Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11572g6.8ON51851827950.0
Kwal_56.223416.8ON51951914530.0
SAKL0E00792g6.8ON5115139701e-125
TDEL0G046306.8ON5035128111e-102
Kpol_1045.796.8ON5085157682e-95
NDAI0G00860singletonON5235317466e-92
KNAG0E027706.8ON5085247352e-90
Skud_16.56.8ON5155257256e-89
YPL272C6.8ON5175257203e-88
Smik_6.4806.8ON5165257186e-88
KAFR0B065106.8ON5085237082e-86
TPHA0M001806.8ON5035216993e-85
Suva_16.336.8ON5185256952e-84
NCAS0D021806.8ON5155266882e-83
TPHA0J002606.8ON5155276839e-83
CAGL0A01089g6.8ON5355456142e-72
Ecym_30116.8ON5095336001e-70
TBLA0A072206.8ON5095365433e-62
ACR018C6.8ON4784805248e-60
Kpol_1032.1singletonON2462542555e-24
CAGL0K00737g5.119ON4574641562e-10
Kpol_191.16.8ON1391361072e-05
Kpol_1010.495.119ON4811501117e-05
NDAI0D023605.119ON4701281091e-04
TDEL0E051105.119ON4692951091e-04
KLTH0C02178g5.119ON4641591027e-04
Kwal_27.98985.119ON460298970.003
ZYRO0F01540g5.119ON470151960.004
TPHA0H009605.119ON476135920.012
YGR212W (SLI1)5.119ON468141910.017
Smik_16.945.119ON466135850.080
Ecym_24835.119ON46189830.14
Skud_7.5485.119ON47556761.2
Suva_4.4746.112ON675126751.5
KLLA0D16324g8.321ON697126751.5
Kpol_259.57.256ON874116714.1
KLLA0C07348g8.726ON65249714.7
KAFR0H021808.346ON69845697.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11572g
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...  1081   0.0  
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   564   0.0  
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   378   e-125
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   317   e-102
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   300   2e-95
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              291   6e-92
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   287   2e-90
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   283   6e-89
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   281   3e-88
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   281   6e-88
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   277   2e-86
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   273   3e-85
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   272   2e-84
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      269   2e-83
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   267   9e-83
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   241   2e-72
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   235   1e-70
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   213   3e-62
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   206   8e-60
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   102   5e-24
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    65   2e-10
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    46   2e-05
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    47   7e-05
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    47   1e-04
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    47   1e-04
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    44   7e-04
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    42   0.003
ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {...    42   0.004
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    40   0.012
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    40   0.017
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    37   0.080
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    37   0.14 
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    34   1.2  
Suva_4.474 Chr4 complement(825864..827891) [2028 bp, 675 aa] {ON...    33   1.5  
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...    33   1.5  
Kpol_259.5 s259 (12123..14747) [2625 bp, 874 aa] {ON} (12123..14...    32   4.1  
KLLA0C07348g Chr3 (639956..641914) [1959 bp, 652 aa] {ON} simila...    32   4.7  
KAFR0H02180 Chr8 (414111..416207) [2097 bp, 698 aa] {ON} Anc_8.3...    31   7.2  

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/518 (100%), Positives = 518/518 (100%)

Query: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60
           MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS
Sbjct: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60

Query: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120
           DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP
Sbjct: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120

Query: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180
           PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL
Sbjct: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180

Query: 181 SESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPL 240
           SESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPL
Sbjct: 181 SESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPL 240

Query: 241 RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFI 300
           RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFI
Sbjct: 241 RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFI 300

Query: 301 ISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCS 360
           ISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCS
Sbjct: 301 ISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCS 360

Query: 361 AGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKFKDMD 420
           AGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKFKDMD
Sbjct: 361 AGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKFKDMD 420

Query: 421 MMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSISYS 480
           MMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSISYS
Sbjct: 421 MMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSISYS 480

Query: 481 FSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPKFVC 518
           FSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPKFVC
Sbjct: 481 FSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPKFVC 518

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/519 (53%), Positives = 369/519 (71%), Gaps = 1/519 (0%)

Query: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60
           MS   +VYRNLT TEKTI+CETA G+KNGVLFS+TY++   N D +        M + L 
Sbjct: 1   MSLTKKVYRNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLP 60

Query: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120
           D+++W+AL ++IKE+AELR ++++ ++FE +D I F+DVVRKIEFD   DE+V+CYNGVP
Sbjct: 61  DAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVP 120

Query: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180
           PYLLRHIFDKCHF++GQ++PLWQ+FVID +MVVFHGHDVLFD FAAA FHKLFL+ALNS 
Sbjct: 121 PYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF 180

Query: 181 SE-SCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239
                     +FK  + L  L ++L  +      SS+ D   + SQ  L++LY+LAIKKP
Sbjct: 181 RNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKP 240

Query: 240 LRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTF 299
           LRFIESGR+EHS    S   +  +Y   LCGTVVFG ++  R + L+ ++N+ KIS ++F
Sbjct: 241 LRFIESGRLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300

Query: 300 IISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNC 359
           IIS T+FCL PVL+ SE+KI FS+PINLR+ IPW+S LG++  NVL ECPL     +   
Sbjct: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360

Query: 360 SAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKFKDM 419
            +G    N E LEG TL+D    N DQ DP+++F R +THV+ EL+ A   LE       
Sbjct: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420

Query: 420 DMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSISY 479
           D++K E+EA+++AA+S SKI+EINDL E+DLS+   S+Y + D+C+T SR ++TFMSISY
Sbjct: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480

Query: 480 SFSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPKFVC 518
             S   GLNLGIHYSE   M YFVESFE FL+++P+FVC
Sbjct: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLDSFPEFVC 519

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 206/513 (40%), Positives = 303/513 (59%), Gaps = 18/513 (3%)

Query: 6   RVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD-LSDNETLRSDMNQRLSDSMI 64
           + +R+L+  EK +  +     +NG++F+A Y   F  ++  SDN TL +  +QRLS+S++
Sbjct: 5   KSFRSLSSVEKKLFSQNLNNKRNGLMFAAVYSTCFDKEETWSDNATLLTVKDQRLSNSLV 64

Query: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124
            +AL KVI  + EL   ++ NLEF+PV  I F+DVV+K+EFD Y DE VNC++GVPPYLL
Sbjct: 65  SRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLL 124

Query: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184
           RHIFDK  F   + +PLWQ+ ++D TMV+FHGHDVLFD FAAANFHKLF QALN L +  
Sbjct: 125 RHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPKDG 184

Query: 185 TSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRFIE 244
            +   +FK        P+++++  + +  +  TD F  Q+Q+  +S+YN  IKKPL FI 
Sbjct: 185 PTLECLFKNDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWTIKKPLDFIN 244

Query: 245 SGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFIISAT 304
           +          S   + L   N+LCGT VFG IS  R   LK I+    I + +F+ +  
Sbjct: 245 TNPNSGLKYYQSCYTDILLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIA 304

Query: 305 LFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSY 364
           L CL+P++++    +TFS+P++LR  IP +S  G+ ++NVL+ECPL     +     G  
Sbjct: 305 LLCLKPLVNNFGSSVTFSIPVDLRSTIPQASRFGLCYKNVLVECPLTLI--DDKVFQGLN 362

Query: 365 VSNPELLEGMTLSDANQTNADQADPESL----FERTVTHVSNELKKALQDLETGKFKDMD 420
           V N     G  + +   TN D    ESL    F    THV N LK+  +  E   F D D
Sbjct: 363 VYN-----GYDIRNTKPTNKDPNYEESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDD 417

