Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11594g6.7ON1006100644780.0
Kwal_56.223346.7ON1008101027150.0
SAKL0E00770g6.7ON1047105320540.0
Ecym_30096.7ON1027103317770.0
ACR020C6.7ON1002102216910.0
KLLA0D00792g6.7ON1020104116370.0
Skud_5.346.7ON1019104915580.0
Smik_5.326.7ON1020105315150.0
KAFR0L003306.7ON1028104814960.0
ZYRO0F00440g6.7ON1039107414950.0
Suva_5.136.7ON1023105214880.0
YEL055C (POL5)6.7ON1022105914780.0
TDEL0G046406.7ON1017105214670.0
CAGL0B03553g6.7ON1021105114630.0
NCAS0F001806.7ON1018106314440.0
KNAG0E009706.7ON1004104814161e-179
TBLA0A072106.7ON1041106212601e-156
Kpol_1045.806.7ON101971210971e-132
NDAI0K029106.7ON106375010801e-129
TPHA0J002506.7ON102471810541e-126
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11594g
         (1006 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...  1729   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...  1050   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   795   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   689   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   655   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   635   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   604   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   588   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   580   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   580   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   577   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   573   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   569   0.0  
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   568   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   560   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   550   e-179
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   489   e-156
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   427   e-132
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   420   e-129
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   410   e-126

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score = 1729 bits (4478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/1006 (87%), Positives = 879/1006 (87%)

Query: 1    MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNG 60
            MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNG
Sbjct: 1    MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNG 60

Query: 61   ARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQV 120
            ARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQV
Sbjct: 61   ARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQV 120

Query: 121  LLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGS 180
            LLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGS
Sbjct: 121  LLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGS 180

Query: 181  QKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDP 240
            QKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDP
Sbjct: 181  QKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDP 240

Query: 241  LSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDXXXXXXX 300
            LSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYED       
Sbjct: 241  LSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDKASEPAK 300

Query: 301  XXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHTL 360
                      HQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHTL
Sbjct: 301  KKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHTL 360

Query: 361  LSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISFD 420
            LSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISFD
Sbjct: 361  LSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISFD 420

Query: 421  QXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKSA 480
            Q                 DQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKSA
Sbjct: 421  QLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKSA 480

Query: 481  ADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADYKSE 540
            ADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADYKSE
Sbjct: 481  ADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADYKSE 540

Query: 541  KVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQ 600
            KVCWPRFTVEILMS         PMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQ
Sbjct: 541  KVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQ 600

Query: 601  LIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEIXXXXXXXXXXXXXXX 660
            LIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEI               
Sbjct: 601  LIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEILLSLAAQKKALLRKA 660

Query: 661  XXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGA 720
               VWELFVGEASQDDIAVLLEILPARENKEGFSKLF                LFAEEGA
Sbjct: 661  SLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLFEGDDEGGSDEEEISDELFAEEGA 720

Query: 721  SGDNTEEEESGPDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXXXXX 780
            SGDNTEEEESGPDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHF        
Sbjct: 721  SGDNTEEEESGPDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFEDLEDTED 780

Query: 781  XXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVD 840
                             GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVD
Sbjct: 781  EEISDEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVD 840

Query: 841  MLEIFVRWAESELKQGGRPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXX 900
            MLEIFVRWAESELKQGGRPEKSVTSK          CVRTTLDKPLAEKV          
Sbjct: 841  MLEIFVRWAESELKQGGRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICK 900

Query: 901  XXXXXDTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSP 960
                 DTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSP
Sbjct: 901  LKITTDTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSP 960

Query: 961  RPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006
            RPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD
Sbjct: 961  RPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/1010 (54%), Positives = 681/1010 (67%), Gaps = 10/1010 (0%)

Query: 1    MVAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNG 60
            M   E++RDLFYKLASDLSEERLQA I LVTQLSK+EK+S EW+YVL+RLIKGLSSSRNG
Sbjct: 1    MGGIEINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSSEWQYVLDRLIKGLSSSRNG 60

Query: 61   ARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQV 120
            ARLG+ LCLTEVVA ALEK VLA  D+Y+ LL+S LS+EN+KNGKEERG+LFGKLFGLQV
Sbjct: 61   ARLGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQV 120

Query: 121  LLNEPLFSQVFKA-EDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMG 179
            LLNEPLFS+VF   E+++N+E M +Y+  LID+ALAKTWIRESS+FTL+QA+EKL+P++G
Sbjct: 121  LLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLG 180

Query: 180  SQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNND 239
            S++PLKA+L LLDS+GLTQTSEGLA+YL+L H+   T   LRKKG L++L L +PWKNND
Sbjct: 181  SRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNND 240

Query: 240  PLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDXXXXXX 299
            PL +GNLPAI+NALK+  + +D S+ QKG+W PRLHF WDI+L +       E       
Sbjct: 241  PLKRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVLQTLLHAENSEITTMQPP 300

Query: 300  XXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHT 359
                          IKFPEFWKSVVDESFFNEKSSSERKYLG LVFEK F L+P  Y   
Sbjct: 301  SKKRKKEEKEAF--IKFPEFWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSPPRYLPQ 358

Query: 360  LLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISF 419
            L SKNL RCLINQCGS+ERNLHK+SQ+ L TIV+VCK QPEKTAPSF  L+  E+G+I+F
Sbjct: 359  LFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGEYGTINF 418

Query: 420  DQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKS 479
            D                     L +L E L ++LF +L++ SR RF+LDA+LHLVRAHK+
Sbjct: 419  DHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHLVRAHKA 478

Query: 480  AADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADYKS 539
             AD+VWL P+L +LV  GFF+  E     +  +   ++S +A ERL+SILADL++ +  +
Sbjct: 479  HADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLLTVEQDT 538

Query: 540  EKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGF 599
              VCWP   V++L +          MDEEL +IL+SS+    +I  +A +     Q +G 
Sbjct: 539  YSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEANLS-QFQGL 597

Query: 600  QLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN-KSGSYAGFIEIXXXXXXXXXXXXX 658
            QL+FSVNILQAY+GE +SI VL+DL SF    E+  KS   AGFIEI             
Sbjct: 598  QLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLSLAAQKKALSR 657

Query: 659  XXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF---XXXXXXXXXXXXXXXXLF 715
                  WE FV + ++ D+ VLL +LP RENKEGFS LF                     
Sbjct: 658  KSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEGGSESEGDSEEDEEMNDEEE 717

Query: 716  AEEGASGDNTEEEESG-PDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXX 774
             E+ AS D  EE ++   + D    +D  +IDKEATSAL KALNLP+SIV+D GEV F  
Sbjct: 718  PEKDASDDEIEESDNNVSEDDSSSDDDMGKIDKEATSALAKALNLPDSIVDDKGEVRFED 777

Query: 775  XXXXXXXXXXXXXXXXXXXXXXX-GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA 833
                                    GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA
Sbjct: 778  LGDTDEEEEESEEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIA 837

Query: 834  FKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXX 893
            FKHRVVDMLEI VRW ES++K+ G  EKSV  K          C+RTTLDKPLAEK+   
Sbjct: 838  FKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKL 897

Query: 894  XXXXXXXXXXXXDTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAK 953
                         ++ + +++    + L+SVHEAML+KK GQFQ LYFS CST SMFLA+
Sbjct: 898  LKNKICKLKPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLAR 957

Query: 954  LFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQ 1003
            L V   P  ETY  LT +YHKTL+ WFV GKF  ++F+EFLNWLS+KK Q
Sbjct: 958  LVVDTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQ 1007

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1053 (42%), Positives = 612/1053 (58%), Gaps = 56/1053 (5%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKESREWEYVLNRLIKGLSSSRNGA 61
            +  +++RDLFYKLASDL EER+QA I L+ +L+ +E    EWEYVLNRLIKGLSS+RN A
Sbjct: 1    MVEKINRDLFYKLASDLQEERVQAAISLIKELASLENNDSEWEYVLNRLIKGLSSNRNSA 60

Query: 62   RLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQVL 121
            RLG+ LCLTEV++ ALEK  L   +EY++LL STL +E +KNGKEERG+LFG++FGLQ L
Sbjct: 61   RLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQAL 120

Query: 122  LNEPLFSQVF-KAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGS 180
            LNEPL S++F      +N  FM+ ++G L+ VAL+KTWIRE  +FTL+Q +EKLSP +  
Sbjct: 121  LNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFLND 180

Query: 181  QKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDP 240
               ++++  LLD   L+ T+EGLA+YL+L H    T+  ++K GLL++L+LNS WKNNDP
Sbjct: 181  TVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNNDP 240

Query: 241  LSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDXXXXXXX 300
            L+KGNLP ++  LK+++  ED  +KQKG W PRLHFVW+IIL       + E        
Sbjct: 241  LTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEHIT 300

Query: 301  XXXXXXXXXXHQ--QIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTH 358
                       Q   I+FPEFWK+VVDESFFNEKSS ERKYLGFL+ E AF   P+S   
Sbjct: 301  KKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVPLSLVS 360

Query: 359  TLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSIS 418
             L SKNL R LINQ   S+R LHK+SQ+VL +I+++C++ P+KT PS + +   E+G+I+
Sbjct: 361  LLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSENGTIN 420

Query: 419  FDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRV-RFLLDAMLHLVRAH 477
            FD+                  + L+ L ++  +HL     + + + RFLLD+MLH+VR H
Sbjct: 421  FDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLHVVRTH 480

Query: 478  KSAADKVWLAPLLDSLVQQGFFELD--ENDRQPEVGDETFTVSKLAVERLYSILADLISA 535
            K+ +DK W+ PL+ S++  GFF+    + D++ +  D T      A ERLYSILADLI  
Sbjct: 481  KTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILADLIPL 540

Query: 536  DYKS-EKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKTFKTICSEAEKGGKQM 594
              +S     WP  T+++L+S         P+D+ L +I   ++   + I  E E      
Sbjct: 541  SKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELENDPSAS 600

Query: 595  QARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEE-NKSGSYAGFIEIXXXXXXXX 653
            Q  G +L+ S+ +LQ Y G+T+S+ VL+DL +F+ ++ + ++  S  G IEI        
Sbjct: 601  QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILLALLAQK 660

Query: 654  XXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLFXXXXXXXXXXXXXXXX 713
                      VWELFV +    ++ VL +IL ARENKEGF+ LF                
Sbjct: 661  KALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTALFEAEDDYMDEEDDEEAS 720

Query: 714  LFAEEGASGDNTEE--------------------------------EESGPDSDDQDGED 741
                +G  G+N  +                                 +   + +D   ED
Sbjct: 721  --QAQGEEGENASDTVNSGEEEEEEEEEEEEEEEEEEEGEEEEEEEGDDQSEDNDYSNED 778

