Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11550g6.9ON39839821270.0
Kwal_56.223456.9ON39639915050.0
SAKL0E00814g6.9ON39838913550.0
KLLA0D00814g6.9ON40840712211e-167
Ecym_30126.9ON39739612181e-166
ZYRO0F00462g6.9ON39338012091e-165
NDAI0K029006.9ON43838811871e-161
TDEL0G046206.9ON39237611811e-161
NCAS0F001906.9ON41138311561e-157
ACR017W6.9ON42338111491e-155
Kpol_1045.786.9ON39238011411e-155
KNAG0E009806.9ON41437310991e-148
Suva_5.126.9ON40138610931e-147
YEL056W (HAT2)6.9ON40138610871e-146
Skud_5.336.9ON40138610861e-146
TPHA0M001906.9ON39138010831e-146
Smik_5.316.9ON42738610721e-144
CAGL0B03575g6.9ON41938710531e-141
KAFR0L003206.9ON39139410321e-138
TBLA0A071206.9ON4073979831e-130
NDAI0C055108.548ON4194213763e-40
Kwal_27.120708.548ON4184203754e-40
SAKL0H09900g8.548ON4254133693e-39
TBLA0H036508.548ON4194183623e-38
NCAS0B021708.548ON4144233501e-36
KLTH0E12694g8.548ON4184093474e-36
Skud_2.3218.548ON4224313441e-35
TPHA0L017208.548ON4194123413e-35
Kpol_1024.398.548ON4174143404e-35
ZYRO0A13068g8.548ON3974143385e-35
KLLA0E23541g8.548ON4174013386e-35
YBR195C (MSI1)8.548ON4224213388e-35
Suva_4.4498.548ON4244213292e-33
CAGL0M05291g8.548ON4194253272e-33
KAFR0I008408.548ON4134213272e-33
TDEL0B029808.548ON4124123247e-33
Smik_2.3358.548ON4224283212e-32
KNAG0A036708.548ON4264203124e-31
AEL250C8.548ON4174053036e-30
Ecym_70428.548ON4144192974e-29
NCAS0F019702.401ON5114011961e-15
Suva_13.3112.401ON5104001925e-15
KAFR0A003802.401ON5164081925e-15
TPHA0G026502.401ON5164041881e-14
CAGL0K03861g2.401ON5133991881e-14
Smik_13.3292.401ON5094001853e-14
YMR131C (RRB1)2.401ON5114001844e-14
Skud_13.2912.401ON5094001835e-14
TDEL0G033402.401ON5143971837e-14
KLLA0F17237g2.401ON5233971773e-13
KNAG0E021802.401ON5174011774e-13
NDAI0H027502.401ON5124021755e-13
ADR242C2.401ON5213991748e-13
Sklu_YGOB_Anc_2.4012.401ON5204031721e-12
ZYRO0A08690g2.401ON5164001641e-11
Ecym_60672.401ON5224001622e-11
Kpol_1041.202.401ON5153991622e-11
NCAS0G011206.276ON4941631596e-11
Kwal_47.178272.401ON5233971587e-11
Kpol_1060.246.276ON4863231588e-11
TBLA0B092502.401ON5263991571e-10
KLTH0E09394g2.401ON5223971552e-10
Skud_4.637.310ON12732141517e-10
ADL184W3.25ON4492231499e-10
Smik_4.457.310ON12702141501e-09
Suva_4.537.310ON12712111491e-09
Ecym_8044na 1ON3111681451e-09
TPHA0D035906.276ON5983331472e-09
Skud_10.1021.247ON7081511472e-09
Suva_16.1598.672ON4511481462e-09
Ecym_33212.283ON4091751462e-09
KNAG0A012303.22ON13211941463e-09
KAFR0B057008.316ON3722981434e-09
NDAI0F012406.276ON5241661444e-09
KLLA0E04819g7.534ON4592001444e-09
KNAG0I009208.316ON3812631425e-09
YPL247C6.276ON5233051436e-09
KLLA0E07085g3.25ON4522091426e-09
NDAI0G006302.283ON3971291426e-09
ZYRO0E08184g6.276ON5063151426e-09
TDEL0A068906.276ON4473521419e-09
AGL190W8.316ON3702951409e-09
TDEL0G021402.283ON3921941401e-08
Kpol_1048.598.544ON8501561411e-08
KLLA0F15598g5.201ON4782671401e-08
Kpol_1036.658.316ON3712991391e-08
CAGL0H00781g6.276ON5133331401e-08
AEL269C7.534ON4551551382e-08
Suva_14.3112.283ON3892471363e-08
Kwal_33.151365.201ON4731371373e-08
Ecym_42498.316ON3742981363e-08
Suva_16.606.276ON5263051364e-08
Smik_10.1261.247ON7122331364e-08
TBLA0G014904.122ON7321431365e-08
Ecym_20263.25ON4512071355e-08
NDAI0I021805.201ON4791411355e-08
SAKL0G12892g5.201ON4761391346e-08
Kwal_56.245967.338ON2941711326e-08
SAKL0F15972g7.534ON4701521346e-08
TDEL0C023607.310ON12642121366e-08
SAKL0H15708g8.316ON3683001336e-08
KLTH0B03410g5.201ON4771961346e-08
Kpol_2002.995.201ON4871391347e-08
Kwal_27.115502.283ON4072251338e-08
YJL112W (MDV1)1.247ON7141511349e-08
ZYRO0B10450g5.201ON4821371339e-08
Skud_11.2711.247ON6461691331e-07
ZYRO0F05808g7.310ON12822201331e-07
YDL195W (SEC31)7.310ON12732151331e-07
SAKL0F11022g7.338ON2961731291e-07
TDEL0A061808.672ON4342001312e-07
KLLA0C16643g7.338ON3022431292e-07
Smik_6.4516.276ON5233041312e-07
Suva_10.645.201ON4901791312e-07
Skud_7.2844.122ON5661801312e-07
KLLA0E04093g8.316ON3723001302e-07
KAFR0F010606.276ON5531611302e-07
TDEL0F044308.316ON3673051292e-07
Skud_16.326.276ON5223091302e-07
AAL157C5.201ON4791421302e-07
KLTH0G10296g2.283ON426941292e-07
YNL035C2.283ON3891901292e-07
TPHA0E030805.201ON4881411293e-07
TPHA0C033702.283ON4132581283e-07
KAFR0J009805.201ON4801371283e-07
KNAG0H020402.283ON3991341283e-07
Smik_7.2874.122ON5661801293e-07
Smik_6.3488.672ON4511471283e-07
SAKL0E07766g2.283ON3981331274e-07
KNAG0D007406.276ON5041711274e-07
NCAS0D027305.201ON4751381274e-07
YGL003C (CDH1)4.122ON5661801274e-07
CAGL0G01628g2.283ON3762011265e-07
Kpol_1019.307.310ON12522071285e-07
Skud_14.2982.283ON3891801265e-07
TBLA0H020005.201ON4731371266e-07
TDEL0E042805.201ON4811361266e-07
YPL151C (PRP46)8.672ON4511471266e-07
ZYRO0A01804g2.283ON376941256e-07
SAKL0D04796g1.247ON7691721276e-07
KAFR0L013207.310ON12402081277e-07
SAKL0C13266g3.25ON4592101257e-07
ZYRO0G20152g2.431ON3192461247e-07
Skud_16.1318.672ON4511471258e-07
NCAS0G038702.283ON389931248e-07
KLLA0E08449g2.283ON4222401258e-07
Smik_14.2962.283ON389931249e-07
TBLA0A038908.316ON3622491249e-07
Smik_12.525.201ON4891371259e-07
Suva_6.1871.247ON7141461259e-07
KNAG0M017505.201ON4851471241e-06
SAKL0H06666g8.672ON4411461241e-06
Suva_7.2794.122ON5661731241e-06
Kpol_1061.364.122ON5891581241e-06
Suva_11.2681.247ON6451661241e-06
YLL011W (SOF1)5.201ON4891371241e-06
NDAI0G038303.25ON5102181231e-06
KLTH0G12430g8.316ON3672751221e-06
KAFR0A064804.122ON5681801231e-06
KLTH0F19294g3.25ON4512251231e-06
Suva_10.5454.309ON6421901232e-06
Kpol_1003.342.283ON3881241222e-06
KNAG0I010508.288ON11591981232e-06
Suva_2.2918.288ON11512071232e-06
TBLA0B059202.283ON403691222e-06
ZYRO0G10472g4.122ON5601801222e-06
CAGL0A00605g4.122ON6401581222e-06
TPHA0F028907.338ON2951631202e-06
KAFR0L013907.322ON12062121222e-06
KLTH0H01518g7.338ON2941711193e-06
TBLA0E045704.309ON5951921213e-06
NDAI0J018504.122ON5751581213e-06
Ecym_21396.276ON4352631203e-06
TPHA0B005904.309ON5881901213e-06
Suva_14.223.25ON4692081203e-06
KLLA0F11231g8.672ON4341821203e-06
Skud_12.565.201ON4891771203e-06
YNL317W (PFS2)3.25ON4652101203e-06
Kpol_2001.657.322ON12062791213e-06
Skud_4.3898.288ON11512071213e-06
Smik_4.907.322ON12012951213e-06
Kpol_2001.637.310ON12762051213e-06
TPHA0P014903.25ON4592081203e-06
KAFR0H024508.672ON4171431194e-06
ZYRO0D05852g8.316ON3713021194e-06
YKR036C (CAF4)1.247ON6431691204e-06
KLTH0D11132g8.672ON4371441194e-06
Skud_14.223.25ON4672261194e-06
Kwal_26.87768.672ON4331691194e-06
ADR090W7.310ON12331971204e-06
TDEL0D013101.247ON7091741204e-06
YDR128W (MTC5)8.288ON11482071204e-06
ZYRO0C03124g3.25ON4451491194e-06
KNAG0B055504.122ON6171431194e-06
Smik_14.143.25ON4662241194e-06
TPHA0G016108.672ON4141941185e-06
TBLA0A023106.276ON5313181195e-06
NDAI0I004606.325ON9171601196e-06
NCAS0A151707.534ON4742101186e-06
Smik_4.3748.288ON11521971196e-06
Kwal_55.220673.25ON4512351177e-06
CAGL0B01529g8.316ON3692811177e-06