Query: 421 MMKMEQEAKFYAAASG--SKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFMSIS 478
           + +M    KF     G   +IIE+N+++E      + + + ++D+C TKS+   TFMS+S
Sbjct: 418 IKRM----KFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLS 473

Query: 479 YSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            +FS   GLN+ IHY +   M+ FVE F++F+E
Sbjct: 474 CAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  317 bits (811), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 182/512 (35%), Positives = 287/512 (56%), Gaps = 19/512 (3%)

Query: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKA 67
           +R+L   EK IL ++  G +NGV+F A Y      ++ SD+ TL +  + RL+ S++ + 
Sbjct: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTT--PEEWSDDATLLTYKDSRLNLSLLSRT 60

Query: 68  LLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHI 127
           L K+I +H EL   ++  LEF PV +I  E+V+  + F  Y DE VNC  G PPYLLRHI
Sbjct: 61  LAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHI 120

Query: 128 FDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESCTSP 187
           F++  F  G    LWQ++V+D T+VVFHGHDVLFD F+AANFHK+FLQ LNS+S+S +  
Sbjct: 121 FNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKL 180

Query: 188 RPVFKGGK-ILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRFIESG 246
             +FK  K +LP  P++++   + +  +   D F  Q+Q+  +SLY  A+KKPL +I S 
Sbjct: 181 STIFKLEKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDYINSN 240

Query: 247 RIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFIISATLF 306
             +   E  +   + L   N+LCGT +FG I   R + L  I     I +K+F+   T+ 
Sbjct: 241 PPQQLKEYRTRYADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITML 300

Query: 307 CLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVS 366
           CL+P++ +    ITF +P++LR  +  SS  G++++++ +ECPL      +  S   Y  
Sbjct: 301 CLKPIVKNYTGSITFCVPVDLRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVY-- 358

Query: 367 NPELLEGMTLSDANQTNADQADPESL----FERTVTHVSNELKKALQDLETGKFKDMDMM 422
                 G   S       D    E L    F++   HV   L++ ++  E   F D D+ 
Sbjct: 359 -----NGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIK 413

Query: 423 KMEQEAKFYAAASGSKIIEINDLSEI--DLSNVNPSQYVVEDICATKSRCNNTFMSISYS 480
           +M+  +     A+ +K+I+IND+S+I  D       ++ + ++  T+S      MS+SY+
Sbjct: 414 RMKFGSD--DTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNMTQSLKPGQLMSLSYT 471

Query: 481 FSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512
            S   GL++ IHY +   M  FVE F++F+E+
Sbjct: 472 HSEK-GLDICIHYPDGYNMESFVECFQSFIED 502

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  300 bits (768), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 183/515 (35%), Positives = 281/515 (54%), Gaps = 26/515 (5%)

Query: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKA 67
           +R L   EK ++ +   G  NG++FSA Y  N     L+D+ TL ++    L DS +  A
Sbjct: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISN-AQDGLTDDATLLTNSEPLLLDSRLVNA 62

Query: 68  LLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHI 127
           L K++ +H ELR  V+  LEFE V +I   D++  ++FD   DE VNC+ G PPYLLRHI
Sbjct: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122

Query: 128 FDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL-SESCTS 186
           F++  FT G  +PLW+L VID ++V+FHG DVLFD FAAANFHKLFL+ LNS+  E  T 
Sbjct: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSMDDEHITD 182

Query: 187 PRPVFKGGKILP----TLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKPLRF 242
              +++          + PR +++  + +      D    Q+Q+  +S Y  AIKKPL  
Sbjct: 183 LEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPLDI 242

Query: 243 IESGRIEHSTEQHSGTPEPLNYPNH---LCGTVVFGTISTPRFKILKGILNDHKISMKTF 299
           I      +S       P  +++ N    LCGT VFG I+T RF+ L  I     + +++F
Sbjct: 243 ITF----NSEPMKYIKPNEIDFMNEASALCGTTVFGHITTDRFEYLNSIARHENVCIRSF 298

Query: 300 IISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAG----R 355
           I    L CL+ ++      ITFS+P+NLR+ I   S  G++++ +L+ECPL         
Sbjct: 299 ICGIALLCLKSMIKDFTGSITFSIPVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYN 358

Query: 356 NSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGK 415
           N N   G   SN ++ E            ++   E  F++    VS  +K+ ++      
Sbjct: 359 NINVYNGYDNSNVKVPE-------TDPTFEEKKLEYQFKQISDLVSTTMKERMRAWRRNG 411

Query: 416 FKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKSRCNNTFM 475
           F D D+ KM+  +     AS +KII+IND+SE  +++   S+  ++++  T S  N+ FM
Sbjct: 412 FNDDDIKKMKFTSD--DKASNTKIIQINDVSEFKINSSKSSKVSIKELNFTHSISNSDFM 469

Query: 476 SISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFL 510
           S+SY++    G N+ IHY +  +M  FVE F++F+
Sbjct: 470 SLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  291 bits (746), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 178/531 (33%), Positives = 285/531 (53%), Gaps = 40/531 (7%)

Query: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNF---PNKDLSDNETLRSDMNQRLSDSMIW 65
           R L+  EK +L +T    +NG+ ++A Y        +  LSD  TL +  + RL+  ++ 
Sbjct: 4   RALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGIVT 63

Query: 66  KALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLR 125
           + L ++IK+H EL   ++ N EF+ + KI  EDV+  I FD Y DEQ+NC++G PPYLLR
Sbjct: 64  RVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYLLR 123

Query: 126 HIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQAL------NS 179
           HIF+K  F L   +PLW+L++ID TM++FHG D+LFD F+AANFHKLF   L      N+
Sbjct: 124 HIFNKEKFELN--KPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLTNT 181

Query: 180 LSESCTSPRP-VFK----GGKILPT---LPRALFQKQEPQAASSITDAFYSQSQAILRSL 231
            S+S + P   VFK        +P     PR++F   +    +   D F  Q+++  +++
Sbjct: 182 FSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTKSFFKTI 241

Query: 232 YNLAIKKPLRFIESGRIEHSTE---------QHSGTPEPLNYPNHLCGTVVFGTISTPRF 282
           Y+  IKKP+    +G   H+           Q     + L   + LCGT VFGT+S  R+
Sbjct: 242 YSNTIKKPIDLF-NGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTVSPTRY 300

Query: 283 KILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHR 342
             LKG++   +I +++FI    + CL+P + +    I FS+PINLR+ I  +   G++++
Sbjct: 301 NYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYIDGAKNFGLFYK 360

Query: 343 NVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSN 402
           +V I+CPL     + N     Y       +  ++ D N    ++   E  F++    + N
Sbjct: 361 DVKIDCPLSLID-DRNFKYNGY-------KDSSIPDENDLEFNEKLLEYQFKQVTEFIEN 412

Query: 403 ELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDL--SNVNPSQYVV 460
            + + L+  E   F D D+ +M+ +         SKII+IND +EI L  ++ N   + +
Sbjct: 413 VILERLKIWEKFNFNDDDIKRMKFDHD-EVLGQNSKIIQINDTTEIMLGENDNNNKAFTL 471

Query: 461 EDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            +   T++   N FMS+S++     GLN+ IHY +   M  FVE F+ F+E
Sbjct: 472 TNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTFIE 522

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  287 bits (735), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 277/524 (52%), Gaps = 32/524 (6%)