Query: 742  TEQIDKEATSALVKALNLPESIVNDNGEVHFX-----XXXXXXXXXXXXXXXXXXXXXXX 796
              +IDKE TSAL KALNLP+ I+N+NGEV+F                             
Sbjct: 779  INKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMEL 838

Query: 797  XGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAE--SELK 854
              QLS+IF+RRKEALSKI TGNKRK E KESRENVIAFKH+VVDMLE+FV++ E  S+ K
Sbjct: 839  DDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERTSKNK 898

Query: 855  QGGRPE-KSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXX-XXDTSLDGL 912
            + G  E KSVTS           CV+ T DK LA+K+                    D +
Sbjct: 899  ECGETELKSVTS----MFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDI 954

Query: 913  EENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVY 972
            EE    N L +VH  ML  KCGQF NLYFS CS  S+FL+KL V  S     Y  L ++Y
Sbjct: 955  EELTISN-LGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIY 1013

Query: 973  HKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNS 1005
              T+ +WF  GKF  + F +F+NWL+ KKQ +S
Sbjct: 1014 LSTMKKWFSKGKFGTSFFFDFINWLASKKQTSS 1046

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1033 (38%), Positives = 579/1033 (56%), Gaps = 41/1033 (3%)

Query: 5    EVDRDLFYKLASDLSEERLQAIIGLVTQLSKV--EKESREWEYVLNRLIKGLSSSRNGAR 62
            +V+RDLFY+LASD+ EER++A +G+V +LS++  +   +EW+YVL RLIKGL+S+R GAR
Sbjct: 3    QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 63   LGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQVLL 122
            LG+ +CL+EVV   LEK  L   + Y+  L   L+  ++KNGKEERG++FGKLFGLQ LL
Sbjct: 63   LGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQALL 122

Query: 123  NEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVMGSQK 182
            NEPLF ++F     I+L+F + ++  L+ +AL+KTW+RE  +FTLYQ IEKLS       
Sbjct: 123  NEPLFGRIFMDGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTEVG 182

Query: 183  PLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNNDPLS 242
             L+A+  LLD   LT T+EGLA+YL L ++   T   L K  +L  + L S WKNNDPLS
Sbjct: 183  HLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITLRSCWKNNDPLS 242

Query: 243  KGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEY---EDXXXXXX 299
            KGN+  +++ LK+I   ED  +KQKG W PRLHFVWDI++       E     +      
Sbjct: 243  KGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPKKR 302

Query: 300  XXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSYTHT 359
                          + F EFW+ VVDESFFN K+SSERKYLG L+ EKA    P SY  +
Sbjct: 303  KTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYVPS 362

Query: 360  LLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGSISF 419
            + SKN+ R LINQ   S RNLHK+S  VL  IV +C++ P K  P   +L    +GSI+F
Sbjct: 363  IFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSINF 422

Query: 420  DQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRAHKS 479
            D                   + L  L  ++ + +       S+VR+LLD +LH+V+AHK 
Sbjct: 423  DILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAHKL 482

Query: 480  AADKVWLAPLLDSLVQQGF-------FELDENDRQPEVGDETFTVSKLAVERLYSILADL 532
             AD  W  PLL S+V+  F       FE  + D   +   E+  +  L+ ERL+SIL  L
Sbjct: 483  KADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADADAESKKIPVLSRERLFSILGQL 542

Query: 533  ISADYKS-EKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKTFKTICSEAEKGG 591
            I    ++ +   WP  T++I+++          +DEEL +    ++K    I  ++++  
Sbjct: 543  IPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQESP 602

Query: 592  KQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEIXXXXXX 651
            +  +  G +L+  V ILQ YSG+ +S  +L++L +F+++++   +G   G  EI      
Sbjct: 603  QASELCGLELLLGVTILQMYSGDAESASILEELTTFYKSIDTKPNG-LVGITEILLSMVA 661

Query: 652  XXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLFXXXXXXXXXXXXXX 711
                        VWE  + +   D++ +L +IL  RENK+GF+ LF              
Sbjct: 662  QKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALF---EAADEYVEVDD 718

Query: 712  XXLFAEEGASGDNTEE------------EESGPDSDDQD----GEDTEQIDKEATSALVK 755
              +  +   S +N +             EE G + +D       E  ++I+KE TSAL  
Sbjct: 719  DEINEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSGNNGYNEYIDKINKETTSALAD 778

Query: 756  ALNLPESIVNDNGEVHFXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIP 815
            AL LPE+++++NG+V F                         GQLSEIFKRRKEALSK+P
Sbjct: 779  ALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMMELDGQLSEIFKRRKEALSKVP 838

Query: 816  TGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKXXXXXXXX- 874
            TGNKRK EV+ESRE+VI+FKHRV+DMLEI+ ++    ++  G+ ++   SK         
Sbjct: 839  TGNKRKLEVRESRESVISFKHRVLDMLEIYCKYV---VRLAGKSQQCEASKLLNIHSMID 895

Query: 875  --XXCVRTTLDKPLAEKVXXXXXXXXXXXXXXX-DTSLDGLEENLFENSLKSVHEAMLLK 931
                C++ T+D+PLAEK                    +D + E +F  SL+++H +ML K
Sbjct: 896  PLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIVFL-SLENIHNSMLAK 954

Query: 932  KCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFI 991
            K GQFQ LYF ACST+S+FL K+ V   P   TY  + ++Y +++  W V GKF  N FI
Sbjct: 955  KPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFI 1014

Query: 992  EFLNWLSIKKQQN 1004
            +F+NWL+ K+ +N
Sbjct: 1015 DFINWLASKRSKN 1027

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1022 (38%), Positives = 562/1022 (54%), Gaps = 39/1022 (3%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSK--VEKESREWEYVLNRLIKGLSSSRN 59
            +A +V+RDLFYKL SDLS+ER+Q+ I L+T+L++  VE+  +EWEYVL RL++GL+SS  
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 60   GARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQ 119
             ARLG+ LCLTEV A+ALE   +  A+EYL  L + L  + +KNGKEERG LFG++FGLQ
Sbjct: 61   SARLGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKVKNGKEERGQLFGRMFGLQ 120

Query: 120  VLLNEPLFSQVFKAED-EINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVM 178
             +LNEPLFS+VF A D +I   F   ++  L+ +AL K W+R+  +FTLYQ IE+L+P  
Sbjct: 121  AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180

Query: 179  GSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNN 238
               + L+A+LTLLD   LT TSEGLA+YL+L +K       L +  + + L L   WK +
Sbjct: 181  TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240

Query: 239  DPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDXXXXX 298
            +PL+KGN  A+A+ LK+    E    KQKG+W PRLHFVWD++L    E     D     
Sbjct: 241  NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHI 300

Query: 299  XXXXXXXXXXXXHQ--QIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSY 356
                         +   + F EFW+ VVDESFF+EK+SSERKYLG L+ EKA    P S 
Sbjct: 301  AKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSL 360

Query: 357  THTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGS 416
               + SKN  R LINQ   + R+LHK+S   L TIV  C+    K  P    +    +G+
Sbjct: 361  VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGT 420

Query: 417  ISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRA 476
            I+FD+                   +L  L  +L   L     D S+++F+LD +LH++RA
Sbjct: 421  INFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISKIKFILDTLLHVIRA 480

Query: 477  HKSAADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLIS-A 535
            HK  A   W  PLL +LV+  FF    +    E  +E  T+S+   ERL+S+L +LI  +
Sbjct: 481  HKWKAHLSWTNPLLLALVRYAFFSAPSH--LSEQSEEIITLSR---ERLFSVLGELIPLS 535

Query: 536  DYKSEKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKTFKTICSEAEKG-GKQM 594
             +      W   T+E+L+           +D EL  + ++++K  + I +++ K   +  
Sbjct: 536  KHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENP 595

Query: 595  QARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEIXXXXXXXXX 654
            Q  G +L+ SV+ILQ ++G+ DS   L++L SF+++  +       G  EI         
Sbjct: 596  QLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKK 655

Query: 655  XXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLFXXXXXXXXXXXXXXXXL 714
                     VWE F+ +  ++++ +LL  L ARENK GF++LF                 
Sbjct: 656  SMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADE------------ 703

Query: 715  FAEEGASGDNTEEEESG-----------PDSDDQDGEDTEQIDKEATSALVKALNLPESI 763
            + E G+    T+ E+              D +D   ED  +IDKEATSAL  AL LP++I
Sbjct: 704  YEELGSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKIDKEATSALAHALRLPDNI 763

Query: 764  VNDNGEVHFXXXXXXXXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQE 823
            ++++G V F                         GQLSEIFKRRK+AL+KIPTGN+RK E
Sbjct: 764  LDEDGNVGF---EEMDDEEEEEESMDDEAMMELDGQLSEIFKRRKDALNKIPTGNQRKIE 820

Query: 824  VKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKXXXXXXXXXXCVRTTLD 883
             KESR++VIAFKHRVVDMLEI+ +  E  + +  +   ++++            ++ TLD
Sbjct: 821  AKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLD 880

Query: 884  KPLAEKVXXXXXXXXXXXXXXXDTSLDG-LEENLFENSLKSVHEAMLLKKCGQFQNLYFS 942
            +PLAEK+                      + E     SL++VH  +L  K GQF  L+FS
Sbjct: 881  RPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFS 940

Query: 943  ACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQ 1002
            ACS+ S+FL+K+ +     P T   +  +Y  T+  W V GKF  N FI+F+NWL+ KK 
Sbjct: 941  ACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKS 1000

Query: 1003 QN 1004
            +N
Sbjct: 1001 KN 1002

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1041 (37%), Positives = 571/1041 (54%), Gaps = 69/1041 (6%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE-KES----REWEYVLNRLIKGLSS 56
            V + V+RDLF+K+AS+L +ERL+A I L+ ++S+V+ +ES    REWEYV+ RL+KGL+S
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 57   SRNGARLGYCLCLTEVVASALEK-SVLAHADEYLRLLLSTL-SRENIKNGKEERGILFGK 114
            +R GARLG+ +CLTEV+A ALE+  +L     +L  L  TL +    KNGKEERG+LFG+
Sbjct: 66   NRGGARLGFSMCLTEVIALALERRDILPSIYAFLNQLEQTLPAGTAFKNGKEERGVLFGQ 125

Query: 115  LFGLQVLLNEPLFSQVFKAEDE--INLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIE 172
            +F LQ LLNEP+FS++F + D+  IN+EF+LTY+  LI +AL+KTW+RE  ++++YQ I+
Sbjct: 126  MFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYSVYQTIQ 185

Query: 173  KL-SPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKL 231
            K  + +      +  +L LLD + LT T+EGL++YL    +    + +L        +  
Sbjct: 186  KCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDTYSSSL--------VIH 237