Kwal_56.238958.316ON3672751177e-06
NCAS0E037507.310ON12762191197e-06
NCAS0C044503.25ON4611491177e-06
KLLA0A08822g4.122ON5821441187e-06
TDEL0F022304.122ON5561651187e-06
KNAG0I025406.325ON9181571187e-06
KLTH0G13068g8.288ON11011971187e-06
YLR429W (CRN1)4.309ON6511901187e-06
ZYRO0F07282g8.672ON4271841177e-06
Kwal_27.126671.247ON7211511188e-06
KNAG0G024508.324ON9421661188e-06
TBLA0F024007.338ON2982131159e-06
NCAS0D046106.340ON5153231179e-06
YDL145C (COP1)7.322ON12012951179e-06
TDEL0A004403.25ON4512081161e-05
AFL157C6.276ON4383611161e-05
Kpol_2001.687.338ON2951671141e-05
NDAI0B051901.247ON6682281161e-05
Suva_4.997.322ON12012951171e-05
Skud_4.1097.322ON12012951171e-05
NDAI0A020907.322ON12003201171e-05
KLTH0E15576g1.247ON7231511161e-05
TBLA0I022806.325ON9271731161e-05
NDAI0J003307.534ON4721961151e-05
Ecym_46447.338ON2951711141e-05
TPHA0I032407.534ON4771331151e-05
SAKL0F10648g7.322ON12032121161e-05
Suva_10.3027.338ON2971651131e-05
ACR199C7.338ON2951721131e-05
SAKL0H22396g4.122ON5551581152e-05
NDAI0I003506.340ON5151621152e-05
KAFR0H033402.283ON367931142e-05
KNAG0F038707.534ON4651431142e-05
YCR084C (TUP1)6.363ON7132051152e-05
Smik_3.1836.363ON7092051142e-05
TPHA0C008608.316ON3782901132e-05
TPHA0I018808.544ON10341341152e-05
KLTH0H01892g7.322ON12092441142e-05
NDAI0J010408.316ON3982601132e-05
Smik_12.2667.338ON2971651122e-05
SAKL0A00660g6.363ON6602131142e-05
Kwal_56.245267.322ON12102441142e-05
Skud_3.1566.363ON7132051142e-05
NCAS0J011104.122ON5951801132e-05
Suva_3.1216.363ON7002051132e-05
KAFR0A056104.309ON6201871132e-05
Kpol_1001.234.309ON6101871132e-05
TDEL0A077806.363ON6572071132e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11550g
         (398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   823   0.0  
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   584   0.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   526   0.0  
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   474   e-167
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   473   e-166
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   470   e-165
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     461   e-161
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   459   e-161
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   449   e-157
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   447   e-155
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   444   e-155
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   427   e-148
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   425   e-147
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   423   e-146
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   422   e-146
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   421   e-146
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   417   e-144
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   410   e-141
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   402   e-138
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   383   e-130
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   149   3e-40
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   149   4e-40
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   146   3e-39
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   144   3e-38
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   139   1e-36
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   138   4e-36
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   137   1e-35
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   135   3e-35
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   135   4e-35
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   134   5e-35
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   134   6e-35
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   134   8e-35
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   131   2e-33
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   130   2e-33
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   130   2e-33
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   129   7e-33
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   128   2e-32
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   124   4e-31
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   121   6e-30
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   119   4e-29
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    80   1e-15
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    79   5e-15
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    79   5e-15
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    77   1e-14
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    77   1e-14
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    76   3e-14
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    75   4e-14
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    75   5e-14
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    75   7e-14
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    73   3e-13
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    73   4e-13
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    72   5e-13
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    72   8e-13
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    71   1e-12
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    68   1e-11
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    67   2e-11
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    67   2e-11
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    66   6e-11
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    65   7e-11
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    65   8e-11
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    65   1e-10
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    64   2e-10
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    63   7e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    62   9e-10
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    62   1e-09
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    62   1e-09
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    60   1e-09
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    61   2e-09
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    61   2e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    61   2e-09
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    61   2e-09
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    61   3e-09
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    60   4e-09
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    60   4e-09
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    60   4e-09