Query: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLS 60
           MSSV    R L+  EK +L ++  G+KNG  F A Y   F      +  TL +  + RL 
Sbjct: 1   MSSV----RALSSFEKKLLLQSVDGLKNGTTFGAEY-STFKEGWSDEEATLLTVKDSRLC 55

Query: 61  DSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120
             ++ KAL  +IK+H EL   ++   EFE + KI   DV+  I+FD + DE++NC  G P
Sbjct: 56  LGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAP 115

Query: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180
           PYLLRHIF+   F  G  +PLW+L+++D ++  FHG D LFD F+ ANFH+L L+ +N L
Sbjct: 116 PYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLL 175

Query: 181 SESCTSPRP---VFKGG----KILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYN 233
           S      +    VFK G      +  LP++++   +    +   D F  Q+Q+  +S+Y 
Sbjct: 176 SSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYV 235

Query: 234 LAIKKPLRFIESGRIEH-STEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDH 292
             +KKP+ F+ +  +   S   +    + L+  + LCG  VFG +S  RFK L  I+N  
Sbjct: 236 NTVKKPIEFLTNTDVSFLSLNSNMKYNDILDINSKLCGNTVFGCVSNERFKYLNTIINQE 295

Query: 293 KISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGT 352
            + +K+FI+   + CL+P++ +    +TFS+P++LR  +      G+Y++++ +ECPL  
Sbjct: 296 GLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFVDEPRDFGLYYKDIRVECPLSL 355

Query: 353 A--GRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQD 410
               ++ +C  G+ VS  +               D+   E  F+     V N L++ L  
Sbjct: 356 IDDDKSKDCMKGASVSEEDF--------------DEKLMEYQFKNITGFVRNHLEQRLTR 401

Query: 411 LETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLSNVN-PSQYVVEDICATK 467
                F D D+  MK + +     +++    I+I D S I+++    P+ +++     TK
Sbjct: 402 FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTK 461

Query: 468 SRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
           S  +   MS+SY++    GLN+ IHY E+ +M  FVE F++FLE
Sbjct: 462 SLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  283 bits (725), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 285/525 (54%), Gaps = 28/525 (5%)

Query: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNK----DLSDNE----TLRSDMN 56
           +  +R L+  EK +L ++    +NG +FS+TY K+ PN+    D + +E    T  S  +
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKS-PNRGNDADWNSDEVTLGTNSSKDD 59

Query: 57  QRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCY 116
            RL+   I   L ++IK    L   V+   EFEP+ ++   D+V  IEF+   D++VNC+
Sbjct: 60  SRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCH 119

Query: 117 NGVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQ 175
            GVPP YLLRH F+K  F  G  +PLW L+VID  ++VFHGHDVLFD F+AANFHKLFL+
Sbjct: 120 WGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLK 179

Query: 176 ALNSLS-ESCTSPRPVFKGGKILPT---LPRALFQKQEPQAASSITDAFYSQSQAILRSL 231
            LN++S E+ +  R +F    +  +    P++++   +    +     F+ Q+Q+  +S+
Sbjct: 180 ELNNISLEAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI 239

Query: 232 YNLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGI 288
           +   +K+P  ++    S     ST Q     + LN  + LCGT VFG ++  RF  LK I
Sbjct: 240 FYNTLKRPFGYLTNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLKSI 299

Query: 289 LNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIEC 348
           +N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + IEC
Sbjct: 300 VNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIEC 359

Query: 349 PLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKAL 408
           PL     +   SA  +++N    E     D ++ N      E  F +   HVS+ +   L
Sbjct: 360 PLSLI--DDELSADEFLANRNDKE-----DDDEFNEKLM--EYQFNKVTKHVSDFIMAKL 410

Query: 409 QDLETGKFKDMDMMKMEQEA-KFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466
           +  E   F D D+ +M+ +    +   S +K+I+IND+S+I LS N +   + +     T
Sbjct: 411 KSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFT 470

Query: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 471 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  281 bits (720), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 180/525 (34%), Positives = 280/525 (53%), Gaps = 26/525 (4%)

Query: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD----LSDNETLRSDMNQ--- 57
           +  +R L+  EK IL ++    +NG +FS+TY K+   ++     SD  TL ++ ++   
Sbjct: 1   MTTFRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117
           RL+  +I   L ++IK    L   V+   EFEP+ ++   D+V  IEF+   D++VNC+ 
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176
           GVPP YLLRH F+K  F  G  +PLW L+VID  ++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 177 LNSLSESCTSP-RPVFKGGKI-LPTL--PRALFQKQEPQAASSITDAFYSQSQAILRSLY 232
           LN +S    S  R +F    I L  L  P++++   +    +     F+ Q+Q+  +S+Y
Sbjct: 181 LNEISTVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIY 240

Query: 233 NLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289
              +K+P  ++    S     S  Q     + LN    LCGT VFG ++  RF  LK I+
Sbjct: 241 YNTLKRPFGYLTNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYLKSIV 300

Query: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349
           N   I +++FI    + CL+P++      I F++PINLR+ +     LG++ + + +ECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECP 360

Query: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409
           L     +   SA  +++N    E        +    Q      F +   HVS  +   L+
Sbjct: 361 LSLI--DDELSANEFLTNSNDNEDNDDEFNERLMEYQ------FNKVTKHVSGFIMAKLR 412

Query: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466
             E   F D D+  MK + +  F+   S +K+I+IND+S+I LS N +   + +     T
Sbjct: 413 SWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFT 472

Query: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 473 SSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  281 bits (718), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 173/525 (32%), Positives = 281/525 (53%), Gaps = 27/525 (5%)

Query: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKD----LSDNETLRSDMNQ--- 57
           +  +R L+  EK +L ++    +NG +FS+TY K+   ++     SD  TL ++ ++   
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117
           RL+  +I   L ++IK    L   ++   EFEP++++   D+V  IEF+   D++VNC+ 
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176
           GVPP YLLRH F+K  F  G  +PLW L+VID T++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 177 LNSLSE-SCTSPRPVFKGGKILPT---LPRALFQKQEPQAASSITDAFYSQSQAILRSLY 232
           LN++S  +    R +F    +  +    P++++   +    +     F+ Q+Q+  +S++
Sbjct: 181 LNNISSVTHYEDRILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIF 240

Query: 233 NLAIKKPLRFI---ESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289
              +K+P  ++    S     S  Q     + LN  + LCGT VFG +S  RF  LK I+
Sbjct: 241 YNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYLKSIV 300

Query: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349
           N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + I CP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKELRIACP 360

Query: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409
           L     +   S   +++N    E     D           E  F     HVS+ +   L+
Sbjct: 361 LSLI--DDELSVNEFLANSNDNEEDEEFDEKLM-------EYQFNNVTKHVSSFIMAKLK 411

Query: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLS-NVNPSQYVVEDICAT 466
             E   F D D+  MK + + +F+   S +K+++IND+S+I LS N +   + +     T
Sbjct: 412 SWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGFT 471

Query: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            S    T +S+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 472 SSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  277 bits (708), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 166/523 (31%), Positives = 282/523 (53%), Gaps = 38/523 (7%)

Query: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKAL 68
           R L+  E+ IL ET    +NGV+F+A+Y  +  +++  D+ TL +  + R + +++ KA+
Sbjct: 4   RTLSSYERKILDETIRRERNGVIFTASYSAS--SEEWGDDTTLLTLKDSRPTIAILTKAI 61

Query: 69  LKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHIF 128
            ++I  H EL   ++ N EFE +  I  +D++  +EFD Y DE++NC+NG PPYLLRHIF
Sbjct: 62  QRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHIF 121

