbjct: 1238 LMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWP---A 1294

Query: 452  WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
             G IKF D S  Y  +  + + NK+N  IEP   + +VG +G GKST+   L R  +   
Sbjct: 1295 HGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATD 1353

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNS-EVTMDEIRSVAK 569
            G+I+IDG +IS L    LR +L ++ Q+     G+IR NL  +  +S E     I +   
Sbjct: 1354 GKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHL 1413

Query: 570  KCFCHGFITKFPEGYET---------------VIGPRGASLSGGQKQRIAIARALIKKPK 614
            K      I+   +  E+                I   G++LS GQ+Q + ++RAL+   K
Sbjct: 1414 KPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSK 1473

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            IL+LDEAT+++D+E++  I  T+      R  TI++IAHR+ T+   + ++VL + G V 
Sbjct: 1474 ILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVR 1530

Query: 675  EMGKFKELYANDQSELFKL------LNDKKPTQ 701
            E      L  N  S  + L      LN   PT 
Sbjct: 1531 EFDSPDTLLENKNSIFYNLCEKGGYLNKALPTN 1563

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 114/487 (23%), Positives = 223/487 (45%), Gaps = 69/487 (14%)

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR--KVFSFGKK 355
            KK++ +++E  +      +   E L+ +K+I+ +  E   L R ++     ++ SF K 
Sbjct: 450 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKI 509

Query: 356 EALTNATFFS--STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
             ++N  FF+     I+   S  I+ A  S + L   +    L  F +  +    A++ +
Sbjct: 510 GIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSV 565

Query: 414 SNFYSELMKGAGAASRL--FEMTDHTSQ--IKPSSGKPYVPSWGEIKFEDVSFSY----- 464
            +  + +++ + +  RL  F  T+   +  I+ S  K    S   ++ ++ +F +     
Sbjct: 566 PSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCA-VEIDNATFLWKGKKN 624

Query: 465 ----------PTRPGNQI-FNKLN-FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
                      T    Q+ F  +N F ++ GS  C+VG  G GK+T+   +L      SG
Sbjct: 625 LVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISG 684

Query: 513 -------RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR 565
                  +++I G +I+               Q+  +M+ S++ N+ +G   +     + 
Sbjct: 685 AQESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENILFGHKYDEHYYNL- 731

Query: 566 SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSAL 625
              + C     +   P+G ET++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+
Sbjct: 732 -TIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAV 790

Query: 626 DVE-SEGAINYTLGR---LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
           D E S+  I   L     L++S+  TII   + +S ++ S+ +  L N   ++E G + +
Sbjct: 791 DAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDD 847

Query: 682 LY-ANDQSELFKLLN------DKKPTQLQSQSRNSVETKENEV--DDQVLEQVANDFNLD 732
           +  +++ S+L  L+N      D    +  S+ R + E   + V  DD ++E   +D NL 
Sbjct: 848 VMNSSEDSKLKALINEFDNDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEN--DDDNLA 905

Query: 733 QKSSKLT 739
           + +   T
Sbjct: 906 ESTVAYT 912

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 138/536 (25%), Positives = 238/536 (44%), Gaps = 48/536 (8%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
            N   I++L     +   +L  N+ K +I     FF+   VG +I+R SSD   V  S+  
Sbjct: 1036 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 254  NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQE--- 310
              S  FK+                       +F   LLV  + Y     ++SREL+    
Sbjct: 1096 VFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLIS 1151

Query: 311  -STGNLTKVSEEQLSGVKTIQAFVAEGKELH----RYNNAIRKVFSFGKKEALTNATFFS 365
             S   +  +  E L+G   I A+    + ++    +  + I  VF+F    ++       
Sbjct: 1152 ISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLVFNF---RSINRWLSVR 1208

Query: 366  STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
               I   +     L   + +  +  LS G +   M Y+    S++  +      +     
Sbjct: 1209 LQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIV 1268

Query: 426  AASRLFEMTD---HTSQIKPSSGKP--YVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI 480
            +  R+ E  +       I P   +P    PS G I+F++ S  Y     + +   +N +I
Sbjct: 1269 SVERIVEYCELPPEAQSINPEK-RPDENWPSEGRIEFKNYSTKY-RENLDPVLKDINVSI 1326

Query: 481  EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540
            +P   + +VG +G GKST++  L R  +P+ G I+ID  NIS+L    LR +L ++ Q+ 
Sbjct: 1327 QPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDA 1386

Query: 541  MLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHGFITKF------------------P 581
                G++R NL  +   SE   DE++   +       + K                    
Sbjct: 1387 QAFEGTVRTNLDPFNRYSE---DELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAK 1443

Query: 582  EGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
            +  +  I   G++LS GQ+Q + +ARAL+   KIL+LDEAT+++D+E++  I  T+ R  
Sbjct: 1444 DILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREF 1503

Query: 642  RSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
            + R  TI++IAHR+ T+  S+ +IVL + G+V E     +L + D+  +F  L +K
Sbjct: 1504 KDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLS-DKGSIFYSLCEK 1555

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 132/266 (49%), Gaps = 31/266 (11%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR--HLG 534
           +F  + G  +CVVG  G GKST    +L       G++     +   L+ K + R   L 
Sbjct: 659 HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 711

Query: 535 VVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGAS 594
              QE  +M+ S+R N+ +G   +    ++    K C     +   P+G ET++G +G S
Sbjct: 712 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 769

Query: 595 LSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSRELTIISIA 652
           LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I + L G+    +  TII   
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 829

Query: 653 HRLSTIRRSENVIVLGNDGSVVEMGKFKELY--ANDQSELFKLL----------NDKKPT 700
           + +S ++ S+ +  L N G +VE G ++ +    ND S+L KLL          N+    
Sbjct: 830 NTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRR 888

Query: 701 QLQSQSRNSVET-----KENEVDDQV 721
             QS  R+  ET      E+E +D+V
Sbjct: 889 TDQSPERDEEETLQLKVVESEAEDEV 914

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 241/539 (44%), Gaps = 48/539 (8%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +LAI+  + V    +   + V+L +     G   +  L +N +         FF+   +G
Sbjct: 1013 YLAIYFALGVGSAFSTLIQTVILWIFCTIHGSTYLHNLMTNAV---FRAPMSFFETTPIG 1069

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFA-PPLLVG 293
             +++R S+D Y V   + +  S  F                  + T+  F+F   PL + 
Sbjct: 1070 RILNRFSNDIYKVDSILGRTFSQFF-----VNTVKVLFTIGVIAYTTWQFVFVIVPLGIF 1124

Query: 294  ALIYGKKIRMISRELQ--ESTGNLTKVS--EEQLSGVKTIQAFVAEGKELH----RYNNA 345
             + Y +     SREL+  ES       S  +E L G+ TI+ +  + +  H    R +N 
Sbjct: 1125 YIYYQQYYLRTSRELRRLESVTRSPIFSHFQETLGGLATIRGYGQQKRFEHINECRVDNN 1184

Query: 346  IRKVF-SFGKKEALT-NATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFML-- 401
            +   + S      L     F  S  ILG  +  I             L  G +TA M+  
Sbjct: 1185 MSAFYPSINANRWLAYRLEFIGSVIILGAATLSIF-----------KLRAGTMTAGMIGL 1233

Query: 402  ---YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ--IKPSSGKP--YVPSWGE 454
               Y       +  +     E+     +  R+ E ++  S+  +   S +P    P  GE
Sbjct: 1234 SLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESNRPPKEWPVAGE 1293

Query: 455  IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
            IKFE     Y     + +   +N  I+P   + +VG +G GKS++   L R  +  SG I
Sbjct: 1294 IKFEHYYTRY-REDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGGI 1352

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
            +IDG +I+++    LR HL ++ Q+  +  G+IR N+    N     D  R++       
Sbjct: 1353 LIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENID-PTNQFTDADIWRALELSHLKE 1411

Query: 575  GFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 634
              +    +G  T++   G++LS GQ+Q + +ARAL+   K+L+LDEAT+A+DVE++  I 
Sbjct: 1412 HIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQ 1471

Query: 635  YTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
             T+    + R  TI++IAHR++TI  ++ +IVL + G VVE    + L  N  S  + L
Sbjct: 1472 ETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEFDTPEALLKNTNSIFYSL 1527

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 106/442 (23%), Positives = 190/442 (42%), Gaps = 46/442 (10%)

Query: 278 SLTSALFLFAPPLLVGALIYGKKIRM------ISRELQESTGNL----TKVSEEQLSGVK 327
            L S   L    + VG LI    I +      I + LQ+S        T+V  E L+ +K
Sbjct: 455 CLISLYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEILNNMK 514

Query: 328 TIQAFVAEGK-----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG 382
           +++ +  E       E  R    ++ +   G   A T+  F +    L   S   V  Y 
Sbjct: 515 SLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQF-NIVPFLVSCSTFAVFVYT 573

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFE-MTDHTSQIK 441
               L   L    LT F L +      +  + N  + +++ + + SRLF  +T+   Q  
Sbjct: 574 EDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFLTNEELQKD 629

Query: 442 PSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKS 497
                P V   G++     ++ +F +  +P  ++    +N+  + G   C+VG  G GKS
Sbjct: 630 AVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVGKVGSGKS 689

Query: 498 TIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNS 557
                LL       G   I G              +  V Q   +M+G++R N+ +G   
Sbjct: 690 AFLQSLLGDLFRVKGFATIHGS-------------VAYVSQVAWIMNGTVRDNVLFGHKY 736

Query: 558 EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
           +    E     K C     +    +G +T++G +G SLSGGQK R+++ARA+  +    +
Sbjct: 737 DPEFYE--KTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYL 794

Query: 618 LDEATSALDVE-SEGAINYTLGR--LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
           LD+  +A+D   S   + + LG   L+ S+  T I   +++S +  ++++ +L N G + 
Sbjct: 795 LDDPLAAVDEHVSRHLVEHVLGPNGLLHSK--TRILATNKISVLSAADSITLLEN-GEIT 851

Query: 675 EMGKFKELYANDQSELFKLLND 696
           + G + +   +++S L KLL +
Sbjct: 852 QQGTYADCRKDEESALGKLLKE 873

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 142/538 (26%), Positives = 247/538 (45%), Gaps = 54/538 (10%)

Query: 189  FGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVS 248
            F T+ + G      VL  K    L  N + +++H    + D   +G +++R + D   + 
Sbjct: 933  FTTLCSIG------VLASKW---LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLD 983

Query: 249  RSMTQNVSDG-FKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISR- 306
              +T++V    F+                    +  FLF   +L+ A  Y    R I R 
Sbjct: 984  NELTESVRLMLFQVGNIVAVIVMCIVYLPWFAIAVPFLFFMFVLI-ADHYQSTSREIKRL 1042

Query: 307  -ELQES--TGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN--- 360
              +Q S    NL +V    L G+ TI+++  + +   + +  I K+   G          
Sbjct: 1043 DAIQRSFVYNNLNEV----LGGMDTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWV 1098

Query: 361  ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTE-YTGSAVFGLSNFYSE 419
            + F     I+   + +I L   + +      SVG L  ++L       S +  L+   ++
Sbjct: 1099 SIFLDMVAII--FALIIALLSVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTEND 1156

Query: 420  LMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGEIKFEDVSFSYPTRPGNQIFNK-LN 477
            +       +   ++    +  KP    P   PS GEI+F DV F+Y  R G  +  K LN
Sbjct: 1157 MNSAERLVNYATKLPLEAAYKKPELSPPESWPSKGEIRFLDVDFAY--RSGLPVVLKGLN 1214

Query: 478  FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQ 537
              I+ G  + + G +G GKSTI S L R  +  SG+I+ID  +IS L    LRR L ++ 
Sbjct: 1215 LDIKSGEKIGICGRTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIP 1274

Query: 538  QEPMLMSGSIRYNLTYGMNSE-------------VTMDEIRSVAKKCF----CHGFITKF 580
            Q+P+L  G+IR NL    N +             +  + +  V  +       H  + KF
Sbjct: 1275 QDPVLFKGTIRKNLDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF 1334

Query: 581  PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640
                + ++   G++ S G++Q +A+ RAL+++ KILILDEATS++D E++G I     R+
Sbjct: 1335 --HLDQLVEEEGSNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQ---KRI 1389

Query: 641  MRSRE-LTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
            +   +  TI+ IAHRL TI + + ++VL   G + E  +  +L++ D+  +F+ + ++
Sbjct: 1390 VEEFDNCTILCIAHRLKTILQYDRILVL-EKGVIAEFDQPFKLFS-DKDSIFRSMCER 1445

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/253 (29%), Positives = 130/253 (51%), Gaps = 22/253 (8%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ L+F I  G  + + GP G GKS++ +    + +   GRI ++G     L C      
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG---DLLFCGY---- 640

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + +++ N+ +G  S    ++  +V + C     +   P G +T IG RG
Sbjct: 641 -------PWIQNATVKDNILFG--SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++  L  L+  +  T I  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE 711
            H+LS I +++ VIVLG DGS  ++G   EL   +Q+ L  LL D   T+ ++++R+   
Sbjct: 750 THQLSLIEKADRVIVLGTDGS-FDIGTVDELKQRNQT-LTNLL-DYSTTERENENRDESP 806

Query: 712 TKENEVDDQVLEQ 724
             + E D+ ++++
Sbjct: 807 VADEENDELLIQE 819

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 149/573 (26%), Positives = 244/573 (42%), Gaps = 67/573 (11%)

Query: 175  GMFDFLAIFAGI-LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKV 233
             ++ F+ ++A I ++     N   IV+L     +   +L  N+   +++    FF+   +
Sbjct: 1040 NLWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPI 1099

Query: 234  GDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVG 293
            G +I+R S D   V   +    S  F++                      F+F   L+V 
Sbjct: 1100 GRIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYN----MPWFFVFNIFLIVI 1155

Query: 294  ALIYGKKIRMISRELQESTG----NLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR-K 348
               Y     + SREL+  T      +  +  E L+G   I A          YN+A R  
Sbjct: 1156 YFYYQAYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINA----------YNHAKRFS 1205

Query: 349  VFSFGKKEALTNATF-FSSTGI-----LGDLSFLIVLAYG----SHLVLQGGLSVGDLTA 398
             F+F   +   +  F F ST       L  +  LIVLA G    S +     L+ G +  
Sbjct: 1206 YFNFESVQFNIDCLFNFRSTNRWLSVRLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGL 1265

Query: 399  FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ-------IKPSSGKPYVPS 451
             M Y+    +++  +     ++     +  R+ E  +   +        KP    P   +
Sbjct: 1266 LMSYSLQVTNSLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWP---A 1322

Query: 452  WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
             G IKF D S  Y  +  + + NK+N  IEP   + +VG +G GKST+   L R  +   
Sbjct: 1323 HGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATD 1381

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNS-EVTMDEIRSVAK 569
            G+I+IDG +IS L    LR +L ++ Q+     G+IR NL  +  +S E     I +   
Sbjct: 1382 GKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHL 1441

Query: 570  KCFCHGFITKFPEGYET---------------VIGPRGASLSGGQKQRIAIARALIKKPK 614
            K      I+   +  E+                I   G++LS GQ+Q + ++RAL+   K
Sbjct: 1442 KPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSK 1501

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            IL+LDEAT+++D+E++  I  T+      R  TI++IAHR+ T+   + ++VL + G V 
Sbjct: 1502 ILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVR 1558

Query: 675  EMGKFKELYANDQSELFKL------LNDKKPTQ 701
            E      L  N  S  + L      LN   PT 
Sbjct: 1559 EFDSPDTLLENKNSIFYNLCEKGGYLNKALPTN 1591

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 114/487 (23%), Positives = 223/487 (45%), Gaps = 69/487 (14%)

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIR--KVFSFGKK 355
            KK++ +++E  +      +   E L+ +K+I+ +  E   L R ++     ++ SF K 
Sbjct: 478 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKI 537

Query: 356 EALTNATFFS--STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGL 413
             ++N  FF+     I+   S  I+ A  S + L   +    L  F +  +    A++ +
Sbjct: 538 GIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSV 593

Query: 414 SNFYSELMKGAGAASRL--FEMTDHTSQ--IKPSSGKPYVPSWGEIKFEDVSFSY----- 464
            +  + +++ + +  RL  F  T+   +  I+ S  K    S   ++ ++ +F +     
Sbjct: 594 PSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCA-VEIDNATFLWKGKKN 652

Query: 465 ----------PTRPGNQI-FNKLN-FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
                      T    Q+ F  +N F ++ GS  C+VG  G GK+T+   +L      SG
Sbjct: 653 LVSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISG 712

Query: 513 -------RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIR 565
                  +++I G +I+               Q+  +M+ S++ N+ +G   +     + 
Sbjct: 713 AQESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENILFGHKYDEHYYNL- 759

Query: 566 SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSAL 625
              + C     +   P+G ET++G +G SLSGGQK R+++ARA+  +  I +LD+  SA+
Sbjct: 760 -TIEACQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAV 818

Query: 626 DVE-SEGAINYTLGR---LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
           D E S+  I   L     L++S+  TII   + +S ++ S+ +  L N   ++E G + +
Sbjct: 819 DAEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDD 875

Query: 682 LY-ANDQSELFKLLN------DKKPTQLQSQSRNSVETKENEV--DDQVLEQVANDFNLD 732
           +  +++ S+L  L+N      D    +  S+ R + E   + V  DD ++E   +D NL 
Sbjct: 876 VMNSSEDSKLKALINEFDNDRDNNSKEEVSEERKTSEETSDVVPIDDNLIEN--DDDNLA 933

Query: 733 QKSSKLT 739
           + +   T
Sbjct: 934 ESTVAYT 940

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  132 bits (331), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 138/536 (25%), Positives = 238/536 (44%), Gaps = 48/536 (8%)

Query: 194 NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
           N   I++L     +   +L  N+ K +I     FF+   VG +I+R SSD   V  S+  
Sbjct: 465 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 524

Query: 254 NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQE--- 310
             S  FK+                       +F   LLV  + Y     ++SREL+    
Sbjct: 525 VFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLIS 580

Query: 311 -STGNLTKVSEEQLSGVKTIQAFVAEGKELH----RYNNAIRKVFSFGKKEALTNATFFS 365
            S   +  +  E L+G   I A+    + ++    +  + I  VF+F    ++       
Sbjct: 581 ISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLVFNF---RSINRWLSVR 637

Query: 366 STGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAG 425
              I   +     L   + +  +  LS G +   M Y+    S++  +      +     
Sbjct: 638 LQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIV 697

Query: 426 AASRLFEMTD---HTSQIKPSSGKP--YVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTI 480
           +  R+ E  +       I P   +P    PS G I+F++ S  Y     + +   +N +I
Sbjct: 698 SVERIVEYCELPPEAQSINPEK-RPDENWPSEGRIEFKNYSTKYRENL-DPVLKDINVSI 755

Query: 481 EPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEP 540
           +P   + +VG +G GKST++  L R  +P+ G I+ID  NIS+L    LR +L ++ Q+ 
Sbjct: 756 QPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDA 815