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    59   5e-09
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    60   6e-09
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    59   6e-09
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    59   6e-09
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    59   6e-09
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    59   9e-09
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    59   9e-09
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    59   1e-08
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    59   1e-08
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    59   1e-08
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    58   1e-08
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    59   1e-08
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    58   2e-08
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    57   3e-08
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    57   3e-08
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    57   3e-08
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    57   4e-08
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    57   4e-08
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    57   5e-08
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    57   5e-08
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    57   5e-08
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    56   6e-08
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    55   6e-08
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    56   6e-08
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    57   6e-08
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    56   6e-08
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    56   6e-08
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    56   7e-08
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    56   8e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    56   9e-08
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    56   9e-08
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    56   1e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    56   1e-07
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    56   1e-07
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    54   1e-07
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    55   2e-07
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    54   2e-07
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    55   2e-07
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    55   2e-07
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    55   2e-07
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    55   2e-07
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    55   2e-07
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    54   2e-07
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    55   2e-07
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    55   2e-07
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    54   2e-07
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    54   2e-07
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    54   3e-07
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    54   3e-07
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    54   3e-07
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    54   3e-07
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    54   3e-07
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    54   3e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    54   4e-07
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    54   4e-07
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     54   4e-07
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    54   4e-07
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    53   5e-07
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    54   5e-07
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    53   5e-07
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    53   6e-07
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    53   6e-07
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    53   6e-07
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    53   6e-07
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    54   6e-07
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    54   7e-07
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    53   7e-07
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    52   7e-07
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    53   8e-07
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     52   8e-07
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    53   8e-07
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    52   9e-07
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    52   9e-07
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    53   9e-07
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    53   9e-07
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    52   1e-06
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    52   1e-06
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    52   1e-06
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    52   1e-06
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    52   1e-06
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    52   1e-06
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      52   1e-06
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    52   1e-06
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    52   1e-06
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    52   1e-06
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    52   2e-06
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    52   2e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    52   2e-06
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    52   2e-06
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    52   2e-06
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    52   2e-06
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    52   2e-06
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    51   2e-06
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    52   2e-06
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    50   3e-06
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    51   3e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    51   3e-06
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    51   3e-06
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    51   3e-06
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    51   3e-06