Query: 129 DKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALN---------S 179
           D   F  G K+PLW L +ID ++V+FHG D+LFD F+AANFHKL L+  N         S
Sbjct: 122 DNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDSS 181

Query: 180 LSESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239
            S+   S     K    L  L ++++        ++  D F  Q+Q+  +S+++  +KKP
Sbjct: 182 ESDIIFSLENSIKKINNLK-LSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVKKP 240

Query: 240 LRFIESG-RIEHSTEQHSGT--------PEPLNYPNHLCGTVVFGTISTPRFKILKGILN 290
           + ++ +  R +  T  ++ +         +  +Y   L  T VFG I+  R++ L  ++ 
Sbjct: 241 IHYLVANVRTKEVTSDNTLSRVTTVQKYTDIFDYNTTLNNTTVFGKITRQRYEYLNSLIT 300

Query: 291 DHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSS-PLGIYHRNVLIECP 349
           + +I  K+F++   + CL+P +++ E  + FS+ INLR  +  S+   G+++++VLI+ P
Sbjct: 301 NQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFLKESNIEFGLFYKDVLIDVP 360

Query: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409
           L                N  +L G      N  +  +   E  F+R  + V + +++ + 
Sbjct: 361 LSLID-----------DNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDLIERRIS 409

Query: 410 DLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDL-SNVNPSQYVVEDICATKS 468
              T  F D D+ +M    K+   A  +KII + D SE+ L S     +Y++ +   TKS
Sbjct: 410 KFSTMGFNDDDIRQM----KYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFTKS 465

Query: 469 RCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
              N F S+SY+     GLNL + + +DC+M  FVE F++F+E
Sbjct: 466 LRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  273 bits (699), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 173/521 (33%), Positives = 280/521 (53%), Gaps = 36/521 (6%)

Query: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSD-NETLRS--DMNQRLSDSMI 64
           +R L   EK +L +T  G +NGV+FS+    N  + + +D N TL +   +N+    S++
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSVL 62

Query: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124
             AL  +I  H EL   ++  L F PV +I+  DV++ I +D   D+ +   + +   LL
Sbjct: 63  CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKLL 121

Query: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184
           RHIF+KC F     +PLWQ  + + + ++FHGHDVLFD F+ ANF K  L+ +N +  S 
Sbjct: 122 RHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSN 181

Query: 185 TSPRPV-----FKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKKP 239
              + V     F   + L   PR++++  +    +  +D    Q+Q+  +++Y   +KKP
Sbjct: 182 QKLKTVKTLFKFDAERSLTNYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTLKKP 241

Query: 240 LRFIESGRIEHS---TEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKISM 296
           +  I S    ++   +E  +   + L+  N LCG  V G IS  R++ LK ++    IS+
Sbjct: 242 IDLITSANSNNNNQLSEYRTRNTDILSGANSLCGRTVLGEISLERYQHLKMLVEQENISL 301

Query: 297 KTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRN 356
           ++FI + T+ CL+P++ + +  I FS+P+NLR LI  SS  G++++N+ +ECPL      
Sbjct: 302 RSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLEL---- 357

Query: 357 SNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGKF 416
              +   Y +NPE+L  M          + +  E  FER   HVS+ + + ++  E   F
Sbjct: 358 --INDEKYYTNPEVLHSM---------QNNSLLEIQFERISRHVSDVISQRMKAWEKFGF 406

Query: 417 KDMDM--MKMEQEAKFYAAASGSKIIEINDLSEI--DLSNVNPS-QYVVEDICATKSRCN 471
            D D+  MK   + K   A     II+IND++EI  D  N N S  + V ++  TKS   
Sbjct: 407 NDDDIKRMKFSNDEKTGIAP----IIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSC 462

Query: 472 NTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512
           N FMS+ YS ++  GLN+ IHY +   M  FVE F++F+EN
Sbjct: 463 NEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  272 bits (695), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 280/525 (53%), Gaps = 25/525 (4%)

Query: 5   LRVYRNLTPTEKTILCETATGVKNGVLFSATYYKNF---PNKDLSDNE----TLRSDMNQ 57
           +  +R L+  EK +L ++    +NG +FS+TY K+     + D   +E    T  S  + 
Sbjct: 1   MTTFRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDS 60

Query: 58  RLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYN 117
           RL+  +I   L K+IK    L   V+ + E+ P+ ++   D+V  IEF+   D++VNC+ 
Sbjct: 61  RLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHW 120

Query: 118 GVPP-YLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQA 176
           GVPP YLLRH F+K  F  G  +PLW L+VID T++VFHGHDVLFD F+AANFHKLFL+ 
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 177 LNSL-SESCTSPRPVFKGGKI---LPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLY 232
           LNS+ S S +  R +F    +     + P++++   + +  +      + Q+Q+  +S++
Sbjct: 181 LNSITSVSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFFKSIF 240

Query: 233 NLAIKKPLRFIESGRIEHS---TEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGIL 289
              +K+P  ++ +     S   T Q     + LN  + LCGT VFG ++  RF  LK I+
Sbjct: 241 YNTLKRPFGYLTNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFSYLKSIV 300

Query: 290 NDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECP 349
           N   I +++FI    + CL+P++      I FS+PI+LR  +     LG++ + + IECP
Sbjct: 301 NQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECP 360

Query: 350 LGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQ 409
           L       +        N  L+      + +    ++   E  F +   HVSN +   L+
Sbjct: 361 LSLIDDELSI-------NEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLK 413

Query: 410 DLETGKFKDMDM--MKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQ-YVVEDICAT 466
             E   F D D+  MK + +  F+   S +K+I+IND+S+I LS  N  + + +     T
Sbjct: 414 SWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFT 473

Query: 467 KSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            S    T MS+SY++    GLN+ IHY +   +  FVE FE+F+E
Sbjct: 474 NSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  269 bits (688), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 180/526 (34%), Positives = 279/526 (53%), Gaps = 38/526 (7%)

Query: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNE--TLRSDMNQRLSDSMIWK 66
           R L+  E  +L +T  G +NGV F+A Y +N+ +  LS ++  TL S  ++RL+ S+I +
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 67  ALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRH 126
            L  +I +H EL  A+S +  +  V +I  +DV+  I FD   DE++NC+ G PPYLLRH
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 127 IFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESCTS 186
           IF+K  F LGQ++PLW+L++ID T ++FHG D+LFD+F+AA FHK FL  +NS   S  S
Sbjct: 124 IFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIVS 183

Query: 187 PRP------VFKGG------KILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNL 234
            +       +F+        KI   +PR+++       A      F  Q+++  +SLY  
Sbjct: 184 SKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAVMFNDQTKSFFKSLYLN 243

Query: 235 AIKKPLRFIESGRIEHSTEQH------SGTPEPLNYPNHLCGTVVFGTISTPRFKILKGI 288
           A+KKP+ FI +   +  T Q        G   P+     LCG  +FGTIS+ RF  L   
Sbjct: 244 AVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNELTEK 303

Query: 289 LNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIEC 348
               +IS+K+ I    +  L+P L+     + FS+ +NLRD +  S   G+Y+R+++IEC
Sbjct: 304 ATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRDDVSKSKTFGLYYRDIIIEC 363

Query: 349 PLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKAL 408
           PL      +   +G Y  +     G+T   A +    +   E  F+   T++ N + + +
Sbjct: 364 PLSLIDDRAIQFSG-YRDHV----GIT---AQELETYEKVYEQQFKDVTTYIQNVMNEKI 415