Query: 541 MLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHGFITKF------------------P 581
               G++R NL  +   SE   DE++   +       + K                    
Sbjct: 816 QAFEGTVRTNLDPFNRYSE---DELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAK 872

Query: 582 EGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
           +  +  I   G++LS GQ+Q + +ARAL+   KIL+LDEAT+++D+E++  I  T+ R  
Sbjct: 873 DILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREF 932

Query: 642 RSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
           + R  TI++IAHR+ T+  S+ +IVL + G+V E     +L + D+  +F  L +K
Sbjct: 933 KDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLS-DKGSIFYSLCEK 984

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 132/266 (49%), Gaps = 31/266 (11%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR--HLG 534
           +F  + G  +CVVG  G GKST    +L       G++     +   L+ K + R   L 
Sbjct: 88  HFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLA 140

Query: 535 VVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGAS 594
              QE  +M+ S+R N+ +G   +    ++    K C     +   P+G ET++G +G S
Sbjct: 141 YCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGIS 198

Query: 595 LSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSRELTIISIA 652
           LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I + L G+    +  TII   
Sbjct: 199 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTT 258

Query: 653 HRLSTIRRSENVIVLGNDGSVVEMGKFKELY--ANDQSELFKLL----------NDKKPT 700
           + +S ++ S+ +  L N G +VE G ++ +    ND S+L KLL          N+    
Sbjct: 259 NTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRR 317

Query: 701 QLQSQSRNSVET-----KENEVDDQV 721
             QS  R+  ET      E+E +D+V
Sbjct: 318 TDQSPERDEEETLQLKVVESEAEDEV 343

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 145/541 (26%), Positives = 239/541 (44%), Gaps = 56/541 (10%)

Query: 186  ILVFGTIA-NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDA 244
            + V G++A  F + + + +LG      L    +++++H    F D   +G +++R + D 
Sbjct: 917  LFVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKDT 976

Query: 245  YVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIY------- 297
              +   +T++V                       +    F  A P LV   ++       
Sbjct: 977  DTLDNEITESVR-----LLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQA 1031

Query: 298  -GKKI-RMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKK 355
             G++I RM + +      N  +V    L G+ TI+A+ +E + L + +  I K+   G  
Sbjct: 1032 SGREIKRMDAVQRSFVYNNFNEV----LGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYL 1087

Query: 356  EALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSN 415
                      S  +L  +  LI+      +  Q  +S G +   + Y       +  L  
Sbjct: 1088 VTSIQRWVAISLDMLAVIFALIIALLC--VTRQFHVSAGSVGVMVTYVLQLPGLLNALLR 1145

Query: 416  FYSELMKGAGAASRLFEMT-----DHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGN 470
              ++      +A RL         +   +I  +      PS G IKFE+VS +Y  RP  
Sbjct: 1146 SQTQTENDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPEL 1203

Query: 471  QIFNKLNFTIEPGSN--VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKS 528
             +  K N +I+ GSN  + + G +G GKSTI S L R  +  +G+I ID  +IS L    
Sbjct: 1204 PVALK-NVSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYE 1262

Query: 529  LRRHLGVVQQEPMLMSGSIRYNLTY----------------GMNSEVTMDEIRSVAKKCF 572
            LR  L ++ Q+P+L  G IR NL                  G      +D IR+  K   
Sbjct: 1263 LRSKLAIIPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDAN 1322

Query: 573  -CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631
               G + KF    + ++   G++ S G++Q +A+ RAL++  KILILDEATS++D  ++ 
Sbjct: 1323 GLSGDMFKF--HLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDA 1380

Query: 632  AINYTLGRLMRS-RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSEL 690
             I     R++      TI+ IAHRL TI     ++VL + G VVE    K+LY ND+  +
Sbjct: 1381 KIQ---SRIVEEFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKLY-NDRDSI 1435

Query: 691  F 691
            F
Sbjct: 1436 F 1436

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 112/235 (47%), Gaps = 24/235 (10%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ LNF ++    + + GP G GKS++ + L  +   +SG + I G     L C      
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKGD---LLLCGY---- 644

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + +++ N+ +G  S     + + V + C     +   P G  T IG RG
Sbjct: 645 -------PWVQNATVKDNILFG--SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RIA+AR++ K   I + D+  SA+D      I     +G L   ++ T I 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYL---KQKTRIL 752

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ--SELFKLLNDKKPTQLQ 703
             H+LS I ++  VI LG DGS  ++G   EL   +   S+L +  N     +L+
Sbjct: 753 ATHQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQNSAPAEELE 806

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 144/559 (25%), Positives = 232/559 (41%), Gaps = 71/559 (12%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F     G  +F T     +  +L  +G      L    +K+IIH    F D  
Sbjct: 934  FYMGLYSFFVF--GAYIFMT----SQFTILCYIGIGASKNLNIQALKRIIHTPMSFMDTT 987

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R + D   +   + +NV                       +    F  A P L
Sbjct: 988  PIGRILNRFTKDTDSLDNELIENVR-----LTVSQFANIVGVCVMCIVYLPWFAIAVPFL 1042

Query: 292  VGALIYG-----------KKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELH 340
            V   ++            K++  I R    +  N      E L G+ TI+ + +E + + 
Sbjct: 1043 VFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFN------EILGGMDTIKFYKSEERYIA 1096

Query: 341  RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVL-----QGGLSVGD 395
            + +  I K+   G               IL D+   I +A+   + L     Q  +S   
Sbjct: 1097 KSDYLIDKMNEAGYLTVCVQ----RWVAILVDM---IAVAFALIITLLCVTRQFHISASS 1149

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEM-TD---HTSQIKPSSGKPYVPS 451
            +   + Y          L    S++     +  RL    TD        KP +  P   S
Sbjct: 1150 VGVLLTYVLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPP--ES 1207

Query: 452  W---GEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYY 507
            W   G IKFE+V F+Y  RPG  I  K +N  I     + + G +G GKSTI + L R  
Sbjct: 1208 WPEEGTIKFENVDFAY--RPGLPIVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLN 1265

Query: 508  DPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT--YGMNSEVTMDEIR 565
            +  SG I+ID  +I+KL    LR+ L ++ Q+P+L  G IR NL   +    E   D + 
Sbjct: 1266 ELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLV 1325

Query: 566  ---SVAKKCFCHGFITKFPEG----------YETVIGPRGASLSGGQKQRIAIARALIKK 612
               ++A +           E            + V+   GA+ S G++Q +A+ RAL++ 
Sbjct: 1326 RGGAIAPEDLAETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALVRN 1385

Query: 613  PKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
             KILILDEATS++D E++  I   +         TI+ IAHRL TI   + ++VL + G 
Sbjct: 1386 TKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH-GE 1442

Query: 673  VVEMGKFKELYANDQSELF 691
            V E      L+  D++ +F
Sbjct: 1443 VAEFDTPMNLF-KDETTIF 1460

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 117/223 (52%), Gaps = 22/223 (9%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  V + GP G GK+++ +    + +  SG I I+G              
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQINGD------------- 658

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
             ++   P + + ++R N+ +G  S    D+ + V + C     +   P G +T IG RG
Sbjct: 659 -LLMGGYPWIQNATVRDNIIFG--SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIISI 651
            +LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++  L +L+ ++  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLL 694
            H+LS I ++  +IVLGNDGS VE+G  +  Y  + ++  K+L
Sbjct: 774 THQLSLIDKASRIIVLGNDGS-VEIGDVQ--YMKETNKTLKVL 813

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 136/540 (25%), Positives = 246/540 (45%), Gaps = 44/540 (8%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR-LRSNVIKKIIHQDAEFFDRNKVGDLI 237
            +L I+  + +   ++   + ++L V      +R L S +   ++     FF+   +G ++
Sbjct: 993  YLGIYLALGLSSALSTLIQTIILWVFCTIRGSRYLHSIMAASVLRAPMVFFETTPIGRIL 1052

Query: 238  SRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF-APPLLVGALI 296
            +R S+D Y V   + +  +  F                   +T+  F+F   P++V  + 
Sbjct: 1053 NRFSNDIYKVDELLGRTFAQFF-----VNVTKVSFTIIVICVTTWQFIFLILPMIVLYVY 1107

Query: 297  YGKKIRMISRELQESTGNLTKVS-----EEQLSGVKTIQAFVAEGKELHRYNNAIRKVFS 351
            Y +     SREL+    ++TK       +E L G+ TI+ +  + +  H   + I    S
Sbjct: 1108 YQQYYLRTSRELRR-LDSVTKSPVYAHFQESLGGLSTIRGYDQQDRFTHINQSRIDNNMS 1166

Query: 352  FGKKEALTNATFFSSTGILGDLSFLI-----VLAYGSHLVLQGGLSVGDLTAFML----- 401
                       F+ S      L+F +     ++ +G+  +    L  G LT  M+     
Sbjct: 1167 ----------AFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLS 1216

Query: 402  YTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKF 457
            Y      ++  +     E+     +  R+ E ++  S+    I+        PS G+IKF
Sbjct: 1217 YALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRPPADWPSKGDIKF 1276

Query: 458  EDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMID 517
            E  S  Y     N +   +N  ++P   + +VG +G GKS++   L R  +   GRI+ID
Sbjct: 1277 EHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVID 1335

Query: 518  GQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFI 577
            G  I+++    LR  L ++ Q+  +  G++R N+     ++ + +EI  V +       +
Sbjct: 1336 GVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLELSHLKNHV 1393

Query: 578  TKF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 636
                 +G  T +   GA+LS GQ+Q + +ARAL+   +ILILDEAT+A+DVE++  I  T
Sbjct: 1394 LSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQET 1453

Query: 637  LGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
            +    + R  TI++IAHRL+TI  S+ ++VL + G V E    + L     S  + L +D
Sbjct: 1454 IRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQGSIFYSLCSD 1510

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/366 (23%), Positives = 155/366 (42%), Gaps = 69/366 (18%)

Query: 349 VFSFGKKEALTNATFFSSTGILGDLSF-LIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTG 407
           VF + +K+ LT    F +  +   LSF L V+       ++  +SV  L +F+   E   
Sbjct: 555 VFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAFIEASVSVNRLYSFLTNEELQK 614

Query: 408 SAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTR 467
            AV         L K   A     +++D                       D +F +  +
Sbjct: 615 DAV-------HHLPKAQKAGDVAIKISD-----------------------DANFLWKRK 644

Query: 468 PGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSC 526
           P  Q+    +N  ++ G   CVVG  G GKS +   LL       G   + G        
Sbjct: 645 PQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGDLYRVKGYAAVHGST------ 698

Query: 527 KSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYET 586
                    V Q P +M+G+++ N+ +G   +    ++    K C     +   P+G +T
Sbjct: 699 -------AYVSQVPWIMNGTVKDNILFGHKYDPVFYDL--TIKACALTIDLGILPDGDQT 749

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG------- 638
           ++G +G SLSGGQK R+++ARA   +    +LD+  +A+D   ++  I + LG       
Sbjct: 750 MVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKS 809

Query: 639 --RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696
             +L+ + ++T++SIA  +S +            G +++ G ++++  +  S L  L+ +
Sbjct: 810 KTKLLATNKITVLSIASSISLVE----------GGEIIQHGSYEDISKDLDSPLSNLVKE 859

Query: 697 --KKPT 700
             KK T
Sbjct: 860 FGKKKT 865

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  130 bits (326), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 140/536 (26%), Positives = 240/536 (44%), Gaps = 42/536 (7%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVL----GEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            +L I+  + V   +A   + ++L V     G K    L   +   ++     FF+   +G
Sbjct: 994  YLMIYLALGVGSALATLIQTIVLWVFCTIHGSKY---LHDAMASSVLKAPMSFFETTPIG 1050

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLF-APPLLVG 293
             +++R S+D Y V   + +  +  F                   + +  F+F   PL V 
Sbjct: 1051 RILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVI-----CMATWQFIFIVLPLSVL 1105

Query: 294  ALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELH----RYNNA 345
             + Y +     SREL+     +   +    +E L G+ TI+ +  + + +H    R +N 
Sbjct: 1106 YIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHINQTRVDNN 1165

Query: 346  IRKVF-SFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTE 404
            +   + S      L     F  + I+   S L V+  G+     G L+ G +   + +  
Sbjct: 1166 MSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGN-----GTLTAGMIGLSLSFAL 1220

Query: 405  YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVP--SW---GEIKFED 459
                ++  +     E+     +  R+ E  +  S+  P   K + P  SW   GEIKF  
Sbjct: 1221 QITQSLNWIVRMTVEVETNIVSVERIKEYAELKSE-APYIIKDHRPPASWPESGEIKF-- 1277

Query: 460  VSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
            V++S   RP  + I   ++  I P   + +VG +G GKS++   L R  +  SG I+IDG
Sbjct: 1278 VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIEAASGHIVIDG 1337

Query: 519  QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578
              I  +    LR  L ++ Q+  +  G++R N+     +  T +EI +          I 
Sbjct: 1338 IPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTNRYTDEEIWNALALSHLKDHIL 1395

Query: 579  KF-PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
                 G ET++   G++LS GQ+Q + +ARAL+    ILILDEAT+A+DVE++  I  T+
Sbjct: 1396 GMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDVETDQLIQKTI 1455

Query: 638  GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKL 693
                + R  TI++IAHR++TI  S+ +IVL + G V E    + L     S  + L
Sbjct: 1456 RNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTEFDTPQNLLQKKDSIFYSL 1508

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 108/443 (24%), Positives = 198/443 (44%), Gaps = 61/443 (13%)

Query: 316 TKVSEEQLSGVKTIQAFVAE----GKELH-RYNNAIRKVFSFGKKEALTNATFFSSTGIL 370
           T+V+ E L+ +K+++ +  E     K  H R    ++ +   G   AL N  F +    L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQF-NIVPFL 540

Query: 371 GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLS---NFYSELMKGAGAA 427
              S   V  Y     L   L    LT F L +       F L+   N  S  ++ + + 
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLS-------FPLAVVPNAISSFIEASVSI 593

Query: 428 SRLFE-MTDHTSQIKPSSGKPYVPSWGE--IKFEDVSFSYPTRPGNQI-FNKLNFTIEPG 483
           +RLF  +T+   Q      +P V + G+  +K  D +F +  +P  ++    +NF  + G
Sbjct: 594 NRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKG 653

Query: 484 SNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLM 543
              C+VG  G GKS +   LL             G  I      ++   +  V Q P +M
Sbjct: 654 ELTCIVGKVGSGKSALIQSLL-------------GDLIRVKGFATVHGDVANVSQVPWIM 700

Query: 544 SGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
           +G+++ N+ +G   +    ++    K C     ++  P+G +T++G +G SLSGGQK R+
Sbjct: 701 NGTVKDNILFGHKYDPEFYQL--TIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARL 758

Query: 604 AIARALIKKPKILILDEATSALDVE-SEGAINYTLG---------RLMRSRELTIISIAH 653
           ++ARA+  +    +LD+  +A+D   ++  I + LG         +++ + ++T++SIA 
Sbjct: 759 SLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA- 817

Query: 654 RLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND--KKPTQLQSQSRNSVE 711
                    + I L  +G +++ G + ++  +  S L KL+ +  KK     SQS  S+ 
Sbjct: 818 ---------DSITLMENGEIIQQGSYDQVNESTNSPLSKLIAEFGKKGKPTPSQSTTSLA 868

Query: 712 TKENE----VDDQVLEQVANDFN 730
              +E      D  + ++  D N
Sbjct: 869 KLASEGIESYSDSKISEITVDIN 891

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 136/537 (25%), Positives = 235/537 (43%), Gaps = 62/537 (11%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            FL  +A I +  +    G++ +  + G     ++ S ++  I      F D   VG +++
Sbjct: 1028 FLLFYAIIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVGRIMN 1087

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPL-----LVG 293
            R S D  ++ + +  N    F+                  +T    +FA PL      VG
Sbjct: 1088 RFSKDMDIIDQQLIPN----FEGLFYSVVVCLWIVILIGYVTPRFLIFAIPLCGLYYFVG 1143

Query: 294  ALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFG 353
            AL Y +  R + R    +   + ++  E + GV TI+A   E + +     AI       
Sbjct: 1144 AL-YLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHTLEAIDG----- 1197

Query: 354  KKEALTNATFFS----------STGILGDL----SFLIVLAYGSHLVLQGGLSVGDLTAF 399
                 +NA FF              I+G L    S L+++A   +L    GL+   L+  
Sbjct: 1198 -----SNAPFFYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYL--DAGLAGILLSNA 1250

Query: 400  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPSWGEIKFE 458
              +TE T   +  + +    LM          E+    S+   S+  P   P  GEI+F+
Sbjct: 1251 FSFTE-TAQWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTGEIEFK 1309

Query: 459  DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518
            ++S  Y       + N ++F +  G+ V +VG +G GKS+I + + R  D  SG I+ID 
Sbjct: 1310 NLSLRYSPHSSKALDN-VSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDN 1368

Query: 519  QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSE-VTMDEIRSVA----KKCF 572
            ++I  +S + LR  +  + Q P L  G+IR NL  Y   S+    D +  V      +  
Sbjct: 1369 KDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQVFDALAKVGLIERNEVL 1428

Query: 573  C--------HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSA 624
            C          F         +V+   G++LS GQ+Q + +AR+++   KI+++DEAT++
Sbjct: 1429 CLVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATAS 1488

Query: 625  LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            +D  S+  I  T+   M +   TI++IAHRL ++     ++V+       +MG+ KE
Sbjct: 1489 IDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILVM-------DMGRVKE 1536

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 122/255 (47%), Gaps = 9/255 (3%)

Query: 433 MTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPS 492
           + D+  + + S  +    S  ++ F+D +  +     +     ++   +  S   ++GP+
Sbjct: 642 IEDYLDESETSKYEILTQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPT 701

Query: 493 GRGKSTIASLLLRYYDPNSGRIMI---DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRY 549
           G GKS++   LL   +  SG+I +   D ++  ++    +   +    Q P L+SG+I  
Sbjct: 702 GSGKSSLLLGLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIED 761

Query: 550 NLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARAL 609
           N+ +G           +V K C     +     G +T +G  G SLSGGQ+QR+A+ARA+
Sbjct: 762 NIVFG--ERPNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAI 819

Query: 610 IKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVL 667
               + L+LD+  SA+D E+   I      G +M+ R  T I  +H +S I +    +V+
Sbjct: 820 YSSSRFLLLDDCLSAVDPETALNIYEKCLCGPIMKGR--TCIITSHNISLITKKAEWLVI 877

Query: 668 GNDGSVVEMGKFKEL 682
            ++G V   GK  +L
Sbjct: 878 LDNGEVKGQGKPSDL 892

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 124/539 (23%), Positives = 234/539 (43%), Gaps = 63/539 (11%)

Query: 179  FLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            FL+ +  I    +    G++ +  + G     ++ + ++  I      F D   VG +++
Sbjct: 1041 FLSTYTIIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMN 1100

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYG 298
            R S D  ++ + +  N    F+                  +T    LFA PL     I G
Sbjct: 1101 RFSKDMDIIDQQLIPN----FEGLFYSVVVCLWVIFLIGYITPRFLLFAIPLCALYYIVG 1156