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    51   3e-06
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    51   3e-06
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    51   3e-06
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    51   3e-06
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    51   3e-06
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    51   3e-06
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    51   3e-06
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    51   3e-06
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    50   4e-06
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    50   4e-06
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    51   4e-06
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    50   4e-06
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    50   4e-06
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    50   4e-06
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    51   4e-06
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    51   4e-06
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    51   4e-06
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    50   4e-06
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    50   4e-06
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    50   4e-06
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    50   5e-06
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    50   5e-06
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       50   6e-06
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    50   6e-06
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    50   6e-06
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    50   7e-06
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    50   7e-06
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    50   7e-06
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    50   7e-06
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      50   7e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    50   7e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    50   7e-06
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    50   7e-06
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    50   7e-06
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    50   7e-06
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    50   7e-06
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    50   8e-06
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    50   8e-06
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    49   9e-06
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     50   9e-06
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    50   9e-06
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    49   1e-05
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    49   1e-05
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    49   1e-05
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    49   1e-05
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    50   1e-05
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    50   1e-05
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    50   1e-05
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    49   1e-05
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    49   1e-05
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      49   1e-05
Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar ...    49   1e-05
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    49   1e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    49   1e-05
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    48   1e-05
ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON} Sy...    48   1e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    49   2e-05
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       49   2e-05
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    49   2e-05
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    49   2e-05
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    49   2e-05
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    49   2e-05
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    48   2e-05
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    49   2e-05
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    49   2e-05
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    48   2e-05
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    48   2e-05
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    49   2e-05
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    49   2e-05
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    49   2e-05
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              48   2e-05
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    48   2e-05
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    48   2e-05
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    48   2e-05
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    48   2e-05
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    49   2e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    49   3e-05
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    47   3e-05
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    48   3e-05
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    49   3e-05
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    48   3e-05
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    48   3e-05
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    47   3e-05
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    48   3e-05
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    48   3e-05
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    48   3e-05
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    47   4e-05
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    48   4e-05
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    48   4e-05
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    47   4e-05
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    47   4e-05
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    47   4e-05
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    48   4e-05
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    47   5e-05
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    47   5e-05
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    47   5e-05
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    47   5e-05
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    47   5e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    47   5e-05