Query: 409 QDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQ---YVVEDICA 465
              +T    D D+  M+     +   S  +II+INDL+EID+ N N SQ   Y V+    
Sbjct: 416 GYWKT----DNDIKMMKMMDDMH--QSKDEIIQINDLTEIDI-NENLSQNDPYCVKSSSM 468

Query: 466 TKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
             S       S+SY+     GL + IH  +   M  FVE+F+AFL+
Sbjct: 469 VTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  267 bits (683), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 270/527 (51%), Gaps = 41/527 (7%)

Query: 8   YRNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSD----MNQRLSDSM 63
           +R L   E+ +L E+     NG +FSA Y       D+  N T+  D    + Q   ++M
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKY------TDMQTNSTINDDAATLLTQNEENNM 56

Query: 64  IWK---ALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVP 120
             +   AL  VI E+ EL   ++  LEFEP+ +I  +DV+  I+F+   DE VNC NG P
Sbjct: 57  FSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAP 116

Query: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSL 180
           PYLLRHIF+K  F  G  +PLW L+++D ++V+FHG DVLFD ++AA+FH+ F  AL   
Sbjct: 117 PYLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGA 176

Query: 181 SESCTSPRPVFKGGKILPT-----LPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLA 235
           + +      +F+   +  +      P++++        +   D    Q++  L+S+ +  
Sbjct: 177 TPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKT 236

Query: 236 IKKPLRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDHKIS 295
           I KPL  I        +  +S   + L   + LCGT VFG IS  RF  L+ I  +  + 
Sbjct: 237 IVKPLNIIMFNDEPMKSFTNSDPMDILEKTSSLCGTTVFGNISNERFDYLQSIAEEENVC 296

Query: 296 MKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGR 355
            K+ +   T+ CL+P++      ITFS+ +NLRD I  S+  G++++NV IE PL     
Sbjct: 297 TKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTEFGLFYKNVRIEVPLSFIDD 356

Query: 356 NSNCSAGSYVSNPELLEGMTLSDANQTNADQADP---ESL----FERTVTHVSNELKKAL 408
           N      SY             DA+ +N  + +P   E L    F +  T +S  LK+ +
Sbjct: 357 NVFKLKTSYNG----------YDASNSNIKETNPNYEEQLIAYQFNQIATFISRNLKQRM 406

Query: 409 QDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYV----VEDIC 464
           +      F D D+  M+  +K     + +KII+IND+S++    +N +  +    ++D+ 
Sbjct: 407 RAWRRNGFNDDDIKMMKFGSK--DKNTSAKIIQINDISDLSFCPMNKNGELNSVSLKDLS 464

Query: 465 ATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
            T S   + FMS+SY+   + G N+ IH+ E  ++  FVE F+ F++
Sbjct: 465 FTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  241 bits (614), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 276/545 (50%), Gaps = 56/545 (10%)

Query: 9   RNLTPTEKTILCETATGVKNGVLFSATY-YKNFPNKDL----SDNETL-------RSDMN 56
           R+L+  E+ +L E     KNG +F A+Y + +    D      DN+TL       RS   
Sbjct: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62

Query: 57  QRLSDSM--IWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVN 114
             LS ++  + +AL  +I+++ E+   V+  LEF P+ +I   DV+  + FD   DE+VN
Sbjct: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122

Query: 115 CYNG-VPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLF 173
           C++G  PPYL+RHI     F  G  +PLW L++ID + +VFH  D+LFD F+AANFHKLF
Sbjct: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182

Query: 174 LQALNSLSESCTS-PRP---VFKGGKILP---TLPRALFQKQEPQAASSITDAFYSQSQA 226
           L+ L ++     S  +P   +FK  K      ++P++++   +    ++  +    Q+Q+
Sbjct: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242

Query: 227 ILRSLYNLAIKKPLRFIESGRIEH--------------STEQHSGTPEPLNYPNHL---- 268
             +S++  A+KKPL FI+                    S E +        Y N L    
Sbjct: 243 FFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSAT 302

Query: 269 --CGTVVFGTISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPIN 326
             CG  +FG++S  RF  L  ++ + KI +++FI + T+ CL+P++ S    + FS+P+N
Sbjct: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362

Query: 327 LRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQ 386
           LRD +      G+ ++++ +ECPL           G   S+PE  E +            
Sbjct: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEYNEKLL----------- 411

Query: 387 ADPESLFERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLS 446
              E  F++  T+V+  +++ +   +   + D DM +M+        A  +++I+IND+S
Sbjct: 412 ---EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVS 468

Query: 447 EIDLSNVNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESF 506
           E+   + +     ++    T S   NT MS+SY+     GLN+ IHY +   M  FV+ F
Sbjct: 469 EVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528

Query: 507 EAFLE 511
           E+F+E
Sbjct: 529 ESFME 533

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  235 bits (600), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 160/533 (30%), Positives = 272/533 (51%), Gaps = 43/533 (8%)

Query: 1   MSSVLRVYRNLTPTEKTILCETATGVKNGVLFSATYYKN-FPNKDLSDNETLRSDMNQRL 59
           M+++    R+L+  EK    E  T  +NG++F+  Y  N   ++  SD+ TL +  + RL
Sbjct: 1   MATIASSIRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRL 60

Query: 60  SDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGV 119
            D  I  AL  +IKE+ EL   ++ + +F P + I ++DVV  IEF  Y DE + C NG+
Sbjct: 61  FDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGI 120

Query: 120 PPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNS 179
           PPY+LR+I +   F  G  +PLW+L ++D TMV+ H H+V+FD FAAANFH  F +AL+ 
Sbjct: 121 PPYILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQ 178

Query: 180 LSESCTSPRP--VFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIK 237
             +   +     V++G ++   L +  F     Q + S   +   Q  ++L+  Y   +K
Sbjct: 179 FPKDTHALDILFVYEGNEL--QLSKTNFDGM-SQISVSPVQSLPLQCISVLKGAYRTTVK 235

Query: 238 KPL-----RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDH 292
           K L      F+ + +I       S   + +  PN LCGT V G+++  R   L  + +  
Sbjct: 236 KSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLCGTTVSGSLNAERLASLLELTSSE 295

Query: 293 KISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPLGT 352
            + M + + + TL  L+P++      ITF +PI++R+ +     LG+ + N+++ECPL  
Sbjct: 296 NVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-LGVSYTNLMVECPL-- 352

Query: 353 AGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPES----------LFERTVTHVSN 402
                     S++++ +     T+SD N  +  + DP S           F++  +HV N
Sbjct: 353 ----------SFINDKDFQH--TVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTSHVMN 400

Query: 403 ELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVED 462
            LK+  Q  +  +F DM  +K ++  +      G K IEIN    +D+      Q+  ++
Sbjct: 401 SLKEKKQAWQKRRF-DMSSLKGKKLRRSNKIIRG-KFIEIN---LVDMGEAQDGQFHTKN 455

Query: 463 ICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLENYPK 515
           +  T S  +   +S+S +     G+N+ +HY E  +M+ FVE F+  LE+  K
Sbjct: 456 VNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLAK 508

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  213 bits (543), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 154/536 (28%), Positives = 273/536 (50%), Gaps = 65/536 (12%)

Query: 6   RVYRNLTPTEKTILCET-ATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMI 64
           +V R L+  EK  L  +  +  ++G + S  +  N  + D+SD+ TL S  ++ L+ S++
Sbjct: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSN--SLDISDDATLLSSKDKPLTISLV 67

Query: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124
            +AL  +I  H E+   +++N EF+ +DKI+  DV+  I F+   DE VNC++G PPYL+
Sbjct: 68  SRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLI 127