Query: 299  KKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGK 354
                  SREL+     +   + ++  E + GV TI+A   E + + +   AI K      
Sbjct: 1157 SLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDK------ 1210

Query: 355  KEALTNATFFS----------STGILGDL-----SFLIVLAYGSHLVLQGGLSVGDLTAF 399
                +NA FF              I+G L     S +IVL          G+ + +  +F
Sbjct: 1211 ----SNAPFFYLNLATEWITYRVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSF 1266

Query: 400  MLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFED 459
                ++      G+    S + +         E ++  +   P +  P     G+I+FE+
Sbjct: 1267 TETAQWIIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLANWPQT---GDIEFEN 1323

Query: 460  VSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQ 519
            ++  Y     ++  + ++F ++ G+ V +VG +G GKS+I + + R  D   G I+ID +
Sbjct: 1324 LTLRYSPH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNK 1382

Query: 520  NISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDE-------IRSVAKKC 571
            +I  +  + LR  +  + Q P L  G+IR NL  +   S+V + E       I      C
Sbjct: 1383 DIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLC 1442

Query: 572  FCHGFITKFPEGYE---------TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEAT 622
               G    +P  ++         TV+   G+++S GQ+Q + +AR+++    I+++DEAT
Sbjct: 1443 SLPGQKLSYPSNHKLRNRFIDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEAT 1502

Query: 623  SALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
            +++D  S+  I  T+   MR+   T+++IAHRL ++   + ++V+       +MG+ +E
Sbjct: 1503 ASIDYVSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-------DMGRVEE 1552

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 101/209 (48%), Gaps = 20/209 (9%)

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
           +    Q P L+SG+I+ N+ +G        +   V K C     I     G +T +G  G
Sbjct: 746 MAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKCCCLEKDIKAMTAGLKTDVGEGG 803

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            SLSGGQ+QRIA+ARA+    + L+ D+  SA+D E+   I      G +M+ R  T I 
Sbjct: 804 FSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHIYEECLCGPMMKGR--TCIV 861

Query: 651 IAHRLSTIRRSENVIVLGNDGSV---------VEMGKF-KELYANDQSELFKLLNDKKPT 700
            +H +S I +    +V+ ++G V         +E  KF KE   ND  +  K  N  K  
Sbjct: 862 TSHNISLIIKQAQWLVILDNGEVKAQGKPSDLIESSKFLKESINNDPGD--KSYNQIKLK 919

Query: 701 QLQS--QSRNSVETKENEVDDQVLEQVAN 727
           Q ++  ++ N +  +E+  D++  ++  N
Sbjct: 920 QFKTLKKTENVLPIEEDPQDEENPQEAEN 948

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 152/545 (27%), Positives = 248/545 (45%), Gaps = 67/545 (12%)

Query: 194  NFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQ 253
            N   I++L     +   +L  ++ K +I     FF+   VG +I+R SSD   V  ++  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQY 1095

Query: 254  NVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMI-SRELQE-- 310
              S  FK+                      FL     LV   IY +   ++ SREL+   
Sbjct: 1096 IFSFFFKSILTYLVTVIL-----VGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLI 1150

Query: 311  --STGNLTKVSEEQLSGVKTIQA------FVAEGKELHRYNNAIRKVFSFGKKEALTN-- 360
              S   +  +  E L+G   I A      F+    E  +YN  +  VF+F       +  
Sbjct: 1151 SISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--VDFVFNFRSTNRWLSVR 1208

Query: 361  -----ATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSN 415
                 AT   +T IL       +    +   L  G+ VG L ++ L  E TGS  + +  
Sbjct: 1209 LQTIGATIVLATAILA------LATMNTKRQLSSGM-VGLLMSYSL--EVTGSLTWIVRT 1259

Query: 416  FYSELMKGAGAASRLFEMTD---HTSQIKPSSGKP--YVPSWGEIKFEDVSFSYPTRPGN 470
              + +     +  R+ E  +       I P   +P    PS G I+F++ S  Y     +
Sbjct: 1260 TVT-IETNIVSVERIVEYCELPPEAQSINPEK-RPDENWPSKGGIEFKNYSTKY-RENLD 1316

Query: 471  QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLR 530
             + N +N  IEP   V +VG +G GKST++  L R  +P  G+I+IDG +IS +    LR
Sbjct: 1317 PVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLR 1376

Query: 531  RHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHGFITKF----PEG-- 583
             HL ++ Q+     G+++ NL  +   SE   DE++   ++      + K     P G  
Sbjct: 1377 SHLAIIPQDAQAFEGTVKTNLDPFNRYSE---DELKRAVEQAHLKPHLEKMLHSKPRGDD 1433

Query: 584  -----------YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632
                        +  I   G++LS GQ+Q + +ARAL+ + KIL+LDEAT+++D+E++  
Sbjct: 1434 SNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKI 1493

Query: 633  INYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFK 692
            I  T+ R  + R  TI++IAHR+ T+  S+ +IVL + GSV E     +L + D++ +F 
Sbjct: 1494 IQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSKLLS-DKTSIFY 1549

Query: 693  LLNDK 697
             L +K
Sbjct: 1550 SLCEK 1554

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 156/685 (22%), Positives = 292/685 (42%), Gaps = 86/685 (12%)

Query: 97  STEEKSKTNYREILRLIRLARHDWK----LLSVAIGLLTISSTVGMTIPKVIGIVLDAVK 152
           S E K+     + L    L R  WK     +SVA+   T S  + +  P+ + I +D + 
Sbjct: 262 SKEFKANWELEKWLNRNSLWRAIWKSFGRTISVAMLYETTSDLLSVVQPQFLRIFIDGL- 320

Query: 153 NASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARL 212
                   P T    PP+    G+F  L +F   +V   + N   I +    G  +   L
Sbjct: 321 -------NPETSSKYPPLN---GVFIALTLFVISVVSVFLTNQFYIGIFEA-GLGIRGSL 369

Query: 213 RSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXX 272
            S V +K +       +    GD+++ +S D   + R      +                
Sbjct: 370 ASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLY 429

Query: 273 XXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAF 332
                ++   L   A  + + A +  +K++ +S+   +      K   E L+ +K+I+ +
Sbjct: 430 WLLGKAVIGGLVTMAIMMPINAFL-SRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLY 488

Query: 333 VAEGKELHRYNNAIR--KVFSFGKKEALTNATFFSSTGI--LGDLSFLIVLAYGSHLVLQ 388
             E   + R N+     ++ +F K   ++N  +F+   +  +   S   + +  S   L 
Sbjct: 489 AWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDSPLS 548

Query: 389 GGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL--FEMTDHTS-----QIK 441
             +    L+ F +      SA++ + +  + +++ + +  RL  F ++D        +I 
Sbjct: 549 PAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERID 604

Query: 442 PSSGKPYVPSWGEIKFEDVSFSYPTRP--------------------GNQIF--NKLNFT 479
           PS+ +  +P+   I+  +++F + ++                      +QI   N  +F 
Sbjct: 605 PSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFE 661

Query: 480 IEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG-RIMIDGQNISKLSCKSLRRHLGVVQQ 538
            + G  VCVVG  G GKST    +L      SG R  I  + I + S       +    Q
Sbjct: 662 AKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSS------SVAYCSQ 715

Query: 539 EPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGG 598
           E  +M+ S+R N+ +G   +   D      K C     +   P+G ET++G +G SLSGG
Sbjct: 716 ESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGG 773

Query: 599 QKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSRELTIISIAHRLS 656
           QK R+++ARA+  +  I +LD+  SA+D E S+  I Y L G+    +  TII   + +S
Sbjct: 774 QKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVS 833

Query: 657 TIRRSENVIVLGNDGSVVEMGKFKELY--ANDQSELFKLL-------NDKKPTQLQSQSR 707
            ++ S+ +  L N G +VE G ++++    N+ S+L KLL       ++   + +Q++ R
Sbjct: 834 ILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTEHR 892

Query: 708 NSVETK--------ENEVDDQVLEQ 724
           +  E          E+E +D+V+ +
Sbjct: 893 SESEVDEPLQLKVTESETEDEVVTE 917

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 136/548 (24%), Positives = 239/548 (43%), Gaps = 60/548 (10%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANF-GRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR 230
            + +GM+ F        VFG+I    G+  LL  +G +    L    + ++IH    F + 
Sbjct: 839  FYMGMYSFF-------VFGSIVFLTGQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMES 891

Query: 231  NKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPP- 289
              +G +++R + D    + S+   + D  +                  +    F  A P 
Sbjct: 892  TPMGRIMNRFTKD----TESLDNQILDNLRFVVYQACTIVGISVLCI-IYLPWFAIAIPG 946

Query: 290  ----LLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNA 345
                L V    Y    R I R        +     + L GV TI+A+ AE +  ++ +  
Sbjct: 947  LGLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYL 1006

Query: 346  IRKV----FSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFML 401
            I K     + +   +   N    +  GI    + ++ L   + +    G S G + +++L
Sbjct: 1007 IDKTNEASYLYTAVQRWINIVI-NLVGI--SFTLIVSLLCVTKVFNLSGASTGVVLSYVL 1063

Query: 402  YT----EYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKF 457
                    T + V    N  + + +    A+ L +   H  ++   +     P  GEIKF
Sbjct: 1064 LIPDLLNNTLTMVTQTENDMNSVERLVTYATELPQEASHGEEVPSKTW----PENGEIKF 1119

Query: 458  EDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            E+V +++  R G   + +K    I  G  V + G +G GKST+   L R  +  SGR+MI
Sbjct: 1120 ENVRYTH--RDGLPAVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVMI 1177

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHG 575
            D  ++SKL+  +LR  L ++ Q+P+L  GS+R+NL  +G   E   D +++   +C    
Sbjct: 1178 DDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLDPFG---EYDDDVLKNALMRCTVGK 1234

Query: 576  FITKFPEGYETV-----------------IGPRGASLSGGQKQRIAIARALIKKPKILIL 618
            F     E  E +                 +   G + S G++Q +A+ARALI+   IL+L
Sbjct: 1235 FNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSSILVL 1294

Query: 619  DEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGK 678
            DEAT+A+D  ++  +   +    + R  T++ +AHRL TI   + ++VL N G ++ +  
Sbjct: 1295 DEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN-GKIIGLDT 1351

Query: 679  FKELYAND 686
             K L  N+
Sbjct: 1352 PKSLLDNN 1359

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 117/466 (25%), Positives = 210/466 (45%), Gaps = 74/466 (15%)

Query: 285 LFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNN 344
           LF   ++V   ++G  ++M    + + T     +  E L+ +K ++ +  E      Y  
Sbjct: 333 LFFVTIIVVIFLFGIVMKM-RLNINQVTDQRVSILREVLNNIKMVKLYCWE----QAYEK 387

Query: 345 AIRKVFSF-----GKKEALTNATF---FSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDL 396
           +I+K+ S       + E L N  F   FS   I   ++FL +        + GGL     
Sbjct: 388 SIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLMTFLALFK------IHGGLK---- 437

Query: 397 TAFMLYTEYTGSAVFGLSNFYSELMKGAG-----AASRLFEMTD-----HTSQIKPSSGK 446
            A  +++  +   +  L +FY  L  G       +  R  E  +      T  I+ ++ +
Sbjct: 438 NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQEFLEAEESKETRIIRETNSE 497

Query: 447 PYVPSWGEIKFEDVSFSYPTRPGNQI-------FNKLNFTIEPGSNVCVVGPSGRGKST- 498
            Y  +   IK    SF + T   +         F+ LNF I  G  + +VGP G GK++ 
Sbjct: 498 IYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTSL 557

Query: 499 ---IASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGM 555
              I  L+ +Y   N G + +DG   S +SC             P + + ++R N+ +G 
Sbjct: 558 LNAICGLMPQY--GNEGELEVDG---SLVSCGY-----------PWIQNTTVRDNILFG- 600

Query: 556 NSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKI 615
            S+    + + V + C     + K      T IG RG +LSGGQK RI +AR+L K+  I
Sbjct: 601 -SKYDESKFKRVIRMCSLEEDLEKLSAYDMTEIGERGVTLSGGQKSRINLARSLYKEKDI 659

Query: 616 LILDEATSALDVE-SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            + D+  SA+D    +  +   L   ++++  T +   H+LS I +++ +IVLGNDG   
Sbjct: 660 YLFDDILSAVDSRVGQSIMKECLMEGLKNK--TRVLATHQLSLIGKADQLIVLGNDGK-F 716

Query: 675 EMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVETKENEVDDQ 720
           +MG++++L   +++    L+N  +  +LQ +    ++ KE  + D+
Sbjct: 717 DMGRYEDLIKTNET----LINLMQYAKLQEE----IQEKEEVIKDK 754

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  125 bits (315), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 155/639 (24%), Positives = 270/639 (42%), Gaps = 77/639 (12%)

Query: 97  STEEKSKTN---YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKN 153
           +T+E+   N   +R     ++ A   W+ + +   LLTI  +    +   + +       
Sbjct: 381 TTKEERAVNSIKFRVYSEYLKAAAGKWRFVVIPCYLLTIMGSAFCQLFASVWL------- 433

Query: 154 ASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLR 213
               F      ++  P  Y +G++ F     G  +F  I  F  +  L V   K    L 
Sbjct: 434 ---SFWTENKFKNRSPSFY-MGLYSFFVF--GQYMFMNI-QFTVLCFLGVTASKF---LN 483

Query: 214 SNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXX 273
              +K I+H    F D   +G +++R + D    + SM   +++  +             
Sbjct: 484 LKAVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIGVI 539

Query: 274 XXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTG--------NLTKVSEEQLSG 325
                      +  P LL+  ++     +   RE++            NL +V    L G
Sbjct: 540 VMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEV----LGG 595

Query: 326 VKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTN---ATFFSSTGILGDLSFLIVLAYG 382
           + TI+A+ ++ + L + +  I K+   G   A      A F     ++   + +I L   
Sbjct: 596 LDTIRAYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVI--FALIITLLCV 653

Query: 383 SHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL----FEMTDHTS 438
           +        S G L  ++L      + V       ++   G  +A RL     ++     
Sbjct: 654 TRQFKISPSSTGVLLTYVLQLPGLLNTVL---RALTQAENGMNSAERLVTYALDLPQEAE 710

Query: 439 QIKPSSGKPY-VPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGK 496
             +P    P   P  GEIKFE VSF+Y P+ P   +    +  I  G  + + G +G GK
Sbjct: 711 YRRPEMSPPENWPDRGEIKFEGVSFAYRPSLP--PVLKNFSLNIGSGEKIGICGRTGAGK 768

Query: 497 STIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGM 555
           STI S L R  +   G+I ID  NI+ L    LR  L ++ Q+P+L  G+I+ NL  +G 
Sbjct: 769 STIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGE 828

Query: 556 NSEVTMDE--IR--SVAKKCF------------CHGFITKFPEGYETVIGPRGASLSGGQ 599
            ++  + E  +R  ++A +               H  + KF    E  +   G + S G+
Sbjct: 829 KTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGE 886

Query: 600 KQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSR-ELTIISIAHRLSTI 658
           KQ +A+ RAL++  +ILILDEATS++D E++  I     R++ +  + TI+ IAHRL+TI
Sbjct: 887 KQLLALTRALVRNSRILILDEATSSVDYETDDKIQ---SRIVEAFGDCTILCIAHRLNTI 943

Query: 659 RRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
              + ++VL   G V E      L+  +   +FK + ++
Sbjct: 944 LNYDRILVL-EQGEVAEFDTPWNLFTKEDG-IFKSMCER 980

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 87/266 (32%), Positives = 135/266 (50%), Gaps = 31/266 (11%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LNF I+ G  + V GP G GK+++ S +  +   + G + ++G+    LSC      
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGR---LLSCGY---- 158

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + ++R N+ +G   E    + R V K C     +   P G  T IG RG
Sbjct: 159 -------PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RI +AR + K   I + D+  SA+D      I     LG L +    T I 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK---TRIL 266

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSV 710
             H+L+ I ++  +IVLGNDGS   +G ++EL  ++ S+L KLL   + T  +S+  ++ 
Sbjct: 267 ATHQLALIEKATRLIVLGNDGSFT-IGTYEELQKSN-SQLKKLL---QFTSDKSEEDDN- 320

Query: 711 ETKENEVDDQVLEQVANDFN-LDQKS 735
           + K+NE D +V    A D   LD+K+
Sbjct: 321 DQKQNENDKEVH---AEDLEGLDEKA 343

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 142/552 (25%), Positives = 233/552 (42%), Gaps = 68/552 (12%)

Query: 172  YGLGMFDFLAIFAGILVFGT-IANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR 230
            + +G++ F        VFG+ I   G+  LL  +G      L    + KI+H    F D 
Sbjct: 942  FYMGLYSFF-------VFGSYIFMNGQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDT 994

Query: 231  NKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPL 290
            N +G +++R + D   +   +T+N+                          A+ +   P 
Sbjct: 995  NPLGRILNRFTKDTDALDNELTENLRLAMSQIANIIG------------VGAMCIIYLPW 1042

Query: 291  LVGALIYGKKIRMISRELQESTGNLTKVSE------------EQLSGVKTIQAFVAEGKE 338
               A+ +   I ++  +  +STG   K  E            E L+G+ TI+A+ A+ + 
Sbjct: 1043 FAIAIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDRF 1102

Query: 339  LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDL-----SFLIVLAYGSHLVLQGGLSV 393
              +    I K+     + A  +       GI  DL     + +I L   +      G   
Sbjct: 1103 ATKSEFLIDKM----NEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISGADT 1158

Query: 394  GDLTAFMLYTEYTGSAVF-GLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPY-VPS 451
            G L  ++L      + V   L+   +++       S   ++       KP    P   P 
Sbjct: 1159 GVLLTYVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQYRKPECSPPIDWPQ 1218

Query: 452  WGEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
             G I FE+++F+Y  RPG  I  K  N  I+P   + + G +G GKSTI + L R  +  
Sbjct: 1219 NGHIVFENINFAY--RPGLPIILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELT 1276

Query: 511  SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT----------------YG 554
            +G+I+ID  +IS L    LR  L ++ Q+P+L  G+IR NL                  G
Sbjct: 1277 TGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAG 1336

Query: 555  MNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPK 614
                  ++ ++S  K       + KF       +   G + S G++Q +A+ RAL+++ K
Sbjct: 1337 AIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVRQSK 1393

Query: 615  ILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            ILILDEATS++D E++  I   +         TI+ IAHRL TI   + ++VL   G V 
Sbjct: 1394 ILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKGEVA 1450

Query: 675  EMGKFKELYAND 686
            E      L+ ND
Sbjct: 1451 EFDTPWNLFNND 1462

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 103/214 (48%), Gaps = 21/214 (9%)

Query: 472 IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRR 531
           + + +NFTI  G  V V GP G GK+++   L    +  SG +   G     L C     
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSG---DLLLC----- 675