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    47   6e-05
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    47   6e-05
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    47   6e-05
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    47   6e-05
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    46   6e-05
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    47   6e-05
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    47   6e-05
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    47   6e-05
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    47   6e-05
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    47   6e-05
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    47   6e-05
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    47   7e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    47   7e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    47   7e-05
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    46   7e-05
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    47   7e-05
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    46   7e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    47   8e-05
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    47   8e-05
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    47   9e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    47   9e-05
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    47   9e-05
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    46   9e-05
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    46   9e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    47   1e-04
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    46   1e-04
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     46   1e-04
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    47   1e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    47   1e-04
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    46   1e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    46   1e-04
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    46   1e-04
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    46   1e-04
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    46   1e-04
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    46   1e-04
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    46   1e-04
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    45   1e-04
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    46   1e-04
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    46   1e-04
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    46   1e-04
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    46   1e-04
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    46   1e-04
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    46   1e-04
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    46   1e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    46   1e-04
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    46   1e-04
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    45   1e-04
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    45   1e-04
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    46   1e-04
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    46   1e-04
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    46   1e-04
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    46   1e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    46   2e-04
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    46   2e-04
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    45   2e-04
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    45   2e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    45   2e-04
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    45   2e-04
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       45   2e-04
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    45   2e-04
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    45   2e-04
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     45   2e-04
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    45   2e-04
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    45   2e-04
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    45   2e-04
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    45   2e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    45   2e-04
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    45   2e-04
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    45   2e-04
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    45   3e-04
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    45   3e-04
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    45   3e-04
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    45   3e-04
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    44   3e-04
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    45   3e-04
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    44   3e-04
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    44   3e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    45   3e-04
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    45   3e-04
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    45   3e-04
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    45   3e-04
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    45   3e-04
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    45   3e-04
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    45   4e-04
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    45   4e-04
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    45   4e-04
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    44   4e-04
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    44   4e-04
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    44   4e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    44   4e-04
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    44   4e-04
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    44   4e-04
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    44   4e-04
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    44   5e-04
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    44   5e-04
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    44   5e-04
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    44   5e-04
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    44   5e-04
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    44   5e-04