Query: 232  NSPWKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEY 291
            NS WKNNDPLSKGN+  +A+ LK++   E   +KQKG W PRLH+VWDI+L    + G +
Sbjct: 238  NSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGSF 297

Query: 292  ----EDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEK 347
                E                    +I+FP+FW++VVDESFFNEKSS+ERKYLGFL+ E+
Sbjct: 298  GQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILEE 357

Query: 348  AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFE 407
            A  +        LLS+NL RC+INQ   S+R L+K+S + L +IV  C+  P K  P  E
Sbjct: 358  AIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLVE 417

Query: 408  TLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLF--TSLRDH-SRVR 464
                  +GSI+FD+                  + L  L  +L + L    S +D  +  R
Sbjct: 418  VFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLTR 477

Query: 465  FLLDAMLHLVRAHKSAADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVER 524
            F+ D  LH+ RAHK+  +  W+ PLL ++++  FF   +N +          +S+LA ER
Sbjct: 478  FIFDTFLHITRAHKTRLESHWVKPLLSAIIKAAFFNESDNSK----------LSELAKER 527

Query: 525  LYSILADLISADYKS--EKVCWPRFTVEILMSXX-XXXXXXXPMDEELTEILNSSIKTFK 581
            LYSIL +LIS   KS  +   WP   ++I++            +DE+L  +  S+IK+ K
Sbjct: 528  LYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSLK 587

Query: 582  TICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAG 641
               S+  K     +  G +L+ SV ILQ Y+G+ +S+ +LQDL SF++  ++ +S    G
Sbjct: 588  QNHSD-NKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECDK-ESTDLVG 645

Query: 642  FIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF---- 697
              EI                  VWE FV +  + ++ VLL+ L ARENK+GF+ LF    
Sbjct: 646  ITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLFEGDE 705

Query: 698  ------XXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGEDTEQIDKEATS 751
                                     ++  S +++E++ S  D D       E+I+KEATS
Sbjct: 706  EEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAA----LEKIEKEATS 761

Query: 752  ALVKALNLPESIVNDNGEVHFXXXXXXXXXXXXXX---------XXXXXXXXXXXGQLSE 802
            AL KALNLP+SIV ++G+V                                     QLSE
Sbjct: 762  ALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLDDQLSE 821

Query: 803  IFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKS 862
            IFKRRKEAL  +PTGNKRK EV+ESRENVI+FKHRVVDMLEI+V+  +  + +      +
Sbjct: 822  IFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVARNNTSIIT 881

Query: 863  VT--SKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLDGLEENLFENS 920
            V   +           C++ TLDK LA+K                      +   +F + 
Sbjct: 882  VEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKEEKTVTSEIF-HL 940

Query: 921  LKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLNEWF 980
            L+ VH+ ++  K GQFQ L+FS CS AS+FL+KL++      E    L ++Y  T   W 
Sbjct: 941  LEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGSHE---NLIDLYADTSKAWM 997

Query: 981  VGGKFSANLFIEFLNWLSIKK 1001
              GK + N FI+F NWL  K+
Sbjct: 998  KDGKCTVNFFIDFSNWLQTKR 1018

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1049 (38%), Positives = 559/1049 (53%), Gaps = 76/1049 (7%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +  +V+RDLF+KLASDL EERL A + L+  LS +E   ++ EW YVLNRLIKGL+S RN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 60   GARLGYCLCLTEVV------ASALEKSVLAHADEYLRLLLSTL-------SRENIKNGKE 106
             ARLG+ LCLTEVV       S      L   +E+L  L S L       S++ +K GK+
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVK-GKD 119

Query: 107  ERGILFGKLFGLQVLLNEPLFSQVFKAEDEI---NLEFMLTYVGTLIDVALAKTWIRESS 163
            ERGILFGKLFGL+ LLNEPLFS++F   D+I   N EF++ ++  LID+AL K WIRE  
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSEIFV--DDIKKGNTEFVIRFMEQLIDLALRKNWIREPC 177

Query: 164  MFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKK 223
            +F+L+Q I+ L P M     +K LL + D   LT T+EGL+ YL L ++S     +L   
Sbjct: 178  LFSLFQTIKMLLPFMNESTAVKILL-IYDKYDLTLTNEGLSTYLVLKYES---DESLIPS 233

Query: 224  GLLEDLKLNSPWKNNDPLSKGNLPAIANALKEINSSEDL------SVKQKGI-WMPRLHF 276
             L  DL+ NS WKNNDPL++GNLP +   L++ +   D       + KQK   W PRLHF
Sbjct: 234  TL--DLR-NSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHF 290

Query: 277  VWDIILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSE 336
            VWD++L   F  G+ E+                    I+FPEFWK  VDESFFNEK+SSE
Sbjct: 291  VWDVLL-PLFGSGKLENTEHITKKRKKTSGKKV-QNSIQFPEFWKMAVDESFFNEKASSE 348

Query: 337  RKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCK 396
            RKYLGFL+ +  F   P S   +  S+N+ R LINQ   S+R L+K++Q  L +IV  C+
Sbjct: 349  RKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACE 408

Query: 397  NQP-EKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFT 455
              P +K  P    +    HGSI+FD+                    L  L       L  
Sbjct: 409  EDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQE 468

Query: 456  SLRDHSRVRFLLDAMLHLVRAHKSAADKV-WLAPLLDSLVQQGFFELDENDRQPEVGDET 514
               D     F+LD++LH++RAHK   + V  + P+L  ++   FF+   ++++ E     
Sbjct: 469  KRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFE----- 523

Query: 515  FTVSKLAVERLYSILADL-ISADYKSEKV---CWPRFTVEILMSXXXXXXX--XXPMDEE 568
              + +LA ERLYSIL +L I+ +  SE      W   T+ +++            P+DE 
Sbjct: 524  -QLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDES 582

Query: 569  LTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFH 628
            L +I N +I +   I           Q+ G   + S+ ++Q Y+GETDSI V+++L  F 
Sbjct: 583  LEKIKNEAISSLAEISK-----SNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFT 637

Query: 629  QTLEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARE 688
            +    + + S  G  EI                  +W+ F+ +   +++ +LL++L ARE
Sbjct: 638  K----HDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARE 693

Query: 689  NKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESG---PDSDDQDGEDTEQI 745
            NK+GF++LF                    +  S   +E +       D +D+  ED   I
Sbjct: 694  NKQGFAQLFEGEGEFEEINEEENANEGDSKSESESESESDSDESNEKDEEDEANEDVVNI 753

Query: 746  DKEATSALVKALNLPESIVNDNGEVHFXXX--XXXXXXXXXXXXXXXXXXXXXXGQLSEI 803
            DKEAT AL+KAL+LP++IVND GEV                              QLSEI
Sbjct: 754  DKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELDDQLSEI 813

Query: 804  FKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPEKSV 863
            FKRRKEALS I TGN+RK EVKESRENVI+FKHR+VDML ++V++ E +L    + E S 
Sbjct: 814  FKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCE-KLAIANKVENSS 872

Query: 864  T-----SKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLDGLEENL-F 917
                  SK          C+R TLDKPLA+K+                 +   L++N+  
Sbjct: 873  NLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKA---NTFKILDKNIEL 929

Query: 918  ENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKTLN 977
             N LKS HE ML  K GQ  +++FSACST+S+FL+KL+            L ++Y  T  
Sbjct: 930  MNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN-NALDELIDLYAATTK 988

Query: 978  EWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006
            EW + GKFS N+FI+F NWLS KKQ   D
Sbjct: 989  EWMLKGKFSTNVFIDFTNWLSSKKQNVLD 1017

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1053 (37%), Positives = 562/1053 (53%), Gaps = 83/1053 (7%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +  +V+RDLF+KLASDL EERL A + L+  LS +    ++ EW YVLNRL+KGL+S RN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 60   GARLGYCLCLTEVVASALEKSV------LAHADEYLRLLLSTL-------SRENIKNGKE 106
             ARLG+ LCLTEV+  A+          L   +++L  L S L        ++++K GK+
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVK-GKD 119

Query: 107  ERGILFGKLFGLQVLLNEPLFSQVF-KAEDEINLEFMLTYVGTLIDVALAKTWIRESSMF 165
            ERGILFGKLFGL+ LLNEPLFS++F K  +  N +F + +   LID+AL K WI+E   F
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFF 179

Query: 166  TLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFH---KSFITTGALRK 222
            TL+Q I+ L P +      K LL + D   +T T+EGL+ YL L +   K+ I +     
Sbjct: 180  TLFQTIKMLLPFIDESIAAKILL-IYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTL--- 235

Query: 223  KGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEIN-------SSEDLSVKQKGIWMPRLH 275
                 DLK N  WK++DPL++GNLP +   L++ +        S D   ++   W PRLH
Sbjct: 236  -----DLK-NLGWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLH 289

Query: 276  FVWDIILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSS 335
            FVWDI+L   F  G+ E+                    I+FPEFWK  +DESFFNEK+SS
Sbjct: 290  FVWDILL-PLFGSGKLENTEHVSKKRKKTSTKKV-QNSIQFPEFWKMAIDESFFNEKASS 347

Query: 336  ERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVC 395
            ERKYLGFL+ + AF   P SY  +  S+N+ R LINQ   S+R L+K++Q  L +IV  C
Sbjct: 348  ERKYLGFLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKAC 407

Query: 396  -KNQPEKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLF 454
             ++   K  P   ++    HGS++FD+                    LT L  V    L 
Sbjct: 408  EEDLTNKLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQ 467

Query: 455  TSLRDHSRVRFLLDAMLHLVRAHKSAADKV-WLAPLLDSLVQQGFFELDENDRQPEVGDE 513
             S RD +   F+LD++LH++RAHK   D +  + P+L  ++   FF+   +D++ E    
Sbjct: 468  QSKRDLTHTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELE---- 523

Query: 514  TFTVSKLAVERLYSILADL-ISADYKSEKV---CWPRFTVEIL--MSXXXXXXXXXPMDE 567
               + +LA ERL+SIL +L ++ +  SE      W   T++++  M          P+DE
Sbjct: 524  --QLHELAKERLFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDE 581

Query: 568  ELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSF 627
             L +    +I +   I   +       QA G   + S+ ++Q Y+GETDSI V+++L  F
Sbjct: 582  NLEKTKEEAISSLAEISRSS-----TAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEF 636

Query: 628  HQTLEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPAR 687
             +    +K+ S  G  EI                  +W+ F+ +   +++ VLL++L AR
Sbjct: 637  SK----DKNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKAR 692

Query: 688  ENKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGEDTE---- 743
            ENK+GF++L                    E  + GD+  E  S    +  + +D      
Sbjct: 693  ENKQGFAQL-FEGEGEFEEIKEEESASEDESKSEGDSESESNSDDADEKDEEDDANEEVV 751