Query: 532 HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
             G+    P + + +IR N+ +G   + T    + V   C     +   P   +T +G R
Sbjct: 676 --GI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSRELTIIS 650
           G +LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y +   +  +  T I 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 651 IAHRLSTIRRSENVIVLGN--DGSVVEMGKFKEL 682
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 138/547 (25%), Positives = 227/547 (41%), Gaps = 60/547 (10%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +GM+ F   F     F T + F    L+  +G     RL    +++++H    F D  
Sbjct: 942  FYMGMYTFFVFFN---YFVTTSQFS---LICYIGLSAAKRLNLKAVQRLLHTPMSFLDTT 995

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R + D   V   +T++V                       +    F  A P L
Sbjct: 996  PIGRVLNRFTKDTDTVDTELTESVR-----LFVFQLSNIVGVIVMCIIYLPWFAIAVPFL 1050

Query: 292  VGALI-----YGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNAI 346
            +   +     Y    R I R       ++     E L G+ TI+A+  E + L + +   
Sbjct: 1051 MLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTKSDFLT 1110

Query: 347  RKVFSFGK-KEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEY 405
             K+   G    A+      +   I    + ++ L   +        SVG L  ++L    
Sbjct: 1111 NKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVLLTYVL---- 1166

Query: 406  TGSAVFGLSNFYSELM----KGAGAASRLF----EMTDHTSQIKPSSGKPY-VPSWGEIK 456
                + GL N     M        +  RL     E+    +  +P    P   P+ G I+
Sbjct: 1167 ---QLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEWPTDGRIE 1223

Query: 457  FEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIM 515
            F+ VS +Y  RPG   +   +   +  G  + + G +G GKSTI S L R  + + G I 
Sbjct: 1224 FDHVSLAY--RPGLPLVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSIT 1281

Query: 516  IDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK---CF 572
            IDG +IS L    LR  L ++ Q+P++  G +R NL      E T DE+     +     
Sbjct: 1282 IDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNL--DPFHERTDDELWHALVRGGAIP 1339

Query: 573  CHGFITKFPEGYETV--------------IGPRGASLSGGQKQRIAIARALIKKPKILIL 618
                 T   + +E                +   G + S G++Q +A+ RAL+++ KILIL
Sbjct: 1340 AESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSLGERQLLALTRALVRQSKILIL 1399

Query: 619  DEATSALDVESEGAINYTLGRLMRS-RELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
            DEATS++D E++  I     R++ +    TI+ IAHRL+TI   + ++VL + G V E  
Sbjct: 1400 DEATSSVDYETDAKIQ---TRIVEAFSNCTILCIAHRLNTILDYDRILVL-DQGRVCEFD 1455

Query: 678  KFKELYA 684
                LYA
Sbjct: 1456 TPAALYA 1462

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 116/250 (46%), Gaps = 42/250 (16%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ LN  I  G  V V G  G GKS++   L  +     G I  DG   + L C      
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDG---TMLLCGY---- 655

Query: 533 LGVVQQEPMLMSGSIRYNLTYGM-NSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
                  P + + ++R N+ +G   +E   +EI  V   C     +   P G  T IG R
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEARYNEIIRV---CSLQADLELLPAGDRTEIGER 705

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTII 649
           G +LSGGQK RI +ARA+ KK  I + D+  SA+D      I     +G+L  S   T +
Sbjct: 706 GITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRV 762

Query: 650 SIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL------------YANDQSELFKLLNDK 697
              H+LS I R+  VI +  DGS V++G  +EL            Y+N  SE     ++K
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEELKKRKPGFVNLMQYSN-HSE-----SEK 815

Query: 698 KPTQLQSQSR 707
           KP +++ + R
Sbjct: 816 KPGEVEEEKR 825

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 147/560 (26%), Positives = 243/560 (43%), Gaps = 65/560 (11%)

Query: 179  FLAIFA----GILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVG 234
            ++A++A    G   F  + +   ++   + G K   +L   + + ++     FF+   VG
Sbjct: 1015 YVAVYALIGLGSAAFTILRSVIMMIYCSIKGSK---KLHDTMARAVLRSPMSFFETTPVG 1071

Query: 235  DLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFL-FAPPLLVG 293
             +I+R SSD  VV + +  + +  F                  S    LFL F   LLV 
Sbjct: 1072 RIINRFSSDVNVVDQGLQFSFTYFF-----IYILNYLFTVILISFNMPLFLLFNGILLVL 1126

Query: 294  ALIYGKKIRMISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGKELHRY---NNA- 345
               Y      +SREL+     S   +  +  E L G   I A+    K L R+   NN  
Sbjct: 1127 YFYYQIYYITLSRELKRLTSISYSPIMSLLSETLGGHLVINAY----KHLQRFTYLNNES 1182

Query: 346  ----IRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLV-LQGGLSVGDLTAFM 400
                I  +F+F      TN         +G +  L+        +     LS G +   M
Sbjct: 1183 IQFNINCMFNFRS----TNRWLSMRLQTIGAVLVLLTALLSLSTINTDKALSSGMVGLLM 1238

Query: 401  LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIK 456
             Y     +++  +     ++     +  R+ E  +   +    I+ S      PS G I 
Sbjct: 1239 SYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPPEADAIIEESRPPKEWPSRGAIT 1298

Query: 457  FEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMI 516
            F++ S  Y     + +   +   I+P   + +VG +G GKST++  L R  +P+ G I+I
Sbjct: 1299 FQNYSTKYRENL-DPVLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVI 1357

Query: 517  DGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKKCFCHG 575
            DG +I+KL    LR +L ++ Q+     G+I+ NL  +G  S+   +EI    +      
Sbjct: 1358 DGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD---EEIWRALELSHLKP 1414

Query: 576  FITKFP-----EGYETV-------------IGPRGASLSGGQKQRIAIARALIKKPKILI 617
             I K       E  ET              I   G +LS GQ+Q + ++RAL+   KIL+
Sbjct: 1415 HILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLLCLSRALLNHSKILV 1474

Query: 618  LDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
            LDEAT+A+D+E++  I  T+    + R  TI++IAHR+ T+  S+ ++VL + G V E  
Sbjct: 1475 LDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFD 1531

Query: 678  KFKELYANDQSELFKLLNDK 697
                L A D+S +F  L +K
Sbjct: 1532 TPTNLLA-DKSTIFYNLCEK 1550

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 206/481 (42%), Gaps = 88/481 (18%)

Query: 298 GKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELHRYNNA------------ 345
            KK++ + R   +      K   E L+ VK+I+ +  E   L R ++             
Sbjct: 451 SKKVKTLYRTQMKYKDARIKTITEILNSVKSIKLYAWEKPMLERLDHCRNGLELENFKKI 510

Query: 346 --IRKVFSFGKK---EALTNATF--FSST-----------------GILGDLSFLIVLAY 381
             +  +  F  K    A+T +TF  FS T                  IL D  + I    
Sbjct: 511 GIVSNLIYFAWKCIPVAVTCSTFAIFSLTSDMPLSPQIVFPSLSLFNILNDCIYSIPSTI 570

Query: 382 GSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSE-LMKGAGAASRLFEMTDHTSQI 440
            +  +++ G+S+  L  F+L  E        L +F+ E L   A + S   E+ + T   
Sbjct: 571 NN--IIETGVSIKRLKDFLLAEE--------LDDFFIERLDANATSNSPAIEIYNATFLW 620

Query: 441 KPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQ---IFNKLNFTIEPGSNVCVVGPSGRGKS 497
           K + G            ED ++       +    + N  +F    G   C+VG  G GKS
Sbjct: 621 KSTKGLK----------EDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKS 670

Query: 498 TIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNS 557
           T    +L      SG   +D     KL  ++  + +    Q+P +M+ S++ N+ +G   
Sbjct: 671 TFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWIMNASLKDNVIFG--H 723

Query: 558 EVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI 617
            +  D  ++  +KC     +   P+G +T++G +G SLSGGQK R+++ARA+  +  + +
Sbjct: 724 RLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYL 783

Query: 618 LDEATSALDVE-SEGAINYTLGR---LMRSRELTIISIAHRLSTIRRSENVIVLGNDGSV 673
           LD+  SA+D E S+  +   L R   +++++  T+I   + +S ++ S+N+  L  DG +
Sbjct: 784 LDDILSAVDAEVSKNIVEQVLNRGTGILKNK--TVILTTNAVSVLKHSQNIYALL-DGEI 840

Query: 674 VEMGKFKELYANDQSELFKLL--------------NDKKPTQLQSQSRNSVETKENEVDD 719
           VE   + +  + D S + K L               D +P+      + S  + ++E +D
Sbjct: 841 VENKSYADAMSCDDSSILKTLIQEFDSNENSREDTKDGQPSSTAKDDQKSFHSIKDEQED 900

Query: 720 Q 720
           +
Sbjct: 901 R 901

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 139/568 (24%), Positives = 236/568 (41%), Gaps = 68/568 (11%)

Query: 172  YGLGMFDFLAIFAGI-LVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDR 230
            Y      F+ I+A I L+     N   +++L     +   +L   +   ++     FF+ 
Sbjct: 1016 YNKDFLKFVTIYAIIGLLSAAFNNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFET 1075

Query: 231  NKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPL 290
              +G +++R SSD   +   +    S  F++                      F+    +
Sbjct: 1076 TPIGRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLIL-----VGYNLPWFIALNAV 1130

Query: 291  LVGALIYGKKIR-MISRELQE----STGNLTKVSEEQLSGVKTIQAFVAEGK------EL 339
            L+    Y +    M+SREL+     S   +  +  E L G   I AF    +      E 
Sbjct: 1131 LIMIYFYYQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAFDHTSRFNFFNFET 1190

Query: 340  HRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYG----SHLVLQGGLSVGD 395
             +YN  I  VF F      TN         +G+L   I+LA G    + L  +  LS G 
Sbjct: 1191 VQYN--IDCVFQFRS----TNRWLSVRLQTIGNL---IILATGLLSFATLGTKKQLSSGM 1241

Query: 396  LTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD---HTSQIKPSSGKPY-VPS 451
            +   M Y+    S++  +     ++     +  R  E  +      +I  +S  P   P 
Sbjct: 1242 VGLLMSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPR 1301

Query: 452  WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
             G I+F + +  Y     + +   +N +I+P   + +VG +G GKST+   L R  +   
Sbjct: 1302 EGAIEFNNYTTKY-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATG 1360

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL-------------------- 551
            G I IDG +ISK+  + LR +L ++ Q+     G+IR NL                    
Sbjct: 1361 GSISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLDPFDQHSDEELWRAVELSHL 1420

Query: 552  ---TYGMNSEVT---MDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAI 605
                  MN E      D  R+       H       E   T I   G+++S GQ+Q + +
Sbjct: 1421 KQHILRMNEEANDRESDSSRTDITTPDSHN----IKELLATPISKNGSNVSVGQRQLLCL 1476

Query: 606  ARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVI 665
            +RAL+   K+LILDEAT+A+D+E++  +  T+    + R  TI++IAHR+ T+   + ++
Sbjct: 1477 SRALLNPSKVLILDEATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKIL 1534

Query: 666  VLGNDGSVVEMGKFKELYANDQSELFKL 693
            VL + G V E      L ++  +  +KL
Sbjct: 1535 VL-DKGEVAEFDTVSNLLSDKNTMFYKL 1561

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/226 (28%), Positives = 120/226 (53%), Gaps = 16/226 (7%)

Query: 477 NFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVV 536
           NFT++ GS  C+VG  G GKSTI   +L      S    +D     K++ ++    +   
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAILGQLPCISA---LDQTRAPKVTIRA--TSIAYC 704

Query: 537 QQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLS 596
            QE  +M+ S++ N+ +G   +     +  V + C     ++  P+G ET++G +G SL 
Sbjct: 705 PQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGISLV 762

Query: 597 GG-QKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSRELTIISI 651
           GG QK RI++ARA+  +  + +LD+  SA+D   S+  I Y L +   L+R++  TII  
Sbjct: 763 GGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILS 820

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELY-ANDQSELFKLLND 696
            + ++ ++ S+ +  +   G +VE   ++ +  ++D S + KL+ +
Sbjct: 821 TNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  122 bits (307), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 140/547 (25%), Positives = 241/547 (44%), Gaps = 62/547 (11%)

Query: 172  YGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRN 231
            + +G++ F  +F G L        G+  L+  +G      L    +++++H    + D  
Sbjct: 924  FYMGLYSFF-VFGGYLFMN-----GQYTLICYMGVTASKVLNLKAVERVLHTPMAYMDTT 977

Query: 232  KVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLL 291
             +G +++R + D   +   +T+++                       +    F  A P L
Sbjct: 978  PIGRILNRFTKDTDSLDNELTESLR-----LFMTQFANIIGVCVMCIIYLPWFAIAIPFL 1032

Query: 292  VGALI-----YGKKIRMISR--ELQES--TGNLTKVSEEQLSGVKTIQAFVAEGKELHRY 342
            V   +     Y    R + R   +Q S    NL +V    L G+ TI+A+ ++ + L + 
Sbjct: 1033 VLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEV----LGGMDTIKAYGSQERFLVKT 1088

Query: 343  NNAIRKVFSFGKK-EALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFML 401
            +  I K+   G    AL          I    + +I L   +        SVG L  ++L
Sbjct: 1089 DFLINKMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCVTRQFHISPASVGVLLTYVL 1148

Query: 402  YTEYTGSAVFGLSNF----YSELMKGAGAASRLF----EMTDHTSQIKPSSGKPY-VPSW 452
                    + GL N      ++      +A RL     E+       +P    P   PS 
Sbjct: 1149 -------QLPGLLNTILRALTQTENDMNSAERLVYCANELPLEADYKRPELAPPESWPSK 1201

Query: 453  GEIKFEDVSFSYPTRPGNQIFNK-LNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
            GEI FEDVSF+Y  RPG  +  K ++  I+    + + G +G GKSTI S L R  + + 
Sbjct: 1202 GEIVFEDVSFAY--RPGLPVVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSD 1259

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNL-------------TYGMNSE 558
            G+I ID  +I ++    LR+ L ++ Q+P+L  G+IR NL             +      
Sbjct: 1260 GKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLWKSLVSGGA 1319

Query: 559  VTMDEIRSV-AKKCFCHGFITKFPEGY-ETVIGPRGASLSGGQKQRIAIARALIKKPKIL 616
            ++ +E+  V  +K    G ++   + + +  +   GA+ S G++Q +A+ RAL+++ KIL
Sbjct: 1320 ISAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALVRQSKIL 1379

Query: 617  ILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEM 676
            ILDEATS++D E++  I   +       + TI+ IAHRL TI   + ++VL   G + E 
Sbjct: 1380 ILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVL-EQGEIEEF 1436

Query: 677  GKFKELY 683
               + LY
Sbjct: 1437 DTPRSLY 1443

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 118/248 (47%), Gaps = 29/248 (11%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F  LN  I+ G  V + GP G GKS++ S +  +    SG + +DG     L C      
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG---DLLMCGY---- 648

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + ++R N+ +G  S    +    V + C     I   P G  T IG RG
Sbjct: 649 -------PWIQNATVRDNIIFG--SPYDKERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RI +AR++ K   I + D+  SA+D      I     LGRL   +  T I 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSV 710
             H+LS I ++  VIVLG DGS  E GK ++L  ++++ L  LL+        SQ  +S 
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDLKRSNKT-LINLLH------FSSQKSSSK 808

Query: 711 ETKENEVD 718
           E   +E D
Sbjct: 809 EADTSEKD 816

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/227 (35%), Positives = 129/227 (56%), Gaps = 13/227 (5%)

Query: 453  GEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511
             EI F+ V   Y P  P   +   ++FT+ P S V +VG +G GKST+   L R  +  +
Sbjct: 1236 AEISFDHVYVRYAPHLP--DVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIELTN 1293

Query: 512  GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDEIRSVAKK 570
            G I I G +I+ L+ ++LRR L V+ Q+P L SG+I+ N+  +G  S+    E+   A++
Sbjct: 1294 GTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRYSD---QELTHFARR 1350

Query: 571  C--FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
               F      +      +++   G ++S GQ+Q + +ARAL++K KILILDEAT+++D E
Sbjct: 1351 IGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASIDHE 1410

Query: 629  SEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVE 675
            ++  I   +     S    +I++AHR+STI   + VIVL  D  +V+
Sbjct: 1411 TDATIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 124/255 (48%), Gaps = 17/255 (6%)

Query: 451 SWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN 510
           S+ E+ F + S ++       +   L    E      ++GPSG GKS++   LL   D  
Sbjct: 631 SFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLI 690

Query: 511 SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
            G I +    +    C           Q P + + +++ N+ +  +S+      + V   
Sbjct: 691 EGSIRVPRGYMHDDRCS-----FAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHA 743

Query: 571 CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 630
           C     I +  EG ETV+G +G +LSGGQ+QR+A+ARA+    + L+LD+  SA+D    
Sbjct: 744 CGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMA 803

Query: 631 GAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
             I     +G LM+ +  T I   H ++ +++  ++I+L ++G V ++GK ++   N  S
Sbjct: 804 VWIFQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF--NFDS 859

Query: 689 ELFKLLNDKKPTQLQ 703
           E     +  KP++L+
Sbjct: 860 E----FDYSKPSKLE 870

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  111 bits (277), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 144/280 (51%), Gaps = 40/280 (14%)

Query: 426 AASRLFEMTDHTSQ----IKPSSGKPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIE 481
           +  R+ E TD  S+    I P +  P     G+++ +++S  Y       + N ++F ++
Sbjct: 3   SVERIKEYTDIPSESNGYISPPANWPQT---GDVELKNLSLRYSPHSSKALDN-VSFKVK 58

Query: 482 PGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPM 541
            G+ V +VG +G GKS+I + + R  D  +G I ID ++I  +  + LR  +  + Q+P 
Sbjct: 59  AGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPT 118

Query: 542 LMSGSIRYNLT----------YGMNSEVTMDEIRSVAKKCF----------CHGFITKFP 581
           L  G++R NL           YG+ S+V +  I    + C            H    +F 
Sbjct: 119 LFDGTVRSNLDPFDRYSDVQIYGVLSKVGL--IEECDELCLIFEQEQPNFSSHKLRNRFI 176

Query: 582 EGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
           +   TV+   G++LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T+   M
Sbjct: 177 D-LNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETM 235

Query: 642 RSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKE 681
           ++   TI++IAHRL ++   + ++V+       EMG+ KE
Sbjct: 236 KN--TTILTIAHRLRSVIDYDKILVM-------EMGRVKE 266

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 131/239 (54%), Gaps = 11/239 (4%)

Query: 454  EIKFEDVSFSYPTRPGNQI-FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSG 512
            EI F++VSF+Y  RPG  +    ++F +  G  + + G +G GK+++ + L R  +  SG
Sbjct: 1144 EIVFQEVSFAY--RPGLPLALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESG 1201

Query: 513  RIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTMDE--IRSVAK 569
             I IDG +I+ L    LR  L ++ Q+P+L  G++R NL  +  +++ T+    +RS   
Sbjct: 1202 SIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVV 1261