Query: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184
            +IF   +F    K+PLWQLF+++ ++VVF+G D LFD FA ANF KL  + +NSL    
Sbjct: 128 NYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYEN 187

Query: 185 TSPRP--VFKGGKILP----TLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKK 238
              +   +FK   I        P++++        ++  + F  Q+Q+  +S+Y    KK
Sbjct: 188 KEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247

Query: 239 P---LRFIESGRI----EHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILND 291
               L F +   I     H+  ++    E L+  + +   +V G +S  R+  L  +++ 
Sbjct: 248 SFDYLNFTQQTPIILARNHNISKNYN--EILHLNSIVKSELVTGNVSMERYLQLLKLIDA 305

Query: 292 HKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPW---------------SSP 336
            KI +K+F  S  + CL+ ++   +  I F +P NLR +                  ++ 
Sbjct: 306 EKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANE 365

Query: 337 LGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERT 396
           LGI ++++ +E PL                  +L+E +   D           E  F+  
Sbjct: 366 LGIIYKDIYVEVPL------------------KLIEKIGNEDV---------VEEQFKIV 398

Query: 397 VTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPS 456
             +++  ++K ++  E   F D D+ +M    KF     G+ IIE+NDL+ +DLS    S
Sbjct: 399 CNYINESIQKRIKAWEKNGFNDDDIKRM----KFGYEQVGN-IIEVNDLTSLDLSCSKDS 453

Query: 457 QYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512
            + +ED+  T++   N  +S+S++ ++  GLNL I+YS + +M  F++ F++F+EN
Sbjct: 454 LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  206 bits (524), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 153/480 (31%), Positives = 241/480 (50%), Gaps = 47/480 (9%)

Query: 46  SDNETLRSDMNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEF 105
           SD+ TL S     L +  I  AL  +I+E+ E+   V+   +F PV +I+++DVVR IEF
Sbjct: 29  SDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEF 88

Query: 106 DCYADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFA 165
             Y DE + C++G+PPY+ RHI +K  F  G  +PLW++++ DG+MV+FH H+VLFD FA
Sbjct: 89  QTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFA 146

Query: 166 AANFHKLFLQALNSLSESCTSPRP------VFKGGKI-LPTLPRA--LFQKQEPQAASSI 216
           A NFH  F QAL    + C    P      V++GG + LP  P A  L     P  ASS 
Sbjct: 147 AGNFHVRFQQAL----QRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASS- 201

Query: 217 TDAFYSQSQAILRSLYNLAIKKPLRFIESG-----RIEHSTEQHSGTPEPLNYPNHLCGT 271
              F S  + + R  Y L   KP   + S      R+  S+         L+    L GT
Sbjct: 202 --PFVSFVKNVCR--YAL---KPFGALASAVTPSLRLNRSSLGRKPFLLTLD-KESLYGT 253

Query: 272 VVFGTISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLI 331
            V G +++ +   L  +++  ++ +++F+ + TL  L+P++ + +  I FS+P++LR   
Sbjct: 254 TVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTES 313

Query: 332 PWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPES 391
             ++P G   + +L++CPL       +    S  + P       L D N     +   E 
Sbjct: 314 HKTTPFGFQSKRILVDCPLALI---DDRVFESLFNRPSKQRKTKL-DKNSPKFSEGLLEY 369

Query: 392 LFERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLS 451
            F+R  THV   L        TGK K     K +   K        KIIEIN    +D+ 
Sbjct: 370 QFKRVTTHVMKSLTAQTSGDWTGKRK---YSKCQLRKK--------KIIEIN---VVDMG 415

Query: 452 NVNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511
               +++ ++++  T S  + TFMS+S +     G+N+ +HY E   M+ FV+ F+ FL+
Sbjct: 416 TSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  102 bits (255), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 124/254 (48%), Gaps = 24/254 (9%)

Query: 262 LNYPNHLCGTVVFGTISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITF 321
           L   +++   V+FGTI+  RF  LK ++   +I +++ I    + C +P + + +  I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 322 SLPINLRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQ 381
           S+ ++++ ++  SS  GI  +N++++CPL                  +L++     D + 
Sbjct: 74  SIGVDMKPIVDDSSQFGILKKNIIVDCPL------------------KLIDDKHYKDTDS 115

Query: 382 TNADQADP-ESLFERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKII 440
            +    D  E  F +    V+ EL   LQ +    FK  +       +   +  S SK+I
Sbjct: 116 ESIKNGDILEIQFRKVTDFVTEELSNKLQSM-AKHFKRNNC--PFNFSSINSQISDSKVI 172

Query: 441 EINDLSEIDLSNV--NPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCE 498
           +INDL++I  +    NP+ Y   D+  T+    N  MS+SY  +S   +++ IHY+E   
Sbjct: 173 QINDLTDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKY 232

Query: 499 MNYFVESFEAFLEN 512
           M+ FVE F  F+EN
Sbjct: 233 MDSFVECFRTFIEN 246

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 97/464 (20%), Positives = 192/464 (41%), Gaps = 69/464 (14%)

Query: 67  ALLKVIKEHAELRC-AVSRNLEF--EPV-DKIDFEDVVRKIEFDCYADEQVNCYNGVPPY 122
           AL +V+  H +L C A   N E    P+ + I F+DVV  +++D Y +E++N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 123 LLRHIFDKCHFTLGQKQPLWQLFVI-DGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLS 181
               +F K +F  G  +PLW++ V+     ++F    + FD  A   F    L++L  L 
Sbjct: 95  ----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEELK 150

Query: 182 E--SCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLA---- 235
           +         +++ G    ++ +    ++ P   S      +   + I+++L+ +A    
Sbjct: 151 QDNDLDVDEIIYRPGGSTDSIDQCHPYEKLPIPFS------WKVKRPIVKALFTIAPGAV 204

Query: 236 ---IKKPLRFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILNDH 292
                  ++F E    E   +++S         N      +   +S+ + K++      H
Sbjct: 205 VSQDASIIQFDEYKIPEDYLKKNSNDDGCYQIKN--TNRQISLKMSSNKLKVIMKDCKQH 262

Query: 293 KISMKTFIISATLFCLQ--PVLDSSEDKITFSLPINLRDLIPWSSPLGIYHRNVLIECPL 350
            +S   ++ +     L   P    S   I + +P+N R+ I                   
Sbjct: 263 HVSFTAYLTAVLYLALGKIPKEKYSGSTIKYEVPMNTRNRI------------------- 303

Query: 351 GTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKA--L 408
             +G  SN S G++V+  E +E +   + ++    Q+  + + E++ T V + + +A  L
Sbjct: 304 SNSGEYSN-SYGTFVAGGEFIETLDF-ERDEWELAQSIHKKIVEKSTTGVMDAINEARLL 361

Query: 409 QDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPSQYVVEDICATKS 468
           + ++  KF     MKM    KF      S   E+ +L   + S    S+Y V D    + 
Sbjct: 362 ELVDAKKF-----MKM----KFETTTGPSSTFEVTNLGFQNFSQNEHSKYTVTDAFFNEP 412

Query: 469 RCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512
           +     ++ S   + + GLN  + Y E  +++  + +  AFL+N
Sbjct: 413 QLFTNLITYSVISTPSGGLNCSMAYPE--KLDSILCNSVAFLKN 454

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 1/136 (0%)

Query: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKAL 68
           R L  +EK+ L +T+ G  NG++FS    K   + +LSD+ TL +         ++ K+L
Sbjct: 3   RILNESEKSALKQTSEGSMNGIIFSVKISKKCED-NLSDDATLHTTGESGNLQLLLLKSL 61