Query: 744  QIDKEATSALVKALNLPESIVNDNGEV---HFXXXXXXXXXXXXXXXXXXXXXXXXXGQL 800
             IDKEATSALVKALNLP++IVND GEV                              GQL
Sbjct: 752  NIDKEATSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDGQL 811

Query: 801  SEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPE 860
            SEIFKRRKEALS I TGN+RK EVKESRENVI+FKHR+VDML ++V++ E +L    + E
Sbjct: 812  SEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCE-KLALANKSE 870

Query: 861  KSVT-----SKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLDGLEEN 915
             S +     SK          C+  TLD+PLA+K+                  +D   E 
Sbjct: 871  DSSSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKEMDKNIEV 930

Query: 916  LFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFV--HRSPRPETYFTLTEVYH 973
            +  + LKS H+ +L  K GQ   +++SACST+S+FL+KL+V  H + + +    L ++Y 
Sbjct: 931  M--DLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGNDKLD---ELIDLYA 985

Query: 974  KTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006
             T  EW   GKF AN+FI+F+NWLS KKQ   D
Sbjct: 986  ATTKEWTNRGKFGANVFIDFINWLSSKKQNVED 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1048 (37%), Positives = 573/1048 (54%), Gaps = 74/1048 (7%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLS--KVEKESREWEYVLNRLIKGLSSSRN 59
            ++ +V+RDLFYKLAS+L EERLQA + ++ +LS  K+   + EW YVL RLIKGLSS R 
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 60   GARLGYCLCLTEVVASAL-------EKSVLAHADEYLRLLLSTLS-----RENIKN--GK 105
            GARLG+ LCLTEV+  A+       E   L++ D+YL +L  TLS     ++N K   GK
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 106  EERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMF 165
            +ERG+LFGK+FGL+ LLNEPLFS+ F    ++   F   ++  L+D+A  K WIRE  +F
Sbjct: 124  DERGLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCLF 183

Query: 166  TLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGL 225
            TL+Q +EKL P     + +K +L LLD    T T+EGLA+YL L HK     G  + K  
Sbjct: 184  TLFQTVEKLLP-FADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHK-----GPEKGKEF 237

Query: 226  LEDLKL----NSPWKNNDPLSKGNLPAIANALKEIN-SSEDLSVK-QKGIWMPRLHFVWD 279
             + +KL    NS WK NDPL++GNLP +   L+E + +SE+  V+     W PRLHFVWD
Sbjct: 238  NDKIKLLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEEKKVEVMSANWQPRLHFVWD 297

Query: 280  IILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKY 339
            I+L +     E                    +  I+FPEFW+  VDESFFNEK+SSERKY
Sbjct: 298  ILLPT-VSTIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKY 356

Query: 340  LGFLVFEKAFSLA--PVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKN 397
            LGF +FE+A S+   P+ ++ T  S+N  R LINQ   + R LHK+S RV+ TIV  C+ 
Sbjct: 357  LGFSIFERAISIVQNPL-HSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEE 415

Query: 398  QPE-KTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHL-FT 455
             P  K  P   ++    +GS +FD+                    L  L ++LT+ +   
Sbjct: 416  SPSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVG 475

Query: 456  SLRDHSRVRFLLDAMLHLVRAHK---------SAADKVWLAPLLDSLVQQGFFELDENDR 506
            +  D  + +F+LD++LH+VR+HK         S   ++ +   +  LV+  FF   +  +
Sbjct: 476  TSEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAK 535

Query: 507  QPEVGDETFTVSKLAVERLYSILADLISADYKSEKVCWPRFT-VEIL-MSXXXXXXXXXP 564
            + +  D    V +LA ERL+S+L++L +   K +   W  +T +EI+             
Sbjct: 536  KEDESDN--QVDELAKERLFSVLSELTTTTNK-QLHSWQYYTLLEIIDRENENPNSLINK 592

Query: 565  MDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDL 624
            MD++L  + +++IK  K I S+ EK     + RG + + S+ +LQ YSG+ DS+  +++L
Sbjct: 593  MDDDLKTVRDNAIKVIKGIASKNEKTTSSGE-RGLESLLSMCLLQLYSGDADSVATIEEL 651

Query: 625  NSFHQT---LEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLL 681
             +F+     +EE +  +  G  EI                  VWE FV E  +D + +LL
Sbjct: 652  ITFYNASRDVEEKR--TMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLL 709

Query: 682  EILPARENKEGFSKLF-----XXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDD 736
            ++LPARENK+GF++LF                        E  +  ++ EE +   +  +
Sbjct: 710  DVLPARENKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDEGAE 769

Query: 737  QDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXXXXXXXXXXXXXXXXXXXXX 796
               E   +IDKEATSAL KALNLP+ I+N+NGEV+F                        
Sbjct: 770  GGNEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKMMEL 829

Query: 797  XGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAE-SELKQ 855
              QL+EIFKRRKEALS + TGN+RK EVKESRE+VIAFKHRV D+L I+++ AE SEL  
Sbjct: 830  DDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAEDSEL-- 887

Query: 856  GGRPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLDGLEEN 915
               P K               CV+ TLDK LA+K+                  +    E 
Sbjct: 888  ---PAKYAI----LFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITA--EQ 938

Query: 916  LFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS-PRPETYFTLTEVYHK 974
            +F++ + SVHE +L  K GQ+Q  ++S CS+ S+FL+KL +  S  + E Y  + ++Y +
Sbjct: 939  VFDH-MTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDIYSE 997

Query: 975  TLNEWFV-GGKFSANLFIEFLNWLSIKK 1001
            T  +W +   KF +N+FI+F NWLS KK
Sbjct: 998  TTKKWVLKDSKFGSNIFIDFYNWLSSKK 1025

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
            gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
            weakly similar to YEL055C uniprot|P39985 Saccharomyces
            cerevisiae
          Length = 1039

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1074 (37%), Positives = 564/1074 (52%), Gaps = 105/1074 (9%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKES--REWEYVLNRLIKGLSSSRN 59
            +  +V+RD FY+LASDL +ER++A + L+ +LS +E  +   EW YVL RLI GL+S RN
Sbjct: 1    MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 60   GARLGYCLCLTEVVASALEKSVLA-----HADEYLRLLLSTLSRENIKN------GKEER 108
             ARLG+ LCL+EVV  AL+K  LA       D+YL LL + LS + +        GK+ER
Sbjct: 61   SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120

Query: 109  GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168
            GILFGK+FGLQ +LNEPLF+ +F  ++     F L +   L ++A+ K W+RES ++TL+
Sbjct: 121  GILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLF 180

Query: 169  QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKG---- 224
            Q +++L P M S+  + ++L LLD   LT T+EGLA+YL LFH      G  RK G    
Sbjct: 181  QTVQRLVPAMESE-IVSSILLLLDKYQLTMTNEGLAIYLLLFH------GKARKNGKSFK 233

Query: 225  LLEDLKLN-SPWKNNDPLSKGNLPAIANALKEI--NSSE--DLSVKQKGIWMPRLHFVWD 279
            +   L L  + WKNNDPLSKGNLP ++  L++   N SE  D S  +   W PRLHFVWD
Sbjct: 234  VPSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWD 293

Query: 280  IILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKY 339
            I++     G   E+                  + I+FPEF+++ VDE+FF+EK+SSERKY
Sbjct: 294  ILIPILAPGKSDEEIPSKKSHKKKKKDTV---EGIEFPEFFQAAVDETFFSEKASSERKY 350

Query: 340  LGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVC-KNQ 398
            LGFLVF +A  +    +  +  ++N  R LINQ   S+R L+K+SQ+ L  IV  C K+ 
Sbjct: 351  LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410

Query: 399  PEKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLR 458
             EK A   E +    HG+ISFD+                    L  L  +L+  L     
Sbjct: 411  SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470

Query: 459  -DHSRVRFLLDAMLHLVRAHKSAADKVWLA-PLLDSLVQQGFFELDENDRQPEVGDETFT 516
             +    +F+LD +LH VR H+    +  +A PLLDS+V   FF     D           
Sbjct: 471  PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED----------- 519

Query: 517  VSKLAVERLYSILADL-ISADYKSEKVCWPRFTVEILMSXXXX-XXXXXPMDEELTEILN 574
            +S LA ERL+SIL++L I  D +S    W  +T+++++S           +DE+L  I  
Sbjct: 520  ISDLARERLFSILSELTIQKDGQS----WQHYTLKLILSKEAEGNEPINKLDEDLKAIET 575

Query: 575  SSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN 634
             ++   + I S++       Q+RG + + S  +LQ YSG+++S+ ++++L  F++    N
Sbjct: 576  EALDILQNISSDSP------QSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYRE-GLN 628

Query: 635  KSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFS 694
            +S S  G  EI                  VWE FV E  + ++ +LLE+L ARENKEGF+
Sbjct: 629  ESNSLVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFA 688

Query: 695  KLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDS-------------------D 735
            KLF                L   EG S  + ++ +SG D                    D
Sbjct: 689  KLFENVDDYQEESAGEEEDLEDGEGKSKKSDDKSKSGNDPSDESEDASSASEEDSSDDSD 748

Query: 736  DQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXX-----------------X 778
             +D  +  +ID+EATSAL KALNLPE+IVND GEV                         
Sbjct: 749  AEDDSNVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEED 808

Query: 779  XXXXXXXXXXXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRV 838
                                QLS+IFKRRKEALS + TGN+RK EVKE+RENVI FKHR+
Sbjct: 809  EEEDEEEESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRI 868

Query: 839  VDMLEIFVRWAESELKQGGRPE---KSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXX 895
            VDMLE +++ A+    Q    E   K               C++ TLDKPLA+K+     
Sbjct: 869  VDMLEAYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLK 928

Query: 896  XXXXXXXXXXDTSLDG-LEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKL 954
                       ++  G ++       L+  H+A+L  K GQF  LYFS CST S+FL K+
Sbjct: 929  GRLYKIKI---SAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKV 985

Query: 955  FV-HRSPRPE-TYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNW-LSIKKQQNS 1005
             V + S  P  +Y  + ++Y  T  EW + GKF AN+F +F NW LS KK  N+
Sbjct: 986  LVENNSEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKTPNA 1039

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1052 (37%), Positives = 554/1052 (52%), Gaps = 85/1052 (8%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +  +V+RDLF+KLASDL EERL A + L+  LS +E   +S EW YVLNRLIKGL+S RN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 60   GARLGYCLCLTEVV--ASALEKSVLAHADEYLRLLLSTLS-----------RENIKNGKE 106
             ARLG+ LCLTEV+  A  +         E +   L TLS           ++ +K GK+
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVK-GKD 119