Query: 570  KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES 629
                     KF    E   G  GA+ S G++Q +A+ARAL++  +ILILDEATS++D  +
Sbjct: 1262 PAGVVPTSHKFHLDQEVDEG--GANFSLGERQLLALARALVRSTRILILDEATSSVDYAT 1319

Query: 630  EGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQS 688
            +  +   +      R+ T++ +AHRL TI   + ++VL + G V E      L+A   S
Sbjct: 1320 DARVQARIA--AEFRQATVLCVAHRLRTIISYDRILVL-DQGRVAEFDTPYRLFARKDS 1375

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 125/268 (46%), Gaps = 21/268 (7%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
            N L F+I+ G  + V+G  G GK+++ + +  Y    +G + ++G   S L C      
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFC------ 601

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVT-MDEIRSVAKKCFCHGFITKFPEGYETVIGPR 591
            GV    P + + +IR N+ +G + + T  DE   V   C        FP G +T +G R
Sbjct: 602 -GV----PWIQNATIRDNIIFGSSFDQTRYDE---VVNACALEADFKIFPAGDKTEVGER 653

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISI 651
           G +LSGGQK RI++ARA+ K   I + D+  SA+D      I      L R +  T I  
Sbjct: 654 GITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQKC-LLDRLQNRTRILA 712

Query: 652 AHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNSVE 711
            H+L+ ++ +  VI LG DGS  +MG   EL+  +  +   L++    T  +     S+ 
Sbjct: 713 THQLALVQEASRVIFLGQDGS-FDMGTPAELHEKN-PQFRNLMSLSSQTNAEESEMESIR 770

Query: 712 TKENEVDDQVLEQVANDFNLDQKSSKLT 739
           ++              DFN +    ++T
Sbjct: 771 SQSKSKKASTAPVSMPDFNEEIDDGRIT 798

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 140/267 (52%), Gaps = 24/267 (8%)

Query: 441  KPSSGKPYV-PSWGEIKFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKST 498
            KP +   ++ P  G+I+F+D +F Y  + G   I    N  ++ G  + + G +G GKST
Sbjct: 787  KPETSPGHIWPENGKIQFKDANFRY--KEGLPLILKNFNMLVQSGEKIGICGRTGAGKST 844

Query: 499  IASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNS 557
            I + L R  +   G I ID  +IS L    LR++L ++ Q+P+L  G+IR NL  +    
Sbjct: 845  IMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFD 904

Query: 558  EVTM------------DEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAI 605
            + T+            D     ++K   +  +TKF       +   G + S G+KQ +A 
Sbjct: 905  DATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAF 962

Query: 606  ARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVI 665
             RA+I   K+++LDEA+S++D E++  I   + +       TI+ IAHRL+TI + + ++
Sbjct: 963  TRAIIHHSKVVVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRIL 1020

Query: 666  VLGNDGSVVEMGKFKELYANDQSELFK 692
            VL + G+++     + L+ N+  ELF+
Sbjct: 1021 VL-DHGNIIGFENPRVLFENN--ELFR 1044

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 120/257 (46%), Gaps = 43/257 (16%)

Query: 455 IKFEDVSFSYPTRPG---------NQI------------FNKLNFTIEPGSNVCVVGPSG 493
           IKF + SF + T            NQI            FN LNF+I  G  + + GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSIX-GEFIIITGPIG 224

Query: 494 RGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTY 553
            GK+++   +        G I IDG N+              +   P + + ++R N+ +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDG-NLQ-------------LCGYPWVQNTTVRDNIIF 270

Query: 554 GMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKP 613
           G  S+   ++   V + C     +  F     T IG  G +LSGGQK RI +ARA+ K  
Sbjct: 271 G--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 614 KILILDEATSALDVESEGAI--NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDG 671
            I + D+  SA+D      I  N  LG L  S +   I   H+LS I++++ ++VLGND 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXILATHQLSLIKKADRIVVLGNDN 386

Query: 672 SVVEMGKFKELYANDQS 688
           S  E+G +KEL  ++++
Sbjct: 387 S-FEIGPYKELIQSNKT 402

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 101/446 (22%), Positives = 197/446 (44%), Gaps = 59/446 (13%)

Query: 316 TKVSEEQLSGVKTIQAFVAEGK-----ELHRYNNAIRKVFSFGKKEALTNATFFSSTGIL 370
           T++  E L+ +K+++ +  E       E  R    ++ +   G   A T+  F +    L
Sbjct: 468 TRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQF-NIVPFL 526

Query: 371 GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 430
              S   V  +     L   L    LT F L +    +    +++F    ++ + + +RL
Sbjct: 527 VSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRL 582

Query: 431 FE-MTDHTSQIKPSSGKPYVPSWGEIKF---EDVSFSYPTRPGNQI-FNKLNFTIEPGSN 485
           F  +T+   Q       P V + G++     +D +F +  +P  ++    +NF    G  
Sbjct: 583 FSFLTNEELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGEL 642

Query: 486 VCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG 545
            C+VG  G GKS +   +L       G   + G              +  V Q P +M+G
Sbjct: 643 TCIVGKVGSGKSALIQSILGDLFRVKGFATVHGD-------------VAYVSQVPWIMNG 689

Query: 546 SIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAI 605
           +++ N+ +G   +    E     K C     ++  P+G  T++G +G SLSGGQK R+++
Sbjct: 690 TVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSL 747

Query: 606 ARALIKKPKILILDEATSALDVESEGA--INYTLG---------RLMRSRELTIISIAHR 654
           ARA+  +    + D+  +A+D E  G   I + LG         +++ + ++T+++IA  
Sbjct: 748 ARAVYARADTYLFDDPLAAVD-EHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIA-- 804

Query: 655 LSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLN------DKKPTQLQSQSRN 708
                   + I L ++G +++ GK++E+ ++  S L KL+N      +  P  + S S +
Sbjct: 805 --------DYITLLDNGEIIQRGKYEEVTSDPGSPLCKLINEYGKKHESTPGTMVSSSMS 856

Query: 709 SVETKENEVDDQVLE-QVANDFNLDQ 733
              +    ++D++ E    +D +L Q
Sbjct: 857 KEPSPNVPLEDELRELHKLDDLDLAQ 882

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 73/127 (57%), Gaps = 13/127 (10%)

Query: 578  TKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
            TK  EG        G++LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T+
Sbjct: 1428 TKLSEG--------GSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETI 1479

Query: 638  GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697
                ++R  TI++IAHRL+TI  S+ ++VL + G + E    + L  +  S  + L    
Sbjct: 1480 RSAFKNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSLCEQA 1536

Query: 698  --KPTQL 702
               P QL
Sbjct: 1537 GLTPAQL 1543

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 81/369 (21%), Positives = 148/369 (40%), Gaps = 32/369 (8%)

Query: 199  VLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVS----RSMTQN 254
            V   + G K+   L S ++  ++     FF+   +G +++R S+D Y V     R+ +Q 
Sbjct: 999  VFCTIHGSKI---LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQF 1055

Query: 255  VSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYGKKIRMISRELQ--EST 312
             S+  K                   T     F  P+    + Y +     SREL+  +S 
Sbjct: 1056 FSNAVKVTFTLVVICVS--------TWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSV 1107

Query: 313  GNLTKVS--EEQLSGVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGIL 370
                 +S  +E L G+ TI+ +  E + +H     +    S        N         L
Sbjct: 1108 TRSPTISHFQETLGGISTIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFL 1167

Query: 371  GDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRL 430
            G +  L     G + + QG ++ G +   + Y      ++  +     E+     +  R+
Sbjct: 1168 GSVIILGASTLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERI 1227

Query: 431  FEMTDHTSQIKPS---SGKPYV--PSWGEIKFEDVSFSYPTR---PGNQIFNKLNFTIEP 482
             E ++  S+  PS     +P V  P  G +KF      Y TR     + +   +   I+P
Sbjct: 1228 KEYSELASE-APSIVEDKRPDVNWPQDGAVKFN----HYYTRYRADLDYVLKDITLDIKP 1282

Query: 483  GSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPML 542
               + +VG +G GKS++   L R  + + G I +DG N  ++    LR  L ++ Q+  +
Sbjct: 1283 REKIGIVGRTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQV 1342

Query: 543  MSGSIRYNL 551
              G++R N+
Sbjct: 1343 FEGTVRDNI 1351

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 129/254 (50%), Gaps = 30/254 (11%)

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRH 532
           F+ L+F ++ G  + + G  G GK+++ + L  +    +G I  +G+    L C +    
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR---MLFCGA---- 642

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  P + + +IR N+T+G  S    +  R V + C     ++  P G +T +G RG
Sbjct: 643 -------PWIQNATIRDNITFG--SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            +LSGGQK RI +AR + K   I + D+  SA+D     +I  +  LG+L    + T I 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQ--SELFKLLNDKKPTQLQSQSR- 707
             H++S   ++  VI LG DGS  ++G   EL   +   + L KL      +Q +S+S+ 
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFANLMKL-----ASQTESESKD 804

Query: 708 NSVETKENEVDDQV 721
           +++ +++ + +DQ+
Sbjct: 805 DNISSEKFDREDQL 818

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 88/408 (21%), Positives = 174/408 (42%), Gaps = 51/408 (12%)

Query: 183  FAGILVFGTIANFG----RIVLLRVLGEKLVARLRSNVIKKIIHQDAEFFDRNKVGDLIS 238
            + G+  F  +AN+     +  L+  LG +    +    + +++H    F D   +G +++
Sbjct: 921  YMGMYFFFVMANYLSTNIQFSLVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILN 980

Query: 239  RLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXXXXXXXSASLTSALFLFAPPLLVGALIYG 298
            R + D  ++   +T+++                       + S ++L  P   V   +  
Sbjct: 981  RFTKDTDILDNELTESL---------RMFSYQFTVIWGVIIMSIIYL--PWFAVAVPLLV 1029

Query: 299  KKIRMISRELQESTGNLTKVS-----------EEQLSGVKTIQAFVAEGKELHRYNNAIR 347
                ++S   Q S   + ++             E +SGV TI+A+ AE + L + +  I 
Sbjct: 1030 VVFILVSDHYQCSAREIKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKKSDILID 1089

Query: 348  KVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFMLYTEYTG 407
            ++         +        G++  L  LI+    S L + G  ++   +  +L T    
Sbjct: 1090 RMNEMTFPLYASQRWVSILIGMIAVLFALII----SILCVTGWFNISPASTGVLLT---- 1141

Query: 408  SAVFGLSNFYSELMKGA-------GAASRLFEMTDHTSQIKPSSGKPYVP--SW---GEI 455
              V  L N ++ L++          +A R+    +   +  P       P  +W   G I
Sbjct: 1142 -YVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEAPYRIPEMAPPKAWPERGAI 1200

Query: 456  KFEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
             F++V+ +Y  RPG   +   ++F I  G  + + G +G GKSTI + L R  + ++G +
Sbjct: 1201 TFDNVALAY--RPGLPLVLQDVSFHISSGEKIGICGRTGAGKSTITNALYRLVELSNGSV 1258

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLT-YGMNSEVTM 561
             IDG +I+ +   +LR  L ++ Q+P+L  G+IR NL  +G +S+  +
Sbjct: 1259 TIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNLDPFGEHSDTEL 1306

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/112 (37%), Positives = 70/112 (62%), Gaps = 6/112 (5%)

Query: 592  GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-RELTIIS 650
            G++ S G++Q +A+ARAL+++ KILILDEATS++D E++  I     R+++  +  TI+ 
Sbjct: 1425 GSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQ---ARIVQEFQHATIMC 1481

Query: 651  IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQL 702
            +AHRL TI   + ++V+   G V E      LY N+Q  +F+ + D+    L
Sbjct: 1482 VAHRLKTILHYDRILVM-EKGRVAEFDTPLRLY-NEQGSIFRSMCDQSSITL 1531

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 101/206 (49%), Gaps = 15/206 (7%)

Query: 533 LGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
           +    Q P L+SG+I+ N+ +G        +   V K C     I     G  T +G  G
Sbjct: 732 MAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCLDKDIKAMTAGIRTDVGDGG 789

Query: 593 ASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSRELTIIS 650
            SLSGGQ+QRIA+ARA+    + LILD+  SA+D E+   I      G +M+ R  T I 
Sbjct: 790 FSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYIYEECLCGPMMKGR--TCII 847

Query: 651 IAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPT---QLQ-SQS 706
            +H +S + +  + +V+ + G V   GK  +L  +++     + ND K T   Q+   +S
Sbjct: 848 TSHNISLVTKRADWLVILDRGEVKSQGKPSDLIKSNEFLRESINNDSKNTTHNQIDLKRS 907

Query: 707 RNSVETKENEVD-----DQVLEQVAN 727
             S +TK  + +     D+V  +V N
Sbjct: 908 TTSKKTKNGDPEGGNSQDEVCAEVEN 933

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 124/278 (44%), Gaps = 53/278 (19%)

Query: 435 DHTSQIKPSSGKPYVP-----SWGEIKFEDVSFSYPT---RPGNQIFNKLNFTIEP---- 482
           D    I PS+    V      ++  I+FE++    P+   R G ++ N+L F + P    
Sbjct: 521 DSVDSIDPSANSELVCGTVQRNFNGIRFENIDVVIPSKFGRDGIKLINRLRFQVPPVIGL 580

Query: 483 --------------------GSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNIS 522
                               GS++ ++GP+G GK++I  ++   +        I  +N  
Sbjct: 581 DNNNSDSQINLSQKLMFKGPGSSMLILGPNGSGKTSIQRIIAEIWP-------IYNKN-G 632

Query: 523 KLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMD------EIRSVAKKCFCHGF 576
            LS  + R  + + Q+   +  G+ R  + Y M+++   D      E+  V K+     +
Sbjct: 633 LLSVPAERELICIPQKPYFIQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-Y 691

Query: 577 ITKFPEG--YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 634
           + K  +G  Y   +      LSGG++QR+  AR +  KPK ++LDEAT+A+  + E   +
Sbjct: 692 LLKRDKGWRYLDAVAEWKDVLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---D 748

Query: 635 YTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
           Y    L R R    I+I+ R S I+  +  + +G D S
Sbjct: 749 YLFNMLKRYR-FNFITISQRPSLIKYHDLALEIGADES 785

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 118/263 (44%), Gaps = 38/263 (14%)

Query: 488 VVGPSGRGKSTIASLLLRYYDPNSGRIMIDG---QNISKLSCKSLRRHLGVVQQEPMLMS 544
           V GP+G GKS +   LL       G I +     ++   +    L   +    Q P +++
Sbjct: 724 VAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHELMIHGDGLTNSISYCSQIPWIIN 783

Query: 545 GSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIA 604
            SI+ N+ +G  SE  +     V + C     +    +G  +++G RG +LSGGQ+QR++
Sbjct: 784 DSIKNNILFG--SEFNLKRYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRVS 841

Query: 605 IARALIKKPKILILDEATSALDVESEGAINYTL---GRLMRSRELTIISIAHRLS-TIRR 660
           +ARA+  K   +ILD+  SA+D +    I Y L   G LM+ R  T I ++H +   I++
Sbjct: 842 LARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELVIKK 898

Query: 661 SENVIVLGN--------DGSVVEMGKFKELYANDQSELFKLLNDKKPTQL---------- 702
           +  +++L N         G +++    ++ Y       F  LN+  P Q           
Sbjct: 899 AAYLLILDNRTTAYKGPPGDLLKDKALRQRYCKFD---FNELNENCPNQCTTSVVHKPDY 955

Query: 703 -----QSQSRNSVETKENEVDDQ 720
                 S S+   +T    +DDQ
Sbjct: 956 YLEDRDSSSKTQSQTILKNLDDQ 978

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 69/312 (22%), Positives = 124/312 (39%), Gaps = 52/312 (16%)

Query: 211  RLRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAXXXXXXXXX 270
            R+   +++ ++     FF++  +G +++  S D   +   ++  +   F           
Sbjct: 1092 RIFIKILRNVVSSKLIFFEKTPIGSIMNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLI 1151

Query: 271  XXXXXSASLT-SALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVS-----EEQLS 324
                 + +    A+F+F     +G           SREL+     +TK        E L+
Sbjct: 1152 LITYVNPNFIFPAIFIFLFCCFIG-----HSYLCCSRELKRYES-ITKTPIYQHFSESLA 1205

Query: 325  GVKTIQAFVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLI------- 377
            G+ +I+AF   G EL      I+ +F+   +    N +FF        LSF I       
Sbjct: 1206 GLVSIRAF---GDELR----FIKVIFT---RVDEYNKSFFYLWEANNWLSFRIELIGSIT 1255

Query: 378  VLAYGSHLVLQGGLSVGDLT--AFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTD 435
            +LA G  L+    +    L    F     +T SA++ +  FY+ +     +  RL+E T+
Sbjct: 1256 ILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEYTN 1314

Query: 436  HTSQIKPSSGKPY----------VPSWGEIKFEDVSFSY-PTRPGNQIFNKLNFTIEPGS 484
               +       PY           P+ G+IKF++V+  Y P  P  ++   + F I    
Sbjct: 1315 LEQE-------PYSRCITNVDNQWPNSGDIKFKNVTLRYSPELP--KVLQDVTFVIGDKE 1365

Query: 485  NVCVVGPSGRGK 496
             + VVG +G GK
Sbjct: 1366 KIGVVGRTGAGK 1377

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 121/263 (46%), Gaps = 44/263 (16%)

Query: 455 IKFEDVS----FSYP---TRPGN------QIFNKLNFTIEPGSNVCVVGPSGRGKSTIAS 501
           IK ED+     FS P    + GN      +I   +N   +PG    ++GPSG GKS++ +
Sbjct: 679 IKLEDIDLRVIFSAPFSNWKEGNFHHETKEILQSVNAIFKPGMINAIMGPSGSGKSSLLN 738

Query: 502 LL--------LRYYDPNSGRIMIDGQNISKLSCKSLRRHL---------GVVQQEPMLMS 544
           L+           +D  SG IM +   +S+L  K++  ++          +  +E +  +
Sbjct: 739 LISGRLKSSVFAKFD-TSGSIMFNDIQVSELMFKNVCSYVSQDDDHLLAALTVKETLKYA 797

Query: 545 GSIR-YNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRI 603
            ++R ++LT     E T + IRS+  K  C   I     G E V G     +SGG+K+R+
Sbjct: 798 AALRLHHLTEAERMERTDNLIRSLGLK-HCENNII----GNEFVKG-----ISGGEKRRV 847

Query: 604 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH--RLSTIRRS 661
            +   L+  P IL+LDE TS LD  +   I   L +L R +  TII   H  R    +R 
Sbjct: 848 TMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRF 907

Query: 662 ENVIVLGNDGSVVEMGKFKELYA 684
            NV++L   G     G   E+ A
Sbjct: 908 GNVLLLAKSGRTAFNGSPDEMIA 930

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 108/242 (44%), Gaps = 38/242 (15%)