Query: 69  LKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHIF 128
             +I ++ EL   V  NL F  +D++   DVV+ I +     +     +G    L+  I+
Sbjct: 62  KLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121

Query: 129 DKCHFTLGQKQPLWQL 144
              +F  G  +P  +L
Sbjct: 122 YHSNFQPGSGKPYGKL 137

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 71/150 (47%), Gaps = 25/150 (16%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSR------NLEFEPV--DKIDFEDVVRKIEFD 106
           +NQ  + + I  AL K + ++ +LRC V +      ++ F  +  +KI F D+V    +D
Sbjct: 31  LNQLPTRTQIIHALRKSVAKYQQLRCNVMKAGDSEDDIYFNDIGNEKIYFADIVEYKNWD 90

Query: 107 CYADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVID--GTMVVFHGHDVLFDTF 164
             ++  +N            IF +  F     +P+W++ V++    +++   H VLFD  
Sbjct: 91  SVSESNINS-----------IFQEYSFEYFTDKPVWKILVLENQNQLLMLLDH-VLFDGM 138

Query: 165 AAANFHKLFLQAL---NSLSESCTSPRPVF 191
           +  NF   F+ +L   +S+SE   +   +F
Sbjct: 139 SGINFWNSFISSLPSIDSISEDANANELIF 168

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 21/128 (16%)

Query: 64  IWKALLKVIKEHAELRCAVSRNLE-----FEPVDK--IDFEDVVRKIEFDCYADEQVNCY 116
           ++KAL   I  + +L   +++N E      E + K  I+FEDVV  + ++ + ++++N  
Sbjct: 41  LYKALQDTIATYPQLHQNITKNKEDEYLYVEDIKKTPIEFEDVVEFVAWEKFEEKEINS- 99

Query: 117 NGVPPYLLRHIFDKCHFTLGQKQPLWQLFVID--GTMVVFHGHDVLFDTFAAANFHKLFL 174
                     IF   +F     +PLW++ V+    T ++   H  LFD  +A    + F+
Sbjct: 100 ----------IFQTYNFHYRNDRPLWKILVVPSLNTFILLLDH-ALFDGISAVKIWETFM 148

Query: 175 QALNSLSE 182
           + LN  SE
Sbjct: 149 EKLNKSSE 156

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 111/295 (37%), Gaps = 47/295 (15%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSRNLE-----FEPVDKIDFEDVVRKIEFDCYA 109
           +NQ      I  AL   I  H +L   V+ + E      + VD I F+DVV  + +D + 
Sbjct: 32  LNQLPDKHQIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFD 91

Query: 110 DEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHD-VLFDTFAAAN 168
           D  + C          HIF   +F    ++PLW++ V      +    D  LFD  +A  
Sbjct: 92  DNTI-C----------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVI 140

Query: 169 FHKLFLQALNSLSESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAIL 228
           F K F+ +L+S +           G  ++      +++      +S++T A        +
Sbjct: 141 FWKSFMSSLSSDARDDFDLLYELTGDPMVQE-DSHVYENWPTSWSSTLTKAIAGVIFKFM 199

Query: 229 RSLYNLAIKKPLRF----IESGRIEHSTEQHSG-----TPEPLNY---PNHLCGTVVFGT 276
            S+     K  LRF         + H  +  S          LN    P+HL G +    
Sbjct: 200 PSVITSVGKDQLRFNGYSFPDSLLTHKPDDDSSYEIRNNNRQLNLQVQPDHLNGII---- 255

Query: 277 ISTPRFKILKGILNDHKISMKTFIISATLFCLQPVL---DSSEDKITFSLPINLR 328
                          H++S+ +FI +     LQ  +   D S  KI   +P+N R
Sbjct: 256 ----------SACKSHQVSLTSFITALISMSLQLKIEDGDYSGSKIMIDIPMNTR 300

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 17/159 (10%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRC-AVSRN--LEFEPVDK-IDFEDVVRKIEFDCYAD 110
           +N+  + S I +A+  V+ E+ +L    V+RN  L  EP+   +   DVV   E +   +
Sbjct: 29  LNKSPTRSEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDE 88

Query: 111 EQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVI-DGTMVVFHGHDVLFDTFAAANF 169
           E  N            IF +  F  G ++PLW++ ++ D    V     ++ D  +A  F
Sbjct: 89  EHSN-----------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVF 137

Query: 170 HKLFLQALNSLSESCTSP-RPVFKGGKILPTLPRALFQK 207
              F+++LN+     T P   VFK    +  +P+  + +
Sbjct: 138 WGSFMRSLNASHADSTFPDEVVFKPSPNIAHVPQHPYSR 176

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 127/298 (42%), Gaps = 46/298 (15%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEF---EPV-DKIDFEDVVRKIEFDCYAD 110
           +NQ  S S I  A+   ++E   L   V    E    EP+ ++I  E V+   ++    +
Sbjct: 29  LNQSPSRSEICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDE 88

Query: 111 EQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVIDG--TMVVFHGHDVLFDTFAAAN 168
           +  N            IF +  FT G  +PLW++ V++   T+V+   H V+ D  +   
Sbjct: 89  DICN-----------KIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDH-VILDGLSTVA 136

Query: 169 FHKLFLQALNSLSESCTSPRPVFKGGKILPTLPRALFQKQEPQAASSITDAFYSQSQAIL 228
           F K FL +LN+ + +      VF+     P++  ++   Q P     +T  F + ++A++
Sbjct: 137 FWKKFLGSLNATASTSLVSEVVFE-----PSVHNSVV-PQHPYDRIPVT-FFETMARALV 189

Query: 229 RSLYNLAIKK----------PL--RFIESGRIEHSTEQHSGTPEPLNYPNHLCGTVVFGT 276
           + L  LA  K          PL  ++++    +  T  +      +   N L   V    
Sbjct: 190 QVLVFLAFLKIDLITTLFVPPLQKQYLKFKNYQF-TRDYLAADGSVRNDNRLLKIV---- 244

Query: 277 ISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSE---DKITFSLPINLRDLI 331
           I   + + L  +   H +S+ + I++     L+ V DSS+    +   S+P+N R  I
Sbjct: 245 IPPQKLQNLLALCKGHNVSLSSLILAIMANSLKHV-DSSQFDGTRAKISIPMNTRPFI 301

>ZYRO0F01540g Chr6 complement(124663..126075) [1413 bp, 470 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212W SLI1 N-acetyltransferase confers resistance to
           the sphingolipid biosynthesis inhibitor myriocin (ISP-1)
           by inactivating it co-operates with Ypk1p in mediating
           resistance to myriocin converts myriocin into N-acetyl-
           myriocin
          Length = 470

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 74/151 (49%), Gaps = 21/151 (13%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSRNLE-----FEPVDK-IDFEDVVRKIEFDCY 108
           +NQ  S + I  AL   I    +LRC V  + E      + +D+ ++ +DVV  +++  +
Sbjct: 33  LNQLPSRTQIQHALKSTIDTFIQLRCNVGIDEEDGKPYLKIIDQSLELKDVVEFVDWAKF 92

Query: 109 ADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVI--DGTMVVFHGHDVLFDTFAA 166
            ++++N           ++F    F    ++PLW++ VI  +  +V+   H VLFD  A 
Sbjct: 93  DEDKMN-----------YVFQNYAFPYHTEKPLWKVLVIPNERKLVLLMSH-VLFDGMAG 140