Query: 107  ERGILFGKLFGLQVLLNEPLFSQVFKAED--EINLEFMLTYVGTLIDVALAKTWIRESSM 164
            ERGILFGKLFGL+ LLNEPLFS +F  ED    N EF++ ++  LID+AL K WI+E  +
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSGIF-VEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCL 178

Query: 165  FTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKS----FITTGAL 220
            ++L+Q I+ L P M      + LLT  D   LT T+EGL+ YL L ++S      +T  L
Sbjct: 179  YSLFQTIKMLLPTMNESTAAEILLTY-DKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGL 237

Query: 221  RKKGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEI-------NSSEDLSVKQKGI-WMP 272
            +  G          WKNNDPL++GNLP +   L++          ++D + KQK   W P
Sbjct: 238  KNLG----------WKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNP 287

Query: 273  RLHFVWDIILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEK 332
            RLHFVW+I+L   F  G+ E+                    I+FPEFW+  VDESFFNEK
Sbjct: 288  RLHFVWNILL-PLFGSGKLENAEHISKKRKKTSNKKVP-SSIQFPEFWQMAVDESFFNEK 345

Query: 333  SSSERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIV 392
            +SSERKYLGFL+ +  F   P S      S+N+ R LINQ   S+R L+K++Q  L +I+
Sbjct: 346  ASSERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSII 405

Query: 393  DVCKNQP-EKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTN 451
              C+  P  K  P    +    HGSI+FD+                    L  L  +   
Sbjct: 406  KACEEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVL 465

Query: 452  HLFTSLRDHSRVRFLLDAMLHLVRAHKSAADKV-WLAPLLDSLVQQGFFELDENDRQPEV 510
             L     D     F+LD++LH++RAHK+  + V  + P+L  +V   FF+   +D++ E 
Sbjct: 466  QLQEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESE- 524

Query: 511  GDETFTVSKLAVERLYSILADL-ISADYKSEKV---CWPRFTVEIL--MSXXXXXXXXXP 564
                  + +LA ERLYSIL +L I+ + +SE      W   T+ ++  M          P
Sbjct: 525  -----QLHELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNP 579

Query: 565  MDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDL 624
            +DE L +  N +I +   I           Q+ G   + S+ ++Q Y+GETDSI V+++L
Sbjct: 580  LDEGLEKTKNEAISSLTEISK-----SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEEL 634

Query: 625  NSFHQTLEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEIL 684
              F +    +++ S  G  EI                  +W+ F+G+    ++ +LL++L
Sbjct: 635  CEFAK----DENSSMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVL 690

Query: 685  PARENKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGEDTE- 743
              RENK+GF+ LF                    +  S  +++ E +  +  D++ E  E 
Sbjct: 691  KTRENKQGFALLFEGEGEFEEVDEEESAVEDESKSESESDSDSESNDDEERDEEDEANED 750

Query: 744  --QIDKEATSALVKALNLPESIVNDNGEVHF------XXXXXXXXXXXXXXXXXXXXXXX 795
               IDKEATSAL+KALNLP++IVND GEV                               
Sbjct: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMME 810

Query: 796  XXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQ 855
               QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHR+VDML I+V+  E +L  
Sbjct: 811  LDDQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCE-KLAI 869

Query: 856  GGRPEKSV-----TSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLD 910
              + E S+      S           C++ TLD+PLA+K+                  LD
Sbjct: 870  ANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLD 929

Query: 911  GLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTE 970
               E L  + LKS H+ ML  K GQ  N++FSACST+S+FL+KL+V  +   + +  L +
Sbjct: 930  KTIELL--DLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLID 986

Query: 971  VYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQ 1002
            +Y  T  +W   GKF AN+FI+F+NWLS KK+
Sbjct: 987  LYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1059 (37%), Positives = 553/1059 (52%), Gaps = 93/1059 (8%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +  +V+RDLF+KLASDL EERL A + L+  LS ++   ++ EW YVLNRLIKGLSS RN
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 60   GARLGYCLCLTEVVASALEKSV------LAHADEYLRLLLSTLSRENIK-------NGKE 106
             ARLG+ LCLTEV+  A+          L   +E+L  L ST+   N+         GK+
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTL-STILNVNVNEGTKKSMKGKD 119

Query: 107  ERGILFGKLFGLQVLLNEPLFSQVF-KAEDEINLEFMLTYVGTLIDVALAKTWIRESSMF 165
            ERGILFGKLFGL+ LLNEPLFS++F K  ++ N EF + +   LID+AL K WI+E   F
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFF 179

Query: 166  TLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHK---SFITTGALRK 222
            TL+Q ++ L P M      K LL + D   LT T+EGL+ YL L ++   S I +     
Sbjct: 180  TLFQTMKMLLPFMDESSAEKILL-IYDKYDLTLTNEGLSTYLLLKYEGDESLIPS----- 233

Query: 223  KGLLEDLKLNSPWKNNDPLSKGNLPAIANALK------EINSSEDLSVKQKGI-WMPRLH 275
               + DLK N  WK+NDPL++GNLP +   L+      + N     + KQK   W PRLH
Sbjct: 234  ---VLDLK-NPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLH 289

Query: 276  FVWDIILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSS 335
            FVW ++L   F  G+ E+                    I+FPEFWK  VDESFFNEK+SS
Sbjct: 290  FVWSVLL-PLFGNGKLENTSHISKKRKKTNNKKV-QNSIQFPEFWKMAVDESFFNEKASS 347

Query: 336  ERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVC 395
            ERKYLGFL+ + AF   P SY     S+N+ R LINQ   S+R L+K+SQ  L +IV  C
Sbjct: 348  ERKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKAC 407

Query: 396  -KNQPEKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLF 454
             ++   +  P    +    HGSI+FD+                    L  L +V     F
Sbjct: 408  EEDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDV----FF 463

Query: 455  TSLRDH----SRVRFLLDAMLHLVRAHK-SAADKVWLAPLLDSLVQQGFFELDENDRQPE 509
              L+D     S   F LD++LH+VRAHK    D   + P+L  +V   FF+   +D + E
Sbjct: 464  LQLQDKKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLE 523

Query: 510  VGDETFTVSKLAVERLYSILADL-ISADYKS---EKVCWPRFTVEILMSXXXXXX--XXX 563
                   + +LA ERLYSIL +L I+ + +    E   W   T+++++            
Sbjct: 524  ------QLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLIN 577

Query: 564  PMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQD 623
            P+DE L  I N +I     +C       +  Q+ G   + S+ ++Q Y+G+TDSI V+++
Sbjct: 578  PLDENLENIKNEAISCLSKVCR-----SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEE 632

Query: 624  LNSFHQTLEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEI 683
            L  F +    +++ S  G  EI                  +W+ F+ E   +++ +LL+I
Sbjct: 633  LCEFSK----HENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDI 688

Query: 684  LPARENKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGEDTE 743
            L ARENK+GF++LF                   +E  +G  +E E      D  + ++ +
Sbjct: 689  LKARENKQGFAQLFEGEEEFEEIKEENDAS--EDESKTGSESESESESDSDDADEKDEED 746

Query: 744  -------QIDKEATSALVKALNLPESIVNDNGEV---HFXXXXXXXXXXXXXXXXXXXXX 793
                    IDKEATSALVKALNLP++IVND GEV                          
Sbjct: 747  EANEDILNIDKEATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKM 806

Query: 794  XXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESEL 853
                 QLSEIFKRRKEALS I TGN+RK EVK+SRENVI+FKHRVVDML ++V++ E +L
Sbjct: 807  MELDDQLSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCE-KL 865

Query: 854  KQGGRPEKSVT-----SKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTS 908
                + E S       SK          CV  TLD+PLA+K+                T+
Sbjct: 866  TLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKV---TA 922

Query: 909  LDGLEENL-FENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFT 967
               + +++   + LK  H+ ML  K GQ   +++S CST+S+FL+KL+V      +    
Sbjct: 923  FKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGN-DKLDE 981

Query: 968  LTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006
            L ++Y  T  EW   GK   N+FI+F+NWLS KKQ   D
Sbjct: 982  LIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1017

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1052 (36%), Positives = 558/1052 (53%), Gaps = 87/1052 (8%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +   V+RD FYKLASDL EER+QA + L+ +LS ++    + EW YVL RLI GLSSSRN
Sbjct: 1    MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 60   GARLGYCLCLTEVVASAL-----EKSVLAHADEYLRLLLSTL--------SRENIKNGKE 106
             ARLG+ LCLTEV+  AL         L+  D +L LL STL        S++ IK GK+
Sbjct: 61   SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIK-GKD 119

Query: 107  ERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFT 166
            ERG+LFGK+FGLQ LL+EPLF +VF ++++   +F L ++  L  +A+ K+W+RE  +FT
Sbjct: 120  ERGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFT 179

Query: 167  LYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLL 226
            L+QA E++ P +   +  + +L LLD   LT T+EGLA+YL L +KS           L 
Sbjct: 180  LFQAYERILP-LADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKS---PRDYSSSILQ 235

Query: 227  EDLKLNSPWKNNDPLSKGNLPAIANALKEIN-SSEDLSVKQKGIWMPRLHFVWDIILTSF 285
             D +  S WK+NDPL++GNLP ++  L++ + ++ED S  +   W PRLHFVWDI+L   
Sbjct: 236  MDFESKS-WKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASNWTPRLHFVWDILLPII 294

Query: 286  FEGG---EYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGF 342
             +     E ED                    I+FPEFW+  VDES FNEK+S+ERK+LG 
Sbjct: 295  TQDNSRRESEDRKPKTKKRKKEK-----ATAIQFPEFWQMAVDESMFNEKASTERKFLGL 349

Query: 343  LVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQP-EK 401
            ++F+KA  + P        S+N+ R LIN    S+R L K+S +VL +IVD+CK +P EK
Sbjct: 350  VIFQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEK 409

Query: 402  TAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLT-LLGEVLTNHLFTSLRDH 460
              P    +    HGSI+FD+                 +  L  L G + +N + +SL + 
Sbjct: 410  LVPCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQ 469

Query: 461  SRVRFLLDAMLHLVRAHKSAADK-VWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSK 519
               +F+LD MLH VR+HKS  +K + +  +L  ++   FF          V DE    S 
Sbjct: 470  KNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFF---------TVKDE--HTSN 518

Query: 520  LAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXX-XXXXXPMDEELTEILNSSIK 578
            LA ER YSIL+++   +  +E   +    ++I+             +D+ L ++ + +++
Sbjct: 519  LAKERFYSILSEITHLN--NEGPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALR 576

Query: 579  TFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGS 638
            T + I +      K  Q RG +++ S+ +LQ YSGE++++ V+++L +F+Q  +EN S S
Sbjct: 577  TLQAISN----NEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDEN-STS 631

Query: 639  YAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF- 697
              G  EI                   W+ FV E  + ++  LL++LPARENK+GFS+LF 
Sbjct: 632  LVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFE 691