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL-------------LRYYDPNSG 512
           ++    + N  +  +  GS + V+G SG GK+T+ ++L             +RY   ++G
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 513 ---------RIMIDGQNISKLSCKSLRRHLGVV---QQEPMLMSGSIRYNLTYGMNSEVT 560
                    R  +DGQ+        +++H+ +    QQ+ +    + R  L +  + ++ 
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 561 MDEIRSVAKKCFCHGFITKF--PEGYETVIGPRGA-SLSGGQKQRIAIARALIKKPKILI 617
             E     KK      I +    +  +T++G      LSGG+K+R++I   +I  P I+ 
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMF 208

Query: 618 LDEATSALDVESEGAINYTLGRLMRSRELT-IISIAHRLSTIRRSENVIVLGNDGSVVEM 676
           LDE T+ LD  S   +  TL +L +    T I+SI    S I    + + + + G+VV  
Sbjct: 209 LDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYC 268

Query: 677 GK 678
            K
Sbjct: 269 DK 270

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 86/174 (49%), Gaps = 19/174 (10%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SFSY   P N ++ KLNF ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  ++++   + 
Sbjct: 451 -----------SRHTHVKLGVYSQH-----SQDQLDLTKS-PLEFVRDKYPNISQDFQYW 493

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    E      G +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 494 RGQLGRYGLTGEAQTSQMG-TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    
Sbjct: 217 TITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR---- 272

Query: 647 TIISIAH 653
           T++ ++H
Sbjct: 273 TLVLVSH 279

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 113/255 (44%), Gaps = 52/255 (20%)

Query: 455 IKFEDVSFSYPTR---PGNQIFNKLNFTIEP------------------------GSNVC 487
           I+ E++    P++    G ++ NKL+F + P                        GS++ 
Sbjct: 545 IRLENIDVVIPSKYGKDGTRLINKLSFQVPPVITLGNGNSDSNLNINKKLAFQGPGSSML 604

Query: 488 VVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG-S 546
           ++GP+G GK++I  ++   +   +   ++     S L C         V Q+P  + G +
Sbjct: 605 ILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC---------VPQKPYFIQGGT 655

Query: 547 IRYNLTYGMNSEVTMDEIRSVAKKCFCH-------GFITKFPEG--YETVIGPRGASLSG 597
            R  + Y M+++   D       K   H        ++ K  +G  Y   +      LSG
Sbjct: 656 FREQIIYPMSADQYFD--MGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKDVLSG 713

Query: 598 GQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLST 657
           G++QRI  AR +  KP+ ++LDEAT+A+  + E   +Y  G L R R    I+I+ R S 
Sbjct: 714 GERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFGLLKRYR-FNFITISQRPSL 769

Query: 658 IRRSENVIVLGNDGS 672
           I+  +  + +  DG+
Sbjct: 770 IKYHDLALDISTDGT 784

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 113/231 (48%), Gaps = 34/231 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  ++++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYSNISQDFQFW 495

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES- 629
            G + ++    EG +TV   + A+LS GQ+ R+  A   +++P +L+LDE T+ LD+ + 
Sbjct: 496 RGQLGRYGLTGEG-QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTI 551

Query: 630 ---EGAIN-YTLGRLMRSRELTIIS-IAHRLSTIRRSENVIVLGNDGSVVE 675
                AIN +  G ++ S +  ++  IA  +  +   EN      DGS+++
Sbjct: 552 DSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVV---ENKTATRWDGSILQ 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 223 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 278

Query: 651 IAH 653
           ++H
Sbjct: 279 VSH 281

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 109/224 (48%), Gaps = 34/224 (15%)

Query: 417 YSELMKGAGAASRLFEMTDHTSQIKP-SSGKPYVPSWGEIK--------FEDVSFSYPTR 467
           Y+ L+K A +  ++ +  +    I+P +  K +   + +++        F+D+SF Y + 
Sbjct: 346 YANLVKQAKSRQKILDKMEADGLIQPVAPDKIFSFRFPQVERLPPPVLAFDDISFHYESN 405

Query: 468 PGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCK 527
           P   ++  LNF ++  S + +VGP+G GKST+  ++     P SGR+            +
Sbjct: 406 PSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV-----------SR 454

Query: 528 SLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FCHGFITKF---PEG 583
                LGV  Q         + +LT     E   D+  ++++   F  G + ++    EG
Sbjct: 455 HTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYSNISQDFQFWRGQLGRYGLTGEG 508

Query: 584 YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            +TV   + A+LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 509 -QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 223 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 278

Query: 651 IAH 653
           ++H
Sbjct: 279 VSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 89/177 (50%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  SV++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYPSVSQDFQYW 495

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    EG +TV   + A+LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEG-QTV---QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 585 ETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSR 644
           +T I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R  
Sbjct: 217 KTTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR-- 274

Query: 645 ELTIISIAH 653
             T++ ++H
Sbjct: 275 --TLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 47/188 (25%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF Y + P   ++  LNF ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 515 --------------MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI-RYNLTYGMNSEV 559
                           D  +++K + + +R     + Q+     G + RY LT G    V
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQFWRGQLGRYGLT-GEGQTV 511

Query: 560 TMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
            M                               A+LS GQ+ R+  A   +++P +L+LD
Sbjct: 512 QM-------------------------------ATLSEGQRSRVVFALLALEQPNVLLLD 540

Query: 620 EATSALDV 627
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 223 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 278

Query: 651 IAH 653
           ++H
Sbjct: 279 VSH 281

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 103/235 (43%), Gaps = 56/235 (23%)

Query: 417 YSELMKGAGAASRLFEMTDHTSQIKPS-SGKPYVPSWGEIK--------FEDVSFSYPTR 467
           Y+ L+K A +  ++ +  +    ++P  S + +   + E++        F+++SFSY  +
Sbjct: 345 YANLVKQAKSRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPPVLAFDEISFSYDEK 404

Query: 468 PGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI------------- 514
           P N ++  LNF ++  S V +VGP+G GKST+  ++     P  GR+             
Sbjct: 405 PENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQ 464

Query: 515 -MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI-RYNLTYGMNSEVTMDEIRSVAKKCF 572
              D  +++K + + +R   G + ++     G + RY LT G    V M           
Sbjct: 465 HSQDQLDLTKSALEFVRDKYGHISEDFQYWRGQLGRYGLT-GEGQTVQM----------- 512

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
                                +LS GQ+ R+  A   + +P +L+LDE T+ LD+
Sbjct: 513 --------------------GTLSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    
Sbjct: 218 TINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR---- 273

Query: 647 TIISIAH 653
           T++ ++H
Sbjct: 274 TLVLVSH 280

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 85/174 (48%), Gaps = 19/174 (10%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+++SFSY   P N ++ KLNF ++  S   +VGP+G GKST+  ++     P+ GR+
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+   +++   F 
Sbjct: 450 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYAHISEDFQFW 492

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    E     + A+LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 493 RGQLGRYGLTGEAQTA-QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    
Sbjct: 216 TINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR---- 271

Query: 647 TIISIAH 653
           T++ ++H
Sbjct: 272 TLVLVSH 278

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 132/280 (47%), Gaps = 39/280 (13%)

Query: 455 IKFEDVSFSYPTRPGNQ--IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL--RYYDPN 510
           + F+D+ +  P    N   + N+++  ++PG  + ++G SG GK+T+  +L   +     
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 511 SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMS---------GSIRYNLTYGMNSEVTM 561
           SG+I ++G++ISK   K   + +G V Q+  L+           S    L   +  E   
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLRLPRALPFEAKR 512

Query: 562 DEIRSVAKKCFCHGFITKFPEGYETVIG---PRGASLSGGQKQRIAIARALIKKPKILIL 618
             +  V ++        +  +  + +IG    RG  +SGG+K+R++IA  L+  P IL L
Sbjct: 513 SRVYKVLEE-------LRILDIKDKIIGNEFERG--ISGGEKRRVSIACELVTSPLILFL 563

Query: 619 DEATSALDVESEGAINYTLGRLMRSRELT-IISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
           DE TS LD  +   +   L RL R+   T ++SI    S I +  + +VL ++G +V  G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 678 ---KFKELYANDQSELFK-------LLNDKKPTQLQSQSR 707
              +  E   N+  +          L++    TQLQS+ R
Sbjct: 624 EAIRVNEFLRNNGYQCPTEYNIADYLIDITFETQLQSKKR 663

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 27/215 (12%)

Query: 470 NQIFNKLN--FTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCK 527
           N+I N ++  F    GS++ ++GP+G GKS+I  ++   +            N + L  K
Sbjct: 629 NEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIWPI---------YNKNGLLSK 679

Query: 528 SLRRHLGVVQQEPMLMSG-SIRYNLTYGMNSEVTMDEIRSVAKKCFCH-------GFITK 579
               +L  V Q+P    G ++R  + Y M+S+   D  R +  K            ++ K
Sbjct: 680 PTEANLLCVPQKPYFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLREVKLDYLLK 737

Query: 580 FPEG--YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 637
             +G  Y   +      LSGG+KQR+  AR +  KP+ ++LDEAT+A+  + E   +Y  
Sbjct: 738 RDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLF 794

Query: 638 GRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGS 672
             L R R    I+I+ R S I+  + ++ + +D S
Sbjct: 795 NVLKRYR-FNFITISQRPSLIKYHDLLLEISDDNS 828

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 126/249 (50%), Gaps = 16/249 (6%)

Query: 453  GEIKFEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYD--- 508
            G   ++DV +  P +   + + +K++  ++PG    ++G SG GK+T+ ++L +  D   
Sbjct: 800  GVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGL-TALMGASGAGKTTLLNVLAQRMDFGI 858

Query: 509  PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG-SIRYNLTYGMNSEVTMDEIRSV 567
             +SG I++D + + +      +R +G VQQ+ +     ++R +L +        D +   
Sbjct: 859  VSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRP-DSVPDA 913

Query: 568  AKKCFCHGFITKF--PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATSA 624
             K  +    I      +  + V+G  G  L+  Q+++++I   L+ KP +L+ LDE TS 
Sbjct: 914  EKMEYVEKIIVVLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDEPTSG 973

Query: 625  LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRS-ENVIVLGNDGSVVEMGKFKELY 683
            LD +S  AI   L RL  + +  + +I    +T+  S + +++L + GSVV  G   + +
Sbjct: 974  LDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGNIGD-H 1032

Query: 684  ANDQSELFK 692
            + D +  FK
Sbjct: 1033 SKDVTNYFK 1041

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 100/243 (41%), Gaps = 60/243 (24%)

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKS----TIASLLLRYYDPNSGRIMIDGQNISKLSC 526
           +I +++NF I+PG    V+G  G G S    T+A  L  + D + G I  DG     +  
Sbjct: 117 KILSQINFLIKPGEMCLVLGRPGAGCSSFLRTVAGELGNFTDVD-GEISYDG-----IPQ 170

Query: 527 KSLRRHLGVVQQEPMLMSGSIRYN---------LTYGMNSEVTM---------DEIRSVA 568
           K + +H            G I YN         LT     E+ +         DE   + 
Sbjct: 171 KEMIKHF----------KGDIIYNGEMDVHFPHLTVSQTLEMAIACKEPHSLSDE--KIP 218

Query: 569 KKCFCHGF------ITKFPEGYETVIGP---RGASLSGGQKQRIAIARALIKKPKILILD 619
           KK   HG       I      + T +G    RG  +SGG+++R++IA A+  +  +   D
Sbjct: 219 KKQHIHGNRDLYAGIFHLTHTFNTKVGNDFVRG--VSGGERKRVSIAEAMAARGSVYCWD 276

Query: 620 EATSALDVESEGAINY-----TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
            ++  LD  S  A +Y     T+  L++S  +  ++I      I R  + + +  DG  +
Sbjct: 277 NSSRGLD--SSSAYDYIKAIRTVSDLIKS--VAFVAIYQAGENIYRKFDKVTVLYDGRQI 332

Query: 675 EMG 677
             G
Sbjct: 333 YYG 335

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 83/188 (44%), Gaps = 47/188 (25%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF+Y  +P N ++N LNF ++  S + +VGP+G GKST+  ++       SGR+
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 515 --------------MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI-RYNLTYGMNSEV 559
                           D  +++K + + +R     + Q+     G + RY LT G    V
Sbjct: 453 SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPEISQDFQYWRGQLGRYGLT-GEAQTV 511

Query: 560 TMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
            M                                +LS GQ+ R+  A   ++ P +L+LD
Sbjct: 512 QM-------------------------------GTLSEGQRSRVVFALLALEAPNVLLLD 540

Query: 620 EATSALDV 627
           E T+ LD+
Sbjct: 541 EPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 223 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 278

Query: 651 IAH 653
           ++H
Sbjct: 279 VSH 281

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 100/236 (42%), Gaps = 48/236 (20%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I+ +DVSF Y     + +   +N  ++  S + +VG +G GK+T+  +++          
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMM---------- 579

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
                       + LR   G V + P L  G       Y     V   ++ + A      
Sbjct: 580 ------------EQLRPTKGYVSRNPRLRIG-------YFTQHHVDSMDLNTSAVDWMSK 620

Query: 575 GFITKFPEGYETVIGPRGAS----------LSGGQKQRIAIARALIKKPKILILDEATSA 624
            F  K  E Y   +G  G +          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 625 LDVESEGAI-----NYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVE 675
           LD     A+     N+T G LM S ++++I   H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISVID--HVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T++ ++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 87/177 (49%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SFSY  +P N ++  LNF ++  S + +VGP+G GKST+  ++       SGR+
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  ++++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYSNISQDFQYW 495

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    E    ++G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEAQTVLMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 586 TVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRE 645
           T I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R   
Sbjct: 218 TTILKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR--- 274

Query: 646 LTIISIAH 653
            T++ ++H
Sbjct: 275 -TLVLVSH 281

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 114/244 (46%), Gaps = 30/244 (12%)

Query: 482 PGSNVCVVGPSGRGKSTIASLLLRYYD--PNSGRIMIDGQNISKLSCKSLRRHLGVVQQE 539
           PGS++ ++GP+  GKS+I  +L   +     +G + I  +  S L C        + Q+ 
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAE--SDLMC--------IAQRP 646

Query: 540 PMLMSGSIRYNLTYGMNSEVTMD------EIRSVAKKCFCHGFITKFPEG--YETVIGPR 591
             +  G+ R  + Y M+ +   +      E+  + K+     ++ K  EG  Y   +   
Sbjct: 647 YFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFVADW 705

Query: 592 GASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISI 651
              LSGG+KQR+  AR +  +PK L+LDEAT+A+ V+ E   +Y    L + R    ISI
Sbjct: 706 KDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISI 761

Query: 652 AHRLSTIRRSENV--IVLGNDGSVVEMGKFKELYANDQSELFKLLNDKKPTQLQSQSRNS 709
           + R S I+  + +  I  G       +G   E   + ++E+  L  + K TQL +  +  
Sbjct: 762 SQRPSLIKYHDYLLEITSGTQWQYQTLGS-DEAITSIEAEIESL--ESKLTQLDAWEKER 818

Query: 710 VETK 713
            E K
Sbjct: 819 EELK 822

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 103/215 (47%), Gaps = 32/215 (14%)

Query: 470 NQIFN-KLNFTIEPGSNVCVVGPSGRGKSTIASLLLRY---YDPNSGRIMIDGQNISKLS 525
           N I++  L F+  PGS++ ++GP+  GKS+I  ++      Y+ N G + I  ++  +L 
Sbjct: 669 NSIYDMTLPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED--ELM 725

Query: 526 CKSLRRHLGVVQQEPMLMSG-SIRYNLTYGMNSEVTMDEIRSVAKKCFCH-------GFI 577
           C         + Q P    G + R  + Y M S+   D  R +  K            ++
Sbjct: 726 C---------IPQRPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYL 774

Query: 578 TKFPEG--YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 635
            K  +G  Y   +      LSGG+KQR+  AR L  KP+ +ILDEAT+A+ V+ E     
Sbjct: 775 LKRDKGWSYFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDY--- 831

Query: 636 TLGRLMRSRELTIISIAHRLSTIRRSENVIVLGND 670
            L ++++      ISI+ R S ++  + ++ +  D
Sbjct: 832 -LFKMLKKYRFNFISISQRPSLVKYHDLLLEISED 865

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 86/177 (48%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F++++FSY   P N ++  LNF ++  S + +VGP+G GKST+  ++     P +GR+
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYPQISQDFQYW 495

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    EG    +G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
            +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ ++H
Sbjct: 226 DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVLVSH 281

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 107/232 (46%), Gaps = 31/232 (13%)

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASL--------LLRYYDPNSGRIMIDGQNIS 522
           +I   +N   +PG    ++GPSG GKS++ +L        L   +D  SG IM +   +S
Sbjct: 716 EILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKFD-TSGTIMFNDIQVS 774

Query: 523 KLSCKSLRRHLG---------VVQQEPMLMSGSIR-YNLTYGMNSEVTMDEIRSVAKKCF 572
           +L  K++  ++          +  +E +  + ++R ++L     +E T + IRS+  K  
Sbjct: 775 ELMFKNVCSYVSQDDDHLLATLTVKETLKYAAALRLHHLNEAERTERTDNLIRSLGLK-H 833

Query: 573 CHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 632
           C   I     G E V G     +SGG+K+R+ +   L+  P IL+LDE TS LD  +   
Sbjct: 834 CENNII----GNEFVKG-----ISGGEKRRVTMGVQLLSDPPILLLDEPTSGLDSFTSAT 884

Query: 633 INYTLGRLMRSRELTIISIAH--RLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
           I   L  L +    T+I   H  R    +R  NV++L   G     G   E+
Sbjct: 885 ILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEM 936

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 95/219 (43%), Gaps = 34/219 (15%)

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL-------------LRYY----D 508
           ++    + N  +  +  GS + V+G SG GK+T+ ++L             +RY     +
Sbjct: 38  SKTNTTLVNSFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLRHEGSIRYVLEDSE 97

Query: 509 PNSG-----RIMIDGQNISKLSCKSLRRHLGVV-----QQEPMLMSGSIRYNLTYGMNSE 558
           P SG      + +  +N S+L  +       V+     QQ+ +    + R  L +  + +
Sbjct: 98  PGSGYGSEESVDVKAKN-SRLDGEDHHTQKHVIMAYLPQQDVLSPRLTCRETLNFAADLK 156

Query: 559 VTMDEIRSVAKKCFCHGFITKF--PEGYETVIGPRGA-SLSGGQKQRIAIARALIKKPKI 615
           +      S  KK      I +    +  +T++G      LSGG+K+R++I   +I  P I
Sbjct: 157 LNSS---SRTKKLMVEQLIEELGLRDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSI 213

Query: 616 LILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHR 654
           + LDE T+ LD  S   +  TL +L +    T I   H+
Sbjct: 214 MFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQ 252

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 86/177 (48%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+ +SFSY   P N ++  L+F ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  ++++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYPNISQDFQYW 495

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    EG    +G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 223 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 278

Query: 651 IAH 653
           ++H
Sbjct: 279 VSH 281

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 88/211 (41%), Gaps = 46/211 (21%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I+ +DVSF Y   P   +   +N  I+  S + +VG +G GK+T+  ++L    P SG  
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSG-- 587

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
                                V + P L  G       Y     V   ++ + A      
Sbjct: 588 --------------------YVSRNPRLRIG-------YFTQHHVDSMDLSTSAVDWMSK 620