Query: 167 ANFHKLFLQALN-SLSESCTSPRPVFKGGKI 196
               + FL+ LN S++    +   V++ G+I
Sbjct: 141 VIILQEFLKNLNQSMNAIENTISTVYEPGEI 171

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 67/135 (49%), Gaps = 21/135 (15%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSRNLE-------FEPVDKIDFEDVVRKIEFDC 107
           +N+  +++ +  +L KVI ++  LRC +++N +        E  ++   +DV+   +++ 
Sbjct: 31  LNKLPTENELCSSLRKVIAKNRILRCNINKNGDSAYINDIIENDNEFTVQDVIEYRDWNK 90

Query: 108 YADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVID--GTMVVFHGHDVLFDTFA 165
           + +++ N            +F + +F  G+ +PLW+L +     T+V+   H   FD  +
Sbjct: 91  FEEDEQN-----------SVFQEINFKYGELKPLWKLIIASKINTIVLAMDH-TFFDGSS 138

Query: 166 AANFHKLFLQALNSL 180
           A  F K  L  L+S+
Sbjct: 139 ATLFWKALLLELSSI 153

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 55  MNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDF-EDVVRKIEFDCYADEQV 113
           +N+    S +  AL   + +H  L C    N+ ++ + K +F ++++  ++F C   E  
Sbjct: 30  LNELPKKSQLIAALKYTVIQHERLTC----NVFYDELKKENFLQNILEPLKF-CDLVEYR 84

Query: 114 NCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVI--DGTMVVFHGHDVLFDTFAAANFHK 171
           + ++ +    + HIF + +F+  + +PLW++ ++     M++   H VL D  +A +  +
Sbjct: 85  HDWDQLGETEINHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDH-VLMDGMSAIHVWE 143

Query: 172 LFLQALN-----SLSESCTSP 187
            F++ L       + E+  SP
Sbjct: 144 TFMEGLQMQQPVEIDETIYSP 164

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 61/135 (45%), Gaps = 21/135 (15%)

Query: 67  ALLKVIKEHAELRCAV----SRNLEF-EPVDK-IDFEDVVRKIEFDCYADEQVNCYNGVP 120
           AL   + +H  L C V    S N  F + +DK   F D+V          E  + +N + 
Sbjct: 42  ALKYTLTQHERLTCNVFYDESENEYFLQNIDKPFKFGDIV----------EYHHNWNHLT 91

Query: 121 PYLLRHIFDKCHFTLGQKQPLWQLFVI--DGTMVVFHGHDVLFDTFAAANFHKLFLQAL- 177
              + +IF   +F+  + +PLW+L +I     M++   H VL D  +A +  + F++ L 
Sbjct: 92  EVEINYIFQNYNFSYSEHKPLWKLLIIPNQNQMLLLTDH-VLMDGISAVHVWETFMEGLQ 150

Query: 178 -NSLSESCTSPRPVF 191
              L E+ T   PV 
Sbjct: 151 EQQLRENETVYSPVL 165

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 12/89 (13%)

Query: 93  KIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVID-GTM 151
           +I  +DV+ +  FD   +   N            I     F   Q++PLW+L  +  GT 
Sbjct: 72  EIRLDDVLEETGFDSLDESAANS-----------ILKNSTFQYDQQRPLWKLISLKAGTQ 120

Query: 152 VVFHGHDVLFDTFAAANFHKLFLQALNSL 180
            +F      FD  +A  F   F+ ALNS+
Sbjct: 121 FLFCFDHAFFDGMSAVIFWNDFISALNSI 149

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 124 LRHIFDKCHFTLGQKQPLWQLFVI--DGTMVVFHGHDVLFDTFAAANFHKLFLQAL 177
           + HIF + +F   + +PLW++ +I     M++   H VL D  +A +  + F++ L
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDH-VLMDGMSAVHVWETFMEGL 157

>Suva_4.474 Chr4 complement(825864..827891) [2028 bp, 675 aa] {ON}
           YBR216C (REAL)
          Length = 675

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 14/126 (11%)

Query: 215 SITDAFYSQSQAILRSLYNLAIKKPLRFIESGRIEHSTEQHSGTPEPL-NYPNHLCGTVV 273
           SITDA Y   +    SLY+    K  + I    +      ++ T EPL N    L    V
Sbjct: 417 SITDAIYLYLRFTTPSLYS----KVYQSIAVESVNRYWLWYAITTEPLENIKTELKNLSV 472

Query: 274 FGTISTPRFKILKGILN-DHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIP 332
           F T +  +  ++K  +  +H++ M TF +   L CL P      + + F   +++  + P
Sbjct: 473 FVTKALLQVLLIKNCVQVNHQLRMVTFTLLTRLLCLVP------ENVAFDFILDVLKICP 526

Query: 333 WSSPLG 338
           +  PLG
Sbjct: 527 F--PLG 530

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 5/126 (3%)

Query: 393 FERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSN 452
           F+R +   +NE +K L         D D+++ +Q  ++ A A   + IE N +  I+L  
Sbjct: 120 FKRLLMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPAFDGQEIEFN-VRIINLKV 178

Query: 453 VNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512
              SQ ++++    +    NT+      F S     L I   +D E+   +  +++F +N
Sbjct: 179 DQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII--EDDHELTAII--YQSFEKN 234

Query: 513 YPKFVC 518
           Y K+ C
Sbjct: 235 YIKYKC 240

>Kpol_259.5 s259 (12123..14747) [2625 bp, 874 aa] {ON}
           (12123..14747) [2625 nt, 875 aa]
          Length = 874

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 49/116 (42%), Gaps = 18/116 (15%)

Query: 36  YYKNFPNKDLSDNETLRSDM-NQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKI 94
           YY+++PN  +S    L+ DM N++ SD   W  L + IK+H      V  +L   P+   
Sbjct: 557 YYESYPNSPVSQG-VLQYDMWNRKPSDLWDWATLKEQIKKH-----GVRNSLLLAPMPTA 610

Query: 95  DFEDVVRKIEFDCYADEQVNCYNG---------VPPYLLRHIFDKCHFTLGQKQPL 141
               ++   E  C+     N Y           V PYLLR + D   +    KQ L
Sbjct: 611 STSQILGYNE--CFEPFTSNMYQRRVLSGEFQIVNPYLLRDLVDLGIWDESMKQHL 664

>KLLA0C07348g Chr3 (639956..641914) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q12033 Saccharomyces cerevisiae YOR275C RIM20
           Protein involved in proteolytic activation of Rim101p in
           response to alkaline pH member of the PalA/AIP1/Alix
           family interacts with the ESCRT-III subunits Snf7p
           suggesting a relationship between the response to pH and
           multivesicular body formation
          Length = 652

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 367 NPELLEGMTLSDANQTNADQADPESLFERTVTHVSNELKKALQDLETGK 415
           N E+L  +TLS   Q    + DP +L+   + H SN L +  +++ +GK
Sbjct: 562 NKEMLTKVTLSSPEQVQISRNDPRTLYLEELKHSSNVLSELKENIISGK 610

>KAFR0H02180 Chr8 (414111..416207) [2097 bp, 698 aa] {ON} Anc_8.346
           YLR139C
          Length = 698

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 53  SDMNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFE 97
           +D+   LSDS  WK L   IK  + L+  +   ++ + ++KI FE
Sbjct: 160 NDLKSNLSDSFTWKQLYSYIKFKSNLKSKLQHMVKIDLINKIFFE 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,293,131
Number of extensions: 2607258
Number of successful extensions: 7452
Number of sequences better than 10.0: 56
Number of HSP's gapped: 7590
Number of HSP's successfully gapped: 58
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)