Query: 698  ----------XXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGEDTEQIDK 747
                                         E+  S ++     +G DS +++ +D  +IDK
Sbjct: 692  GEDDFEEAEEEFDEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDS-NENQDDVAKIDK 750

Query: 748  EATSALVKALNLPESIVNDNGEVHFXX----------------XXXXXXXXXXXXXXXXX 791
            EATSAL KALNLP++IVND GEV                                     
Sbjct: 751  EATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDEDSMDDE 810

Query: 792  XXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAES 851
                   QLS+IFKRRK+ALS I TGN+RK E KESRE+VIAFK RV+DMLEI+V++ E 
Sbjct: 811  KMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVKFVE- 869

Query: 852  ELKQGGRPEK-SVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLD 910
              KQ  + E  S  S           C++ T DK LA ++                    
Sbjct: 870  --KQSLKEENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTS--AFCG 925

Query: 911  GLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS-PRPETYFTLT 969
              +++     L+  HE +   K GQ Q +Y+S CSTAS+FL K+ +  S  +      + 
Sbjct: 926  SCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKDAAVHDII 985

Query: 970  EVYHKTLNEWFVGGKFSANLFIEFLNWLSIKK 1001
            ++Y +T+ +W   GKF  N+FI+F NWLS +K
Sbjct: 986  DLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5 DNA
            polymerase V
          Length = 1021

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/1051 (36%), Positives = 560/1051 (53%), Gaps = 88/1051 (8%)

Query: 4    AEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRNGA 61
            A+V+RD FYKLASDL EERLQA +G++  LS +E  +E  EW Y +NRL+KGL SSRN A
Sbjct: 2    AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 62   RLGYCLCLTEVVASALE-----KSVLAHADEYLRLLLSTLSRE----NIKNGKEERGILF 112
            RLG+ +CL+E +  AL         L   + YL++L  TL  +      + GK+ERGILF
Sbjct: 62   RLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGILF 121

Query: 113  GKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIE 172
            GKLFGLQ LLNEPLFS VF  +D I+  F+  +V  +I+++  K WIRE ++F+LYQ +E
Sbjct: 122  GKLFGLQALLNEPLFSNVFVTKDGIS-NFVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180

Query: 173  KLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKL- 231
            KL   + S+  +  L++ LD   LT T+EGLA+YL L  +S   +     +  + ++KL 
Sbjct: 181  KLISKV-SKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKIS-----RAEIAEIKLQ 234

Query: 232  NSPWKNNDPLSKGNLPAIANALKEIN----SSEDLSVKQKG--IWMPRLHFVWDIILTSF 285
            N  WK+NDPL+KGNLP++   L + +    + ++   KQKG   W PRLHFVW+ +L++ 
Sbjct: 235  NQGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294

Query: 286  FEGGE---YEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGF 342
              G      ED                    IKF EFW+ VVDE++FN+K+SSERKYLGF
Sbjct: 295  INGSHSLNVEDKHVSKKRKKNNTIA-----SIKFHEFWQMVVDETYFNDKASSERKYLGF 349

Query: 343  LVFEKAFSLAPVSYTHTL--LSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPE 400
            L+F++AF +   SY   +  L +N  R LINQC   +R+L+K++ + +  IV+ C+N   
Sbjct: 350  LIFQRAFPMLK-SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT 408

Query: 401  KTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDH 460
            K  P FETLA  + GSI+FD+                  + L+ L ++L+  L     + 
Sbjct: 409  KILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEK 468

Query: 461  SRVRFLLDAMLHLVRAHKSAADKVWLA-PLLDSLVQQGFFELDENDRQPEVGDETFTVSK 519
            S  +F+LD+MLHLVR  K+  D + L   +L  +V+  FF           GD   T+ +
Sbjct: 469  SFSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF----------TGDNE-TLQE 517

Query: 520  LAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXX--XXXXXPMDEELTEILNSSI 577
            ++ ERL+SIL++L S  + SE    P++ V  L+             +D+EL E  +S++
Sbjct: 518  MSKERLFSILSELNSL-HLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSAL 576

Query: 578  KTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSG 637
            +    I +E  K   +   RG   +F+  +LQ Y+G+++S+  LQ+L   ++ L  +   
Sbjct: 577  R----ILAEIAKATDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDER 632

Query: 638  SYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF 697
              +   EI                  VWE  V   SQD++ +LL+IL ARENK+GF++LF
Sbjct: 633  PLSSITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

Query: 698  XXXXXXXXXXXXXXXXLFAE----------------EGASGDNTEEEESGPDSDDQDGED 741
                               +                E    ++   E++  DS +   + 
Sbjct: 693  EGIDEYEEDEDDEQLEDEEQIKEVTDDSSSNSESDSEEDEDNSDSHEDTSSDSVEDHNDA 752

Query: 742  TEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXXXXXXXXXXXXXXXXXXXXXX---G 798
               IDKE TSAL KAL+LP  I+N NGEV                               
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDD 812

Query: 799  QLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGR 858
            QLSEIFKRRKEALS IPTGNKRK EVKESRE+VIAFKHR+VD+L ++++  E  +++   
Sbjct: 813  QLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDV 872

Query: 859  PEKSVTSKXX---XXXXXXXXCVRTTLDKPLAEKVXXXXXX---XXXXXXXXXDTSLDGL 912
             E S   K             C++ TLDK LAEK+                  DT+ D +
Sbjct: 873  DENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTA-DVV 931

Query: 913  EENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPE-TYFTLTEV 971
            E+       + +H+  L  K GQF  LY+S CS+ S++ +K+ V  +   +  Y TL + 
Sbjct: 932  ED------FQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDT 985

Query: 972  YHKTLNEWFVGGKFSANLFIEFLNWLSIKKQ 1002
            Y  T+ EW    KF  ++F++F+NWL+ KKQ
Sbjct: 986  YSTTIKEWLKDTKFPHSIFLDFVNWLASKKQ 1016

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1063 (36%), Positives = 546/1063 (51%), Gaps = 108/1063 (10%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKV--EKESREWEYVLNRLIKGLSSSRN 59
            +  +V+RDLFYKLASDL EER QA I LV +L+ +    E+ EW YV+NRLIKGL+S R+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 60   GARLGYCLCLTEVVASALE-----KSVLAHADEYLRLLLSTLSRENIKN---------GK 105
             ARLG+ LCLTEV+  AL         L   D++L+LL  TLS +   N         G+
Sbjct: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120

Query: 106  EERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLE---FMLTYVGTLIDVALAKTWIRES 162
            +ERG+LFGK+FGLQ + NEP+FS VF  + +   E   F   ++  ++D+AL K WI+ES
Sbjct: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180

Query: 163  SMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFH----KSFITTG 218
             +FTL+Q I+KL P       L ++L+LLDS  L+ TSEGLAVYL + +     + + T 
Sbjct: 181  CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239

Query: 219  ALRKKGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEINSSE-----DLSVKQKGI-WMP 272
            ++  K        N  WKNNDPLS+GNLP +   L++ + ++     + S KQ    W P
Sbjct: 240  SIEFK--------NPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNP 291

Query: 273  RLHFVWDIILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEK 332
            RLHFVWDI+L     G                       + I+FPEFW+ VVDESFFNEK
Sbjct: 292  RLHFVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEK 351

Query: 333  SSSERKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIV 392
            +SSERKYLGFL+F K   +   +  +   S N  R LINQ   S+R LHK+SQ  L TI+
Sbjct: 352  ASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTII 411

Query: 393  DVCK-NQPEKTAPSFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTN 451
            +VC+ +   K       +     GSI+FD+                  + L  L ++ T+
Sbjct: 412  EVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTS 471

Query: 452  HLFTSLRDHSRVRFLLDAMLHLVRAHKSAAD-KVWLAPLLDSLVQQGFFELDENDRQPEV 510
            ++     +  + R++LD +LH+VR HK+  +    + PLLD L+Q  FF           
Sbjct: 472  NISEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFF----------- 520

Query: 511  GDETFTVSKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXXXX--XXXPMDEE 568
              E   +++LA ER  SILA+L S   K     W  + ++I++             +DE 
Sbjct: 521  AKENEPLNELAKERFSSILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDEN 580

Query: 569  LTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFH 628
            L +I N +      I     K  +  Q  G + + S+ +LQ +SGET+S+  +++L  F+
Sbjct: 581  LGKIKNDACDVIVKII----KSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFY 636

Query: 629  QTLE-ENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPAR 687
            +  + + +S S  G  EI                  VWE F+    ++++ +LL++L AR
Sbjct: 637  KEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKAR 696

Query: 688  ENKEGFSKLFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQ---------- 737
            ENK+GF+ LF                   +EG S  + E++ SG +S++           
Sbjct: 697  ENKQGFAHLFEGADEYEEIED-------EQEGESNQSEEKDVSGEESEESEESEIDDEDD 749

Query: 738  --DGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXX-------XXXXXXXXXXX 788
              D  +   IDKEATSAL KALNLPE+IVND GEV                         
Sbjct: 750  SLDTAEVNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESM 809

Query: 789  XXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRW 848
                      QLSEIFKRRKEALS   TGN+RK E KESRENVIAFK RVVD+L ++V++
Sbjct: 810  DDEKMMLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKY 869

Query: 849  AESELKQGGRPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTS 908
             E +L+     +K V             CV+ TLDK LA+KV                T 
Sbjct: 870  VE-KLQTADHSQKFVN--LISFVEPMVTCVQKTLDKSLADKVSKLLK-----------TR 915

Query: 909  LDGLEENLFENS---------LKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS 959
            +  ++ + F+NS         LK +HE +L +K GQ   LY++  S+AS+F +K++V  S
Sbjct: 916  IFKIKSSTFKNSANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASS 975

Query: 960  P-RPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKK 1001
                  Y  L + Y  T   W    KF  N F +F NWL+ +K
Sbjct: 976  TDETNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  550 bits (1416), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 367/1048 (35%), Positives = 539/1048 (51%), Gaps = 91/1048 (8%)

Query: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59
            +  +V+RD FYKLASDL EERLQA + L+ +LS +       EW YV+NRLIKGLSS RN
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 60   GARLGYCLCLTEVVASALE------KSVLAHADEYLRLLLSTLSRE-----NIKNGKEER 108
            GARLG+ LCLTEVV  A++         L   D +L LL  T S +       + GKEER
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEER 120

Query: 109  GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168
            G++FGKLF LQ LLNEPLFS +F  + +I  +F   ++  L+++A  K WI++  +FTLY
Sbjct: 121  GLMFGKLFALQALLNEPLFSDIFIKDGKIT-KFTTKFIDELVNLASRKNWIKQPCLFTLY 179

Query: 169  QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLED 228
            Q IE+L P       +K ++T+LD    T T+EGLA+YL    K +          LL  
Sbjct: 180  QTIERLLP-YSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGY-------SSALLSI 231