Query: 575 GFITKFPEGYETVIGPRGAS----------LSGGQKQRIAIARALIKKPKILILDEATSA 624
            F  K  E Y   +G  G +          LSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 625 LDVESEGAI-----NYTLGRLMRSRELTIIS 650
           LD     A+     N+T G LM S ++++I+
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   ++S   T+++++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 83/177 (46%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF+Y  +P N ++  LNF ++  S V +VGP+G GKST+  ++       SGR+
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         +  L      E   D+   ++    + 
Sbjct: 450 -----------SRHTHVKLGVYSQHSQDQLDLTKSPL------EFVRDKYSHISHDFQYW 492

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    EG  + +    A+LS GQ+ R+  A   ++ P +L+LDE T+ LD+
Sbjct: 493 RGQLGRYGLTGEGQTSQM----ATLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI 545

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    
Sbjct: 216 TINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR---- 271

Query: 647 TIISIAH 653
           T++ ++H
Sbjct: 272 TLVLVSH 278

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 83/190 (43%), Gaps = 47/190 (24%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF+Y   P N ++  LNF ++  S   +VGP+G GKST+  ++     P SGR+
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 515 --------------MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI-RYNLTYGMNSEV 559
                           D  +++K + + +R     + Q+     G + RY LT G   +V
Sbjct: 563 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLGRYGLT-GDAQKV 621

Query: 560 TMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
            M                                +LS GQ+ R+  A   ++ P +L+LD
Sbjct: 622 QM-------------------------------GTLSEGQRSRVVFALLALENPNVLLLD 650

Query: 620 EATSALDVES 629
           E T+ LD+ +
Sbjct: 651 EPTNGLDIPT 660

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 333 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 388

Query: 651 IAH 653
           ++H
Sbjct: 389 VSH 391

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 121/257 (47%), Gaps = 39/257 (15%)

Query: 455 IKFEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--S 511
           + FE++ ++  +  G + I N ++ +++PG  + ++G SG GK+T+  +L         S
Sbjct: 366 LTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKAS 425

Query: 512 GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
           G I I+G  I+K   ++L +  G V QE  L+     Y     +NS +    +R   K  
Sbjct: 426 GSIKINGSEITK---QNLSKIAGFVDQENFLLPTLTVYETV--LNSAL----LRLPRKL- 475

Query: 572 FCHGFITKFPEGYET------------VIG---PRGASLSGGQKQRIAIARALIKKPKIL 616
               F+ K    Y+             +IG    RG  +SGG+K+R++IA  L+  P +L
Sbjct: 476 ---SFVQKQKRVYQVLEELRILDIKDRIIGDDLERG--ISGGEKRRVSIACELVTSPSVL 530

Query: 617 ILDEATSALDVESEGAINYTLGRL-MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVE 675
            LDE TS LD  +   +   L RL +      I+SI    S I +S + +VL + G +V 
Sbjct: 531 FLDEPTSGLDSNNANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVF 590

Query: 676 MGKFKELYANDQSELFK 692
            G      A D SE  +
Sbjct: 591 SG-----VATDVSEFLR 602

>TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3.220
            YDR011W
          Length = 1511

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 114/234 (48%), Gaps = 16/234 (6%)

Query: 457  FEDVSFSYPTRPG-NQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL-RYYDPNSGRI 514
            + DV ++ P   G  ++ + ++    PG+   ++G SG GK+T+ + L  R     +G +
Sbjct: 871  WRDVCYTIPYDGGMRRLLDNVSGYCRPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDM 930

Query: 515  MIDGQNISKLSCKSLRRHLGVVQQE-----PMLMSGSIRYNLTYGMNSEVTMDEIRSVAK 569
            +++GQ I      S  R  G VQQ+      M +  S++++     N +V  +E  +  +
Sbjct: 931  LVNGQPID----ASFERRAGYVQQQDLHVAEMTVRESLQFSARMRRNQDVPDEEKMAYVE 986

Query: 570  KCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATSALDVE 628
            K      +    E  E ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS LD +
Sbjct: 987  KII---EVLGMEEYSEALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQ 1043

Query: 629  SEGAINYTLGRLMRSRELTIISIAHRLSTI-RRSENVIVLGNDGSVVEMGKFKE 681
            S  AI   L +L  + +  + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1044 SSWAIVQLLKKLANAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1097

>KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 107/236 (45%), Gaps = 31/236 (13%)

Query: 467 RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKST--------IASLLLRYYDPNSGRIMIDG 518
           R   QI   ++ + +PG    ++GPSG GKST        + S +   +D  SG IM +G
Sbjct: 684 REQKQILQCVSASFKPGMINAIMGPSGSGKSTLLNIISGRVKSSIFAKFD-KSGSIMFNG 742

Query: 519 QNISKLSCKSLRRHLG---------VVQQEPMLMSGSIR-YNLTYGMNSEVTMDEIRSVA 568
             +S+   K++  ++          +  +E    +  +R +N+TY   S  T + IR++ 
Sbjct: 743 NEVSEHMFKNVCSYVSQDDDHLLSKLTVKETFKFAADLRLHNMTYEQRSTKTDELIRALG 802

Query: 569 KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVE 628
            K  C   I     G E V G     +SGG+K+R+ +   L   P I++LDE TS LD  
Sbjct: 803 LK-HCENNII----GDEFVKG-----ISGGEKRRVTMGIQLQNDPPIILLDEPTSGLDSF 852

Query: 629 SEGAINYTLGRLMRSRELTIISIAH--RLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
           +   I   L +L  +   TII   H  R    ++  NV++L   G     G   E+
Sbjct: 853 TSSTILEILKKLAVNYGKTIILTIHQPRAELFKQFGNVLLLAKSGRTAFNGSPNEM 908

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/209 (22%), Positives = 95/209 (45%), Gaps = 31/209 (14%)

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL-------------LRYY-DPNS 511
           ++ G Q+ +  +  +  GS + V+G SG GK+T+ ++L             ++Y  + N+
Sbjct: 30  SKSGKQLIDSFSIDLHSGSVMAVMGGSGSGKTTLLNVLASKISGGLTVEGDIKYVLEENN 89

Query: 512 GRIMIDGQNISKLSCKSLRRHLGVV---QQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVA 568
           G  M+D  +       S+  H+ +    QQ+ +    + R  L    + ++   +   + 
Sbjct: 90  G--MMDDDD------SSIEEHVKMAYLPQQDILPARLTCRETLMCAADLKLNKSKQEKIN 141

Query: 569 KKCFCHGFITKF--PEGYETVIG-PRGASLSGGQKQRIAIARALIKKPKILILDEATSAL 625
                +  I +    +  +T++G  +   LSGG+K+R++I   ++  P I+ LDE T+ L
Sbjct: 142 ---IVNQLIDELGLKDCADTLVGDSKHKGLSGGEKRRLSIGTQMVSNPSIMFLDEPTTGL 198

Query: 626 DVESEGAINYTLGRLMRSRELTIISIAHR 654
           D  S   +  T+ +L +      I   H+
Sbjct: 199 DSYSAYLVIKTIKKLAKDDGRIFIMSIHQ 227

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 111/243 (45%), Gaps = 58/243 (23%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+++SF+Y   P + ++  LNF ++  S + +VGP+G GKST+  ++     P +GR+
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 515 --------------MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSI-RYNLTYGMNSEV 559
                           D  +++K + + +R     + Q+     G + RY LT       
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLGRYGLT------- 505

Query: 560 TMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILD 619
                                 +G +  +G    +LS GQ+ R+  A   ++ P IL+LD
Sbjct: 506 ---------------------GDGQKAQMG----TLSEGQRSRVVFALLALQAPNILLLD 540

Query: 620 EATSALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRR-SENVIVLGN------DGS 672
           E T+ LD+ +   I+ +L   + +    ++ ++H    + + ++++ V+ N      DGS
Sbjct: 541 EPTNGLDIPT---ID-SLAEAINTFNGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDGS 596

Query: 673 VVE 675
           ++E
Sbjct: 597 ILE 599

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 643
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R+
Sbjct: 219 TIQKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRT 275

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 110/223 (49%), Gaps = 20/223 (8%)

Query: 467  RPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--SGRIMIDGQNISKL 524
            R   +I N ++  ++PG+   ++G SG GK+T+   L         +G I +DG    KL
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 525  SCKSLRRHLGVVQQEPM-LMSGSIRYNLTYGMNSEVTMDEIRSVA---KKCFCHGFITKF 580
              +S  R +G  QQ+ + L + ++R +L +       + + +SV    K+ +    I   
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFS----AMLRQPKSVPASEKRKYVEEVINVL 977

Query: 581  P-EGY-ETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTL 637
              E Y + ++G  G  L+  Q++R+ I   L+ KPK+LI LDE TS LD ++  +I   L
Sbjct: 978  EMEPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSIC-QL 1036

Query: 638  GRLMRSRELTIISIAHRLST--IRRSENVIVLGNDGSVVEMGK 678
             R + +R   I+   H+ S   I+  + ++ L   G  V  G+
Sbjct: 1037 IRKLANRGQAILCTIHQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {ON}
           YOL075C (REAL)
          Length = 1295

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 108/233 (46%), Gaps = 29/233 (12%)

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN-------SGRIMIDGQNISK 523
           QI   +N   +PG    ++GPSG GKS++ +L+      +       +G IM++   +S+
Sbjct: 709 QILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSFFAKFNTAGSIMLNDIQVSE 768

Query: 524 LSCKSLRRHLG---------VVQQEPMLMSGSIR-YNLTYGMNSEVTMDEIRSVAKKCFC 573
              K++  ++          +  +E +  + ++R ++LT     E T + IRS+  K  C
Sbjct: 769 FMFKNVCSYVSQDDDHLLATLTVKETLKYASALRLHHLTEAERMERTDNLIRSLGLK-HC 827

Query: 574 HGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 633
              I     G E V G     +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I
Sbjct: 828 ENNII----GNEFVKG-----ISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATI 878

Query: 634 NYTLGRLMRSRELTIISIAH--RLSTIRRSENVIVLGNDGSVVEMGKFKELYA 684
              L +L   +  T+I   H  R    +R  NV++L   G     G   E+ A
Sbjct: 879 LEILEKLCTEQGKTVIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEMIA 931

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 104/240 (43%), Gaps = 26/240 (10%)

Query: 466 TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLL-------------LRYYDPNSG 512
           ++    + N  +  +  GS + V+G SG GK+T+ ++L             +RY   + G
Sbjct: 38  SKTNTTLVNAFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDMG 97

Query: 513 RIMIDGQ-NISKLSCKSLRRHLGVV-----QQEPMLMSGSIRYNLTYGMNSEVTMDEIRS 566
               + +  +  L  +    H  V+     QQ+ +    + R  L +  + ++   E   
Sbjct: 98  SESGEARLKVGHLDDQDHPTHKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE--- 154

Query: 567 VAKKCFCHGFITKF--PEGYETVIGPRGA-SLSGGQKQRIAIARALIKKPKILILDEATS 623
             K+      I +    +  +T++G      LSGG+K+R++I   +I  P ++ LDE T+
Sbjct: 155 RTKRIMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSVMFLDEPTT 214

Query: 624 ALDVESEGAINYTLGRLMRSRELT-IISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKEL 682
            LD  S   +  TL +L +    T I+SI    S I    + + + + G+VV   K   +
Sbjct: 215 GLDAYSAYLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVYCDKMNNI 274

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 105/250 (42%), Gaps = 60/250 (24%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I+ +DVSF Y  +  N +   +N  ++  S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
             +G                             R  + Y     V   ++ + A      
Sbjct: 590 SRNG-----------------------------RLRIGYFTQHHVDSMDLTTSAVDWMSK 620

Query: 575 GFITKFPEGYETVIGPRGAS----------LSGGQKQRIAIARALIKKPKILILDEATSA 624
            F  K  E Y   +G  G +          LSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 625 LDVESEGAI-----NYTLGRLMRSRELTII-SIAHRL-----STIRR--------SENVI 665
           LD     A+     N++ G LM S ++++I S+ + +      T+++         +++I
Sbjct: 681 LDTTGLDALIDALKNFSGGVLMVSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHII 740

Query: 666 VLGNDGSVVE 675
            L ND  VV+
Sbjct: 741 SLANDAGVVK 750

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T++ ++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 116/243 (47%), Gaps = 33/243 (13%)

Query: 457  FEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--SGR 513
            + D+ +  P + G + I N +N  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 802  WRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGG 861

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPM-LMSGSIRYNLTYG----MNSEVTMDE----I 564
            I +DG    +L  +S  R +G  QQ+ + L + ++R +L +       S V+++E    +
Sbjct: 862  IFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYV 917

Query: 565  RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATS 623
              V K       I +  +  + V+G  G  L+  Q++R+ I   L  +PK+L+ LDE TS
Sbjct: 918  EEVIK-------ILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 970

Query: 624  ALDVESEGAINYTLGRLMR---SRELTIISIAHRLSTI--RRSENVIVLGNDGSVVEMGK 678
             LD ++     +   +LMR   +    I+   H+ S I  ++ + ++ L   G  V  G 
Sbjct: 971  GLDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGD 1026

Query: 679  FKE 681
              E
Sbjct: 1027 LGE 1029

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 116/243 (47%), Gaps = 33/243 (13%)

Query: 457  FEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--SGR 513
            + D+ +  P + G + I N +N  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 802  WRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGG 861

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPM-LMSGSIRYNLTYG----MNSEVTMDE----I 564
            I +DG    +L  +S  R +G  QQ+ + L + ++R +L +       S V+++E    +
Sbjct: 862  IFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYV 917

Query: 565  RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATS 623
              V K       I +  +  + V+G  G  L+  Q++R+ I   L  +PK+L+ LDE TS
Sbjct: 918  EEVIK-------ILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 970

Query: 624  ALDVESEGAINYTLGRLMR---SRELTIISIAHRLSTI--RRSENVIVLGNDGSVVEMGK 678
             LD ++     +   +LMR   +    I+   H+ S I  ++ + ++ L   G  V  G 
Sbjct: 971  GLDSQTA----WDTCQLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGD 1026

Query: 679  FKE 681
              E
Sbjct: 1027 LGE 1029

>SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa]
           {ON} highly similar to gnl|GLV|KLLA0D04554g
           Kluyveromyces lactis KLLA0D04554g and similar to YCR011C
           uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1027

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 121/255 (47%), Gaps = 31/255 (12%)

Query: 441 KPSSGKPYVPSWGEIKFEDVSFSYPTRPGN--QIFNKLNFTIEPGSNVCVVGPSGRGKST 498
           +P   KP V +   + FE++++   +  G+  Q+ N ++ +++PG  + ++G SG GK+T
Sbjct: 358 EPDFLKPDVKA--TLTFENINYQVRSSKGSSTQVLNSISGSVKPGEILAIMGGSGAGKTT 415

Query: 499 IASLLLRYYDPN--SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYN------ 550
           +  +L         +G I ++G  ++K   ++  + +G V QE  L+     Y       
Sbjct: 416 LLDILAMKNKTGKVTGSIRLNGTEVTK---QNYSKIVGFVDQEDFLLPTLTVYETVLNSA 472

Query: 551 ---LTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIG---PRGASLSGGQKQRIA 604
              L   M+       +  V ++        +  E    VIG    RG  +SGG+K+R++
Sbjct: 473 LLRLPRSMSFAAKQKRVYQVLEE-------LRIFEIRNRVIGNDLERG--ISGGEKRRVS 523

Query: 605 IARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT-IISIAHRLSTIRRSEN 663
           IA  L+  P IL LDE TS LD  +   +   L RL      T I+SI    S I +  +
Sbjct: 524 IACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLANHYNRTLILSIHQPRSNIFKLFD 583

Query: 664 VIVLGNDGSVVEMGK 678
            +VL ++G +V  G+
Sbjct: 584 KLVLLSEGELVYSGE 598

>KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 105/224 (46%), Gaps = 34/224 (15%)

Query: 417 YSELMKGAGAASRLFEMTDHTSQIKP-SSGKPYVPSWGEIK--------FEDVSFSYPTR 467
           Y+ L+K A +  ++ +  +    I+P ++ K +   + E++        F+D+SFSY   
Sbjct: 343 YANLVKQAKSRQKILDKMEADGLIQPVAADKVFSFRFPEVERLPPPVLAFDDISFSYDGN 402

Query: 468 PGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNISKLSCK 527
             N ++  L+F ++  S + +VGP+G GKST+  ++       SGR+            +
Sbjct: 403 SENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRV-----------SR 451

Query: 528 SLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FCHGFITKF---PEG 583
                LGV  Q         + +LT     E   D+   V++   +  G + ++    EG
Sbjct: 452 HSHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYPHVSQDFQYWRGQLGRYGLTGEG 505

Query: 584 YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
               +G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 506 QTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 545

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 587 VIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSREL 646
            I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    
Sbjct: 216 TINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR---- 271

Query: 647 TIISIAH 653
           T++ ++H
Sbjct: 272 TLVLVSH 278

>YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Plasma
            membrane ATP binding cassette (ABC) transporter,
            multidrug transporter and general stress response factor
            implicated in cellular detoxification; regulated by
            Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR
            responsive element
          Length = 1529

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 114/240 (47%), Gaps = 27/240 (11%)

Query: 457  FEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--SGR 513
            + D+ +  P + G + I N ++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 886  WRDLCYDVPIKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGN 945

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPM-LMSGSIRYNLTYG----MNSEVTMDE----I 564
            I +DG    +L  +S  R +G  QQ+ + L + ++R +L +       S V+++E    +
Sbjct: 946  IFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRYV 1001

Query: 565  RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATS 623
              V K       I +  +  + V+G  G  L+  Q++R+ I   L  +PK+L+ LDE TS
Sbjct: 1002 EEVIK-------ILEMQQYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTS 1054

Query: 624  ALDVESEGAINYTLGRLMRSRELTIISIAHRLSTI--RRSENVIVLGNDGSVVEMGKFKE 681
             LD ++       L R + +    I+   H+ S I  ++ + ++ L   G  V  G   E
Sbjct: 1055 GLDSQTAWDTC-QLMRKLATHGQAILCTIHQPSAILMQQFDRLLFLQKGGQTVYFGDLGE 1113

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 67/176 (38%), Gaps = 29/176 (16%)

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNI---SKLSCK 527
           QI   ++  + PG  + V+G  G G +T    LL+    NS    I   +I   + LS  
Sbjct: 184 QILKPMDGCLNPGELLVVLGRPGSGCTT----LLKSISSNSHGFKIAKDSIVSYNGLSSS 239

Query: 528 SLRR-----------------HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
            +R+                 HL V Q    +       N   G++ E   + +  VA  
Sbjct: 240 DIRKHYRGEVVYNAESDIHLPHLTVYQTLFTVARMKTPQNRIKGVDREAYANHVTEVAMA 299

Query: 571 CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
            +          G + V G     +SGG+++R++IA   I   +    D AT  LD
Sbjct: 300 TYGLSHTRDTKVGNDLVRG-----VSGGERKRVSIAEVAICGARFQCWDNATRGLD 350

>KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1020

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 120/266 (45%), Gaps = 39/266 (14%)

Query: 455 IKFEDVSFSYPTRPGN-QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--S 511
           + FED+S+S  +      + N ++ ++ PG  + ++G SG GK+T+  +L         S
Sbjct: 367 LTFEDISYSITSNKKEINLLNGISGSVRPGEIMALMGGSGAGKTTLLDILAMKEKAGKVS 426

Query: 512 GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571
           G I ++G+ ++K   ++L   +G V QE  L+     Y     +NS +    +R   K  
Sbjct: 427 GLIKVNGKGVTK---QNLAEIIGFVDQEDFLLPTLTVYETV--LNSAL----LRLPRK-- 475

Query: 572 FCHGFITKFPEGYETV---------------IGPRGASLSGGQKQRIAIARALIKKPKIL 616
               F  K    Y+ +                  RG  +SGG+K+R++IA  L+  P IL
Sbjct: 476 --MSFTAKQKRVYQVLEELRIIDIKDRIIGDDFDRG--ISGGEKRRVSIACELVTSPSIL 531

Query: 617 ILDEATSALDVESEGAINYTLGRL-MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVE 675
            LDE TS LD  +   +   L RL +      ++SI    S I +S + +VL + G +V 
Sbjct: 532 FLDEPTSGLDSNNANNVIECLVRLALHYNRTLVLSIHQPRSNIFKSFDKLVLLSQGEMVF 591

Query: 676 MGKFKELYANDQSELFKLLNDKKPTQ 701
            G      A D SE  +  N   P+ 
Sbjct: 592 SGA-----ATDVSEFLRNNNYNCPSD 612

>KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} similar to
            uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2 ABC
            transporter
          Length = 1483

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 126/271 (46%), Gaps = 36/271 (13%)

Query: 434  TDHTSQIKPSSGKPYVP-------SWGEIKFEDVSFSYPTRPGNQIF-NKLNFTIEPGSN 485
            TD  ++   SS +   P       S G   ++D+ ++ P + G ++  + ++  ++PG+ 
Sbjct: 809  TDSITKTTDSSSRSDDPALFADMRSEGIFLWKDICYTIPYKGGERLLLDNVSGYVKPGTL 868

Query: 486  VCVVGPSGRGKSTIASLLLRYYDPN--SGRIMIDGQNISKLSCKSLRRHLGVVQQ----- 538
              ++G SG GK+T+ + L +  D    +G ++++G+ I      S  R  G VQQ     
Sbjct: 869  TALMGESGAGKTTLLNTLAQRTDIGVVTGDMLVNGKPID----ASFERRTGYVQQQDVHI 924

Query: 539  ------EPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRG 592
                  E +  S  +R  LT  +  E  +D +  V +       I       E ++G  G
Sbjct: 925  KEMTVRESLQFSARMRRPLT--VPDEEKLDYVEKVIE-------ILDMSAYGEALVGNIG 975

Query: 593  ASLSGGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRLMRSRELTIISI 651
              L+  Q+++++IA  L+ KP +L+ LDE TS LD +S  AI   L +L  + +  + +I
Sbjct: 976  YGLNVEQRKKLSIAVELVAKPNLLLFLDEPTSGLDSQSAWAIVQLLKKLAGAGQSILCTI 1035

Query: 652  AHRLSTI-RRSENVIVLGNDGSVVEMGKFKE 681
                +T+    + +++L   G  V  G   E
Sbjct: 1036 HQPSATLFEEFDRLLLLRKGGQTVYFGDIGE 1066

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 117/238 (49%), Gaps = 16/238 (6%)

Query: 453  GEIKFEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL-RYYDPN 510
            G   ++DV ++ P   G + + + ++   +PG+   ++G SG GK+T+ + L  R     
Sbjct: 862  GVFIWKDVCYTIPYDGGQRMLLDHVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGII 921

Query: 511  SGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSG-SIRYNLTYGMN----SEVTMDEIR 565
            +G ++++G  I      S  R  G VQQ+ + +S  ++R +L +         VT  E  
Sbjct: 922  TGDMLVNGHPID----TSFERRTGYVQQQDIHISELTVRESLQFSARMRRPQSVTDKEKM 977

Query: 566  SVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATSA 624
            +  +K      +    +  E ++G  G+ L+  Q+++++I   L+ KP +L+ LDE TS 
Sbjct: 978  TYVEKII---HVLDMEDYAEALVGTVGSGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSG 1034

Query: 625  LDVESEGAINYTLGRLMRSRELTIISIAHRLSTI-RRSENVIVLGNDGSVVEMGKFKE 681
            LD +S  AI   L +L  S +  + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1035 LDSQSSWAIVQLLKKLAHSGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGNIGE 1092

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 120/254 (47%), Gaps = 45/254 (17%)

Query: 455 IKFEDVSFSYPTRPGNQ----IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL--RYYD 508
           + FE++S++ P+   N     I   ++  ++PG  + ++G SG GK+T+  +L   R   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 509 PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRY-------------NLTYGM 555
             SG I I+G+N+S+   + + + +G V Q+  L      Y             ++T+  
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 556 NSE---VTMDEIRSVAKKCFCHGFITKFPEGYETVIGP---RGASLSGGQKQRIAIARAL 609
             +     ++E+R    K              + +IG    RG  +SGG+K+R++IA  L
Sbjct: 550 KQQRVFQVLEELRIYNIK--------------DRLIGDDFERG--ISGGEKRRVSIACEL 593

Query: 610 IKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAHR-LSTIRRSENVIVLG 668
           +  P IL LDE TS LD  +   +   L RL ++   T++   H+  S I    + +VL 
Sbjct: 594 VTSPLILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLL 653

Query: 669 NDGSVVEMGKFKEL 682
           + G +V  G+ + +
Sbjct: 654 SSGEMVYSGEIRRV 667

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 99/209 (47%), Gaps = 31/209 (14%)

Query: 475 KLNFTIEPGSNVCVVGPSGRGKSTIASLLLR---YYDPNSGRIMIDGQNISKLSCKSLRR 531
           KL F    GS++ ++GP+G GKS+I  ++      Y+ N G + I  +N           
Sbjct: 630 KLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN----------- 677

Query: 532 HLGVVQQEPML-MSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH-------GFITKFPEG 583
           ++  + Q+P     G++R  + Y M+S+   D  R    K            ++ K   G
Sbjct: 678 NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFD--RGFRDKELVQILVEVKLDYLLKRGVG 735

Query: 584 --YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
             Y   I      LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y    L 
Sbjct: 736 LTYLDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFNLLK 792

Query: 642 RSRELTIISIAHRLSTIRRSENVIVLGND 670
           R R    ISI+ R + I+  E ++ +G +
Sbjct: 793 RYR-FNFISISQRPTLIKYHEMLLEIGEN 820

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 126/266 (47%), Gaps = 25/266 (9%)

Query: 429  RLFEMTDHTSQIKPSSG---KPYVPSWGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSN 485
            +L E +D  S    S+G      +  W  + + DV     TR   +I N ++  ++PG+ 
Sbjct: 829  QLLEDSDEGSSNGDSTGLVKSEAIFHWRNLCY-DVQIKDETR---RILNNVDGWVKPGTL 884

Query: 486  VCVVGPSGRGKSTIASLLLRYYDPN--SGRIMIDGQNISKLSCKSLRRHLGVVQQEPM-L 542
              ++G SG GK+T+   L         +G +++DG+       +S  R +G  QQ+ + L
Sbjct: 885  TALMGSSGAGKTTLLDCLAERVTMGVITGDVLVDGRPRD----ESFPRSIGYCQQQDLHL 940

Query: 543  MSGSIRYNLTYG----MNSEVTMDEIRSVAKKCFCHGFITKFPEGYETVIGPRGASLSGG 598
             + ++R +L +       +EV+++E  +  ++      I +  +  + V+G  G  L+  
Sbjct: 941  KTSTVRESLRFSAYLRQPAEVSVEEKDAYVEEVIK---ILEMEKYADAVVGVAGEGLNVE 997

Query: 599  QKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRLMRSRELTIISIAHRLST 657
            Q++R+ I   L  KPK+L+ LDE TS LD ++  +I   L R + S    I+   H+ S 
Sbjct: 998  QRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSIC-QLMRKLASHGQAILCTIHQPSA 1056

Query: 658  IRRSE--NVIVLGNDGSVVEMGKFKE 681
            I   E   ++ L   G  V  G+  E
Sbjct: 1057 ILMQEFDRLLFLQKGGKTVYFGELGE 1082

>KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 607

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 106/231 (45%), Gaps = 34/231 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+D+SF+Y  +  N ++  LNF ++  S V +VGP+G GKST+  ++       SGR+
Sbjct: 390 LAFDDISFAYDGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRV 449

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         +  L      E   D+   +++   + 
Sbjct: 450 -----------SRHTHVKLGVYSQHSQEQLDLNKSPL------EFVRDKFPHISQDFQYW 492

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVES- 629
            G + ++    EG  + +G    +LS GQ+ R+  A   ++ P +L+LDE T+ LD+ + 
Sbjct: 493 RGQLGRYGLTGEGQTSQMG----TLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDIATI 548

Query: 630 ----EGAINYTLGRLMRSRELTIIS-IAHRLSTIRRSENVIVLGNDGSVVE 675
               E   ++  G ++ S +  ++  IA  +  +   EN      DGS+++
Sbjct: 549 DSLAEAINDFNGGVVVVSHDFRLLDKIAKDIFVV---ENKTATRWDGSILD 596

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 588 IGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT 647
           I  +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T
Sbjct: 217 IKKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----T 272

Query: 648 IISIAH 653
           ++ ++H
Sbjct: 273 LVLVSH 278

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 117/240 (48%), Gaps = 22/240 (9%)

Query: 452  WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN- 510
            W ++ + DV     TR   +I N ++  ++PG+   ++G SG GK+T+   L        
Sbjct: 871  WRDLCY-DVQIKDETR---RILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGV 926

Query: 511  -SGRIMIDGQNISKLSCKSLRRHLGVVQQEPM-LMSGSIRYNLTYG----MNSEVTMDEI 564
             +G I +DG   +    +S  R +G  QQ+ + L + ++R +L +        EV+++E 
Sbjct: 927  ITGDIFVDGLPRN----ESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPKEVSVEEK 982

Query: 565  RSVAKKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATS 623
             +  ++      I +  +  + ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS
Sbjct: 983  NAYVEEIIK---ILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTS 1039

Query: 624  ALDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSE--NVIVLGNDGSVVEMGKFKE 681
             LD ++  AI   + +L +  +  + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1040 GLDSQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 95/233 (40%), Gaps = 45/233 (19%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           I+ +DVSF Y  +  + +   +N  ++  S + +VG +G GK+T+  +++    P SG +
Sbjct: 532 IQLQDVSFGYEEQ--SLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH 574
             +G                             R  + Y     V   ++ + A      
Sbjct: 590 SRNG-----------------------------RLRIGYFTQHHVDSMDLNTSAVDWMSK 620

Query: 575 GFITKFPEGYETVIGPRGAS----------LSGGQKQRIAIARALIKKPKILILDEATSA 624
            +  K  E Y   +G  G +          LSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 625 LDVESEGAINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMG 677
           LD     A+   L +        ++ ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGG----VLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (66%), Gaps = 4/60 (6%)

Query: 594 SLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIISIAH 653
           S SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T+++++H
Sbjct: 367 SFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 86/177 (48%), Gaps = 25/177 (14%)

Query: 455 IKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRI 514
           + F+ +SFSY   P + ++  L+F ++  S + +VGP+G GKST+  ++     P SGR+
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 515 MIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC-FC 573
                       +     LGV  Q         + +LT     E   D+  ++++   + 
Sbjct: 452 -----------SRHTHVKLGVYSQH-----SQDQLDLTKSA-LEFVRDKYPNISQDFQYW 494

Query: 574 HGFITKF---PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDV 627
            G + ++    EG    +G    +LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 495 RGQLGRYGLTGEGQTVQMG----TLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 547

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 591 RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELTIIS 650
           +   +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +   L R  R    T++ 
Sbjct: 222 KTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDR----TLVL 277

Query: 651 IAH 653
           ++H
Sbjct: 278 VSH 280

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 142/342 (41%), Gaps = 51/342 (14%)

Query: 428 SRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDVSFSYP---------------TRPGNQI 472
           SRL + +D    ++     PY     E+  +D++ +                  R   +I
Sbjct: 640 SRLIQNSDKDIDLESKDSHPYEV---EVSLKDITLTVDYIHVQGISQWRNKIINRERKKI 696

Query: 473 FNKLNFTIEPGSNVCVVGPSGRGKSTI---------ASLLLRYYDPNSGRIMIDGQNISK 523
              +N T +PG    ++GPSG GKST+         ++L  R+     G +  +G  +S+
Sbjct: 697 LRSVNATFKPGMVNAIMGPSGSGKSTLLNLISGRVKSTLFSRF--TKDGSMSFNGAEVSE 754

Query: 524 LSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF--P 581
              K +  +  V Q +  L+S  +    T+   S++ +  + +  ++   +  I      
Sbjct: 755 TMFKQICSY--VSQDDDHLLS-KLTVRETFKFASDLRLHHLNAKEREAKRNNLIIALGLK 811

Query: 582 EGYETVIGPRGAS-LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640
              +T+IG      +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I   L  L
Sbjct: 812 HCEDTIIGNEFVKGISGGEKRRVTMGIQLLNDPPILLLDEPTSGLDSFTSSTILEILSNL 871

Query: 641 MRSRELTIISIAH--RLSTIRRSENVIVLGN------DGSVVEMGKFKELYANDQSELFK 692
            +    T+I   H  R    ++  NV++L        +GS  EM  + E       EL  
Sbjct: 872 CQEYGKTVILTIHQPRAELFKKFGNVLLLAKSGRTAFNGSPDEMIMYFEKLGFKCPELTN 931

Query: 693 LLN--------DKKPTQLQSQSRNSVETKENEVDDQVLEQVA 726
           + +        + +  Q +S SR  VE      +DQV  Q A
Sbjct: 932 VADYFLDLISINTQNEQNESTSRERVEKLLANWEDQVQLQHA 973

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 6/94 (6%)

Query: 585 ETVIGP---RGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
           +T+IG    RG  LSGG+K+R++I   +I  P I+ LDE T+ LD  S   +  T+ +L 
Sbjct: 153 DTIIGDSSHRG--LSGGEKRRLSIGTQMIANPSIMFLDEPTTGLDAYSAYLVVKTIRKLA 210

Query: 642 RSR-ELTIISIAHRLSTIRRSENVIVLGNDGSVV 674
                + I+SI    S I    + + + + G++V
Sbjct: 211 EDDGRIFIMSIHQPRSDIMFLLDKVCILSKGNIV 244

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 114/251 (45%), Gaps = 49/251 (19%)

Query: 455 IKFEDVSFSYP----TRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLL--RYYD 508
           + FE++S+  P    ++   ++ N +   ++PG  + ++G SG GK+T+  +L   R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 509 PNSGRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEV--------- 559
              G I ++G +I     K   + +G V Q+  L+     Y     +NS +         
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETV--LNSALLRLPRSMPF 510

Query: 560 ---------TMDEIRSVAKKCFCHGFITKFPEGYETVIG---PRGASLSGGQKQRIAIAR 607
                     ++E+R +  K              + +IG    RG  +SGG+K+R++IA 
Sbjct: 511 TAKRKRVNRVLEELRIMDIK--------------DRIIGNDFERG--ISGGEKRRVSIAC 554

Query: 608 ALIKKPKILILDEATSALDVESEGAINYTLGRLMRSRELT-IISIAHRLSTIRRSENVIV 666
            L+  P IL LDE TS LD  +   +   L RL ++   T ++SI    S I    + +V
Sbjct: 555 ELVTSPAILFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLV 614

Query: 667 LGNDGSVVEMG 677
           L +DG ++  G
Sbjct: 615 LLSDGEMIYSG 625

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 99/209 (47%), Gaps = 31/209 (14%)

Query: 475 KLNFTIEPGSNVCVVGPSGRGKSTIASLLLR---YYDPNSGRIMIDGQNISKLSCKSLRR 531
           KL F    GS++ ++GP+G GKS+I  ++      Y+ N G + I  +N           
Sbjct: 630 KLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN----------- 677

Query: 532 HLGVVQQEPML-MSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCH-------GFITKFPEG 583
           ++  + Q+P     G++R  + Y M+S+   D  R    K            ++ K   G
Sbjct: 678 NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILVEVKLDYLLKRAVG 735

Query: 584 --YETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 641
             Y   +      LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y    L 
Sbjct: 736 LTYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFNLLK 792

Query: 642 RSRELTIISIAHRLSTIRRSENVIVLGND 670
           R R    ISI+ R + I+  E ++ +G +
Sbjct: 793 RYR-FNFISISQRPTLIKYHEMLLEIGEN 820

>Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR406W
            (REAL)
          Length = 1533

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 113/236 (47%), Gaps = 19/236 (8%)

Query: 457  FEDVSFSYPTRPGNQ-IFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPN--SGR 513
            + D+ +  P + G + I N ++  ++PG+   ++G SG GK+T+   L         +G 
Sbjct: 890  WRDLCYDVPVKGGQRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGN 949

Query: 514  IMIDGQNISKLSCKSLRRHLGVVQQEPM-LMSGSIRYNLTYG----MNSEVTMDEIRSVA 568
            I +DG    +L  +S  R +G  QQ+ + L + ++R +L +       S V+++E     
Sbjct: 950  IFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNKYV 1005

Query: 569  KKCFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILI-LDEATSALDV 627
            ++      I +  +  + V+G  G  L+  Q++R+ I   L  +PK+L+ LDE TS LD 
Sbjct: 1006 EEVIK---ILEMEKYSDAVVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDS 1062

Query: 628  ESEGAINYTLGRLMRSRELTIISIAHRLSTI--RRSENVIVLGNDGSVVEMGKFKE 681
            ++       L R + +    I+   H+ S I  ++ + ++ +   G  V  G   E
Sbjct: 1063 QTAWDTC-QLMRKLATHGQAILCTIHQPSAILMQQFDRLLFMQRGGQTVYFGDLGE 1117

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 67/176 (38%), Gaps = 29/176 (16%)

Query: 471 QIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQNI---SKLSCK 527
           QI   ++  + PG  + V+G  G G +T    LL+    NS    I   +I   S LS  
Sbjct: 188 QILKPMDGCLYPGELLVVLGRPGSGCTT----LLKSISSNSHGFKIAKDSIISYSGLSSS 243

Query: 528 SLRR-----------------HLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKK 570
            +++                 HL V Q    +       N   G++ E   + +  VA  
Sbjct: 244 EIKKHYRGEVVYNAESDIHLPHLTVYQTLFTVARMKTPQNRIKGVDRESYANHVTEVAMA 303

Query: 571 CFCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALD 626
            +          G + V G     +SGG+++R++IA   I   +    D AT  LD
Sbjct: 304 TYGLSHTRDTKVGNDLVRG-----VSGG