Query: 229  LKLNSPWKNNDPLSKGNLPAIANALKE--INSSEDLSVKQKGIWMPRLHFVWDIILTSFF 286
               N  WK N+PL KGNL  ++  ++E  +   ++ +      W P+LHFVWDI+L   +
Sbjct: 232  NVTNKGWKYNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPILY 291

Query: 287  EGGEYEDXXXXXXXXXXXXXXXXXH-QQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVF 345
                 E                      I+FPEFWK++VDE++F++K+SSERK+LG L+F
Sbjct: 292  NDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351

Query: 346  EKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQP-EKTAP 404
             KA    P  +     S+NL RCLINQC  SER+LHK++++ L +IV  C+  P  K  P
Sbjct: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411

Query: 405  SFETLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVR 464
                L    +GSI+FD+                 D  +  L  + T+ L  S ++ + + 
Sbjct: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSEL-NSQKNEAVLH 470

Query: 465  FLLDAMLHLVRAH----KSAADKVWL-APLLDSLVQQGFFELDENDRQPEVGDETFTVSK 519
            F+LD +LH++R+H    K      WL + LL  LV+ GFF   E    PE   +   VS+
Sbjct: 471  FILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATET--SPE---DKINVSE 525

Query: 520  LAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKT 579
            +A ER+YSIL++L S     +   W    +  L +          +DE+LT + ++ +  
Sbjct: 526  IARERIYSILSELSSVP-TGDAHSWQFHILNELTTVENELTLTNALDEDLTTVKDTGLSV 584

Query: 580  FKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSG-- 637
              ++  + +K      +RG + + ++ +LQ YSGE DS+  ++++  +   L E KS   
Sbjct: 585  IHSLSVKNDKS-----SRGIESLLAMCLLQLYSGEADSVATIKEICDY---LTEEKSSKN 636

Query: 638  --SYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSK 695
              S  G  EI                  VWE  + +   D++ ++L++L ARENKEGFS 
Sbjct: 637  SISLVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSY 696

Query: 696  LFXXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPD------------------SDDQ 737
            LF                    E  SGD   E E  P+                  S++ 
Sbjct: 697  LFEGAEEY--------------EKVSGD---ENEVAPEEESASSDTSDSSSDSDDESEEA 739

Query: 738  DGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXXXXXXXXXXXXXXXXXXXXXX 797
            D +D   ID++   AL KAL LPE++VN++GEV F                         
Sbjct: 740  DNKDVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALD 799

Query: 798  GQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGG 857
            GQL++IFKRRK+ALS +PTGN RK EV++SRE+VI FK R++DML I+V++ E    +  
Sbjct: 800  GQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDK 859

Query: 858  RPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTSLDGLEENLF 917
               K               CV+ TLD+PLA+K+                ++ DG     F
Sbjct: 860  DVMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPV-SAEDG---ERF 915

Query: 918  ENSLKSVHEAMLL-KKCGQFQNLYFSACSTASMFLAKLFVH-RSPRPETYFTLTEVYHKT 975
              SL+ +H   LL +K GQ+Q +Y+S CS+AS+F  KL +  R  +   +  + ++Y +T
Sbjct: 916  VESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAET 975

Query: 976  LNEWFVGGKFSANLFIEFLNWLSIKKQQ 1003
              +W    KF  ++F +F NWLS K+QQ
Sbjct: 976  TKKWMDKKKFPTSVFFDFYNWLSSKRQQ 1003

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  489 bits (1260), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 349/1062 (32%), Positives = 530/1062 (49%), Gaps = 97/1062 (9%)

Query: 6    VDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKES---------REWEYVLNRLIKGLSS 56
            V+RD+FY+LASDL EERLQ+++ LV +L +++  +         +EW YV+NRLI GL+S
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 57   SRNGARLGYCLCLTEVVASALEKS-------VLAHADEYLRLLLSTLSRENIKNG----- 104
            +R GARLG+ LCLTEV+  AL +         L     +L L+  TLS  + K G     
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 105  ---KEERGILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRE 161
               K+ERG+LFGKLF LQ LLN+P+F ++F  +   N   +  ++  LI ++  K WI+E
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKD---NKAILFEFIYELIALSNLKNWIKE 180

Query: 162  SSMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALR 221
             ++FTL+  I+K+   +  +  +  LL +L S  LT T+EGL++Y+YL +    T   + 
Sbjct: 181  PTLFTLFNFIQKIIEFLD-RSDIVQLLNILASNNLTLTNEGLSIYIYLIY----TNPHIS 235

Query: 222  KKGLLEDLKLNSPWKNNDPLSKGNLPAIANALKEINS-SEDLSVKQKGIWMPRLHFVWDI 280
             + +  D   N+ WKNNDP  K N+  ++  L   ++ S+         W PRLH+VWD+
Sbjct: 236  PEDIQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHYVWDV 295

Query: 281  ILTSFFEGGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYL 340
            IL         +                    +IKF EFW+ V+DESFFNEK+S ERKYL
Sbjct: 296  ILPILLNPKSSD----KLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKYL 351

Query: 341  GFLVFEKAFSLAPVSY-THTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQP 399
            GFL+ +K F L   +    ++ + NL R +INQ   S+R L+K+S + +  IV  C++  
Sbjct: 352  GFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNS 411

Query: 400  E-KTAPSFETLALKEHGS--ISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTS 456
            E +  P       KE  S  I+FD+                    L+ L  + T+ L  S
Sbjct: 412  ELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKL-DS 470

Query: 457  LRDHSRVRFLLDAMLHLVRAHKS--AADKVWLAPLLDSLVQQGFFELDENDRQPEVGDET 514
                + ++FLLD++LH++R+HKS       +L P+L+ ++   FF+        E  D  
Sbjct: 471  FTTTTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFK--------ETAD-- 520

Query: 515  FTVSKLAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILN 574
             ++S +  +RL SIL DL +    S  + +    + + ++           D+ L E+ +
Sbjct: 521  VSISNILKDRLISILNDLTTVGENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKD 580

Query: 575  SSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN 634
            S+I T K      E   +  + +    + S++++Q Y  + DSI  +QDL  F+   + N
Sbjct: 581  SAITTLK---RAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSN 637

Query: 635  ------KSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARE 688
                  K+    G IEI                  +WE F+     ++   + ++L  RE
Sbjct: 638  TIMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRE 697

Query: 689  NKEGFSKLF--------XXXXXXXXXXXXXXXXLFAEEGASGDNTEEEESGPDSDDQDGE 740
            NKEGF++LF                          + E +  DN+ +EE+  DS  +  +
Sbjct: 698  NKEGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEEN--DSIVESND 755

Query: 741  DTEQIDKEATSALVKALNLPESIVNDNGEV-------------HFXXXXXXXXXXXXXXX 787
            D  +IDKEATSAL KAL LP++I+ND GEV             HF               
Sbjct: 756  DINRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMD 815

Query: 788  XXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVR 847
                      GQLS+IF RRKEALS I TGNKRK +VKESRENVIAFKHR+VDM+E++++
Sbjct: 816  DEQMMELD--GQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLK 873

Query: 848  WAESELKQGGRPEKSVTSKXXXX----XXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXX 903
              E   K     E++  +K              C++ TLD+ LAEK+             
Sbjct: 874  HIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKL 933

Query: 904  XXDTSLDGL-EENLFENSLKSVH-EAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPR 961
                    L  EN+ E  + ++H E +L+KK GQ+Q LYF  CS +S+F  ++F   S  
Sbjct: 934  VEFKDCGDLTSENILE-WISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTN 992

Query: 962  PETYFTLTEVYHKTLNEWFVGG--KFSANLFIEFLNWLSIKK 1001
             + Y +L ++Y +T   WF     K    +F +F NWLS K+
Sbjct: 993  ADLYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  427 bits (1097), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 265/712 (37%), Positives = 397/712 (55%), Gaps = 51/712 (7%)

Query: 5   EVDRDLFYKLASDLSEERLQAIIGLVTQLS--KVEKESREWEYVLNRLIKGLSSSRNGAR 62
           +V+RD FYKLASDL EER+Q+ + L+  LS  K  +  +E+EYVLNRLI GLSS+RN AR
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62

Query: 63  LGYCLCLTEVVASALEK-----SVLAHADEYLRLLLSTLSRENI------KNGKEERGIL 111
           LG+ LCLTEVV  AL++     + L   D++L ++  TL  +++      K GK+ERGI+
Sbjct: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122

Query: 112 FGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAI 171
           FG++F LQ LLNEPLF++VF  ++    +F + +   L+++A+ K W+RE  +FTLYQ +
Sbjct: 123 FGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTV 182

Query: 172 EKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKL 231
           EK  P + S   +++L+ LLD   LT T+EGLA+YL L H    T G    K +   L L
Sbjct: 183 EKFMPYIDSSY-IESLVQLLDKYKLTLTNEGLAIYLSLIH----TNG----KKIASSLPL 233

Query: 232 NSP-WKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGI---WMPRLHFVWDIILTSFFE 287
            S  WK NDPL+KGNLP +   L  +NS+ + S   +G    W PRLHFVWDI+L     
Sbjct: 234 ESQGWKLNDPLAKGNLPTLTQVL--LNSNINQSETPQGNAANWSPRLHFVWDILLPILL- 290

Query: 288 GGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEK 347
            G+ +                     IKF  FWK VVDESFFNEKSSSERKYLGFL+ +K
Sbjct: 291 -GQ-DSTTNDEHVSKKQKSKTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQK 348

Query: 348 AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFE 407
           +  L P     +L  +N+ R +INQ   ++R LHK+SQ+VL +I++ C+    K  P  +
Sbjct: 349 SLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPIVK 408

Query: 408 TLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRDHSRVRFLL 467
            +   E+G+ +FD+                 ++ L+ +  +L+N +  S     + +F+L
Sbjct: 409 VILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQFVL 468

Query: 468 DAMLHLVRAHKSAAD-KVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLY 526
           D +LH+VR HK   +    +  LL  ++   FF L EN+R          +S +A ER +
Sbjct: 469 DTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF-LKENER----------ISNIAKERFF 517

Query: 527 SILADLISADYKSEKVCWPRFTVEILMSXXXX-XXXXXPMDEELTEILNSSIKTFKTICS 585
           S+L++L  A   +    W    +E++ +           MD++L  I    I+  K    
Sbjct: 518 SLLSEL--AAITTSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLK---- 571

Query: 586 EAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEI 645
           E  K    +Q RG + + S+++LQ Y+G+ DS+ +++DL +F+   E++ S S  G  EI
Sbjct: 572 EVTKKSDTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDD-SVSLVGITEI 630

Query: 646 XXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF 697
                              WE FV     +++ VL+++L ARENKEGF++LF
Sbjct: 631 LLALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  167 bits (422), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 149/276 (53%), Gaps = 18/276 (6%)

Query: 744  QIDKEATSALVKALNLPESIVNDNGEVHFXX-----------XXXXXXXXXXXXXXXXXX 792
            +I+KE TSAL KALNLP++I+N+NGEV                                 
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 793  XXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAE-- 850
                  QLSEIFKRRKEALS + +GN+RK +VKESRENVIAFKHR++D+LE ++++ E  
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 851  SELKQGGRP--EKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXXXXXXXXXXDTS 908
            +  K   +P  ++ + +           C++ TLD+PLA+K+                 +
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 909  LDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS---PRPETY 965
             +   +      LK++HE ++  K GQ  +LYFS CST+S+FL+KL +  +    R   +
Sbjct: 918  GNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAF 977

Query: 966  FTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKK 1001
              L ++Y +   +W + G+F   +F++F NWL+ KK
Sbjct: 978  SQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKK 1013

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  420 bits (1080), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 281/750 (37%), Positives = 403/750 (53%), Gaps = 73/750 (9%)

Query: 2   VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSK--VEKESREWEYVLNRLIKGLSSSRN 59
           +A +V+RDLFYKLASDL EERLQ+ + L+ +LS+  V  +  EW YVLNRLIKGL+S RN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 60  GARLGYCLCLTEVVASAL-----EKSVLAHADEYLRLLLSTL-------SRENI-----K 102
            ARLG+ LCLTE +  AL         +   +E+L LL  TL       + EN      K
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120

Query: 103 NGKEERGILFGKLFGLQVLLNEPLFSQVFKAEDE--INLEFMLTYVGTLIDVALAKTWIR 160
            G++ERGILFGKLF LQ LLNEPLFS +F +ED+  I+    + YV  L  +   K WIR
Sbjct: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180

Query: 161 ESSMFTLYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGAL 220
           ES  FTLYQ IEKL P     +  + +LTLLD   LT + EGLA+YL + ++S       
Sbjct: 181 ESCFFTLYQTIEKLLP-YADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRS------A 233

Query: 221 RKKGL---LEDLKL-NSPWKNNDPLSKGNLPAIANALKEINSSE---------DLSVKQK 267
            KK L   L D++L NS WK+N+PL++GNLPA+ N L++ N +E           + +  
Sbjct: 234 NKKQLEKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPP 293

Query: 268 GIWMPRLHFVWDIILTSFFEGGEY----EDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSV 323
             W PRLHFVWDI+L              D                 ++ I+FPEFW+  
Sbjct: 294 ANWAPRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMA 353

Query: 324 VDESFFNEKSSSERKYLGFLVFEK---AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNL 380
           +DESFFNEK+SSERKYLGFL+F+K   +          T  ++N  R LINQ   ++R L
Sbjct: 354 IDESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLL 413

Query: 381 HKVSQRVLTTIVDVCKNQP-EKTAPSFETLALKEH--GSISFDQXXXXXXXXXXXXXXXX 437
           HK+SQ  + TIV VC++ P  K  P  + L    +  GSI+FD+                
Sbjct: 414 HKMSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHL 473

Query: 438 XDQQLTLLGEVLTNHL--FTSLRDHSRV-RFLLDAMLHLVRAHKSAAD-KVWLAPLLDSL 493
               L  L ++  + +   ++ ++ + V +F LD +LH+VR+HKS  D    + PLL+ L
Sbjct: 474 SSSTLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPL 533

Query: 494 VQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLISADY--KSEKVC--WPRFTV 549
           V+  FF  D              +++LA ERLYSIL++L  A    KS      W  +T+
Sbjct: 534 VKLAFFSKDNE-----------ALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTL 582

Query: 550 EILMSXXXX--XXXXXPMDEELTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNI 607
           ++++             +D +L  I N+ +K    I S         Q++G +L+ S+ I
Sbjct: 583 QLILELEKSGNQELVNKLDADLETIKNNGLKVLNEI-SMTNTDEMTQQSKGLELLLSMCI 641

Query: 608 LQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEIXXXXXXXXXXXXXXXXXXVWEL 667
           LQ +SG+T+S+  +++L  F+   ++ +S S  G  EI                  VWE 
Sbjct: 642 LQLFSGDTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEH 701

Query: 668 FVGEASQDDIAVLLEILPARENKEGFSKLF 697
           F+ +  ++++ VLL +LP RENK+GF+ LF
Sbjct: 702 FISDIGKNELNVLLAVLPVRENKQGFAHLF 731

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 145/279 (51%), Gaps = 20/279 (7%)

Query: 741  DTEQIDKEATSALVKALNLPESIVNDNGEVHFXXXXXXXXXXXXXXXXXXX--------- 791
            D   IDKEATSAL KALNLPE+IVN+ GEV                              
Sbjct: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESM 845

Query: 792  ---XXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRW 848
                      QLSEIFKRRKEALS I TGN+RK EVKESRENVIAFKHRV+DML I++++
Sbjct: 846  DDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKY 905

Query: 849  AESELKQGGRPEKSVTSKXXXXXXXXXXCVRTTLDKPLAEKVXXXXXXX--XXXXXXXXD 906
             E         EK               CV+ TLDK LA+KV                  
Sbjct: 906  VEGLTLTTENGEK--FGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQI 963

Query: 907  TSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVH--RSPRPET 964
             SL+  ++ + E  L+  HE++L  K GQF +LY+S CST S+FL K+ VH   + +   
Sbjct: 964  ESLNADDDRVME-LLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIA 1022

Query: 965  YFTLTEVYHKTLNEWFVG-GKFSANLFIEFLNWLSIKKQ 1002
            Y  L ++Y +T   W +  GKF  N F +F NWLS ++Q
Sbjct: 1023 YGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  410 bits (1054), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 253/718 (35%), Positives = 382/718 (53%), Gaps = 62/718 (8%)

Query: 6   VDRDLFYKLASDLSEERLQAIIGLVTQLSKV---EKESREWEYVLNRLIKGLSSSRNGAR 62
           VDRDLFYKLASD+ EER+ +++G+V  L K+   ++  +EW YV++RL+KGL S+RN AR
Sbjct: 3   VDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSAR 62

Query: 63  LGYCLCLTEVVASALEKSV------LAHADEYLRLL--------LSTLSRENIKNGKEER 108
           LG+ +CLTE +   L + V      L    +YL+ +        + T   +    GK+ER
Sbjct: 63  LGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDER 122

Query: 109 GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168
           G LFG+LF  +VLLNEPLFS +F      + +F++ +   +I +   K W+ E   F+LY
Sbjct: 123 GTLFGRLFAYKVLLNEPLFSLLF------DQKFLIEFQERVIQLGSMKNWLLEPCFFSLY 176

Query: 169 QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLED 228
           QAIEKL P +  Q+  +A +  +D   LT T+EGL+VYL L            KK  L D
Sbjct: 177 QAIEKLLPGL-DQEYAQATVAQIDEHKLTMTNEGLSVYLLL-----------AKKFTLSD 224

Query: 229 LKL-NSPWKNNDPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFE 287
             L NS WK NDPL KGNL  +A  + + N     S   K  W PRLH++WDIIL  FF+
Sbjct: 225 FTLENSAWKANDPLQKGNLSVMAKVMLDTNVDGANSNTNKN-WAPRLHYIWDIILREFFD 283

Query: 288 GGEYEDXXXXXXXXXXXXXXXXXHQQIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEK 347
             E                     Q+++F  FW++VVDESFFN+K+S ERKY G+L+F+K
Sbjct: 284 N-EQHGSDAKHVYQKKKHDKSKNPQRVEFKSFWQAVVDESFFNDKASPERKYQGYLIFQK 342

Query: 348 AFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFE 407
           A    P S      ++N+ R +INQ   S+R L+K+SQ+ L T+V +C+++P K  P   
Sbjct: 343 AVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKLTPVLT 402

Query: 408 TLALKEHGSISFDQXXXXXXXXXXXXXXXXXDQQLTLLGEVLTNHLFTSLRD------HS 461
            L   E GS++FD                     L  L  + T+ L  S +       + 
Sbjct: 403 ALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEELNP 462

Query: 462 RVRFLLDAMLHLVRAHKS--AADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSK 519
           R++F+LD++L+L+R+ K+    DK  +  +L+S +Q  FF+ D              ++ 
Sbjct: 463 RLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDNE-----------YINN 511

Query: 520 LAVERLYSILADLISADYKSEKVCWPRFTVEILMSXXXXXXXXXPMDEELTEILNSSIKT 579
           +A ERL S+LA+LI     S    WP   +EI+++          +D+ L  +   S+  
Sbjct: 512 IAKERLSSMLAELIV--LPSTDGSWPYLALEIIVTKEKSETLIDSLDDSLVAVKAESLDI 569

Query: 580 FKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSY 639
            K I   +E   K  Q  G + + S+N++Q YSG+ +SI +++DL +F+     +++ ++
Sbjct: 570 LKKI---SELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANF 626

Query: 640 AGFIEIXXXXXXXXXXXXXXXXXXVWELFVGEASQDDIAVLLEILPARENKEGFSKLF 697
            G  EI                  VWE F+ +  +++I +LL  L ARENKEGFS LF
Sbjct: 627 TGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 146/289 (50%), Gaps = 21/289 (7%)

Query: 736  DQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVHFXX--------XXXXXXXXXXXXX 787
            + D E   QIDKE TSAL KALNLP++I+N+NGEV+                        
Sbjct: 738  NADDEKISQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDES 797

Query: 788  XXXXXXXXXXGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVR 847
                       QLSEIFKRRK+ALS + TGN+RK +VKESRENVIAFKHR++DMLEI+++
Sbjct: 798  MDDEKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIK 857

Query: 848  WAESELKQGGRPEKSVTSKXXXXXXXX--------XXCVRTTLDKPLAEKVXXXXXXXXX 899
              E          K VT++                  CV+ TLDKPL EK+         
Sbjct: 858  HIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFS 917

Query: 900  XXXXXXDTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRS 959
                     ++   E +  NSL+ +H  +   K GQF   Y+  CS+ S++L +  +  +
Sbjct: 918  KIRFTLFEDIETSTEIM--NSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTT 975

Query: 960  PRPE---TYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQNS 1005
               E    +  L +VY  T   W   GK+ A +F++F NWL+ KKQ+ +
Sbjct: 976  VEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQRKA 1024

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 89,186,914
Number of extensions: 3453996
Number of successful extensions: 20535
Number of sequences better than 10.0: 57
Number of HSP's gapped: 20542
Number of HSP's successfully gapped: 69
Length of query: 1006
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 886
Effective length of database: 39,721,479
Effective search space: 35193230394
Effective search space used: 35193230394
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)