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    44   6e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    44   6e-04
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    44   6e-04
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    44   6e-04
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    44   6e-04
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    44   6e-04
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    44   6e-04
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    44   6e-04
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    44   6e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    44   6e-04
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    44   6e-04
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    43   7e-04
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    44   7e-04
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    44   7e-04
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    44   7e-04
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    44   7e-04
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    44   7e-04
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    43   7e-04
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    44   7e-04
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    44   7e-04
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    44   7e-04
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    44   7e-04
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    44   7e-04
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    43   8e-04
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    44   8e-04
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    44   8e-04
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    44   8e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    43   8e-04
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    44   8e-04
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    43   8e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    44   8e-04
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    43   9e-04
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    43   9e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    44   9e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    43   0.001
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    43   0.001
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    43   0.001
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    43   0.001
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    43   0.001
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    43   0.001
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    44   0.001
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    43   0.001
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    43   0.001
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    42   0.001
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     43   0.001
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    43   0.001
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    43   0.001
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    43   0.001
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    43   0.001
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    42   0.001
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    43   0.001
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    42   0.001
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    43   0.001
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    43   0.001
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    43   0.001
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    43   0.001
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    43   0.001
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    42   0.001
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    43   0.001
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    43   0.001
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    42   0.001
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    42   0.002
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    42   0.002
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    42   0.002
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    42   0.002
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    42   0.002
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    42   0.002
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    42   0.002
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    42   0.002
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    42   0.002
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    42   0.002
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    42   0.002
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    42   0.002
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    42   0.002
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    42   0.002
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    42   0.002
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    42   0.002
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    42   0.002
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    42   0.002
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    42   0.002
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    42   0.002
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    42   0.002
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    42   0.003
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    42   0.003
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    42   0.003
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    42   0.003
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    42   0.003
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    41   0.003
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    42   0.003
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    41   0.003
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    42   0.003
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    42   0.003
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    42   0.003
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    42   0.003
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    42   0.003
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    41   0.003
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    41   0.003
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    42   0.003
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    41   0.004
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      41   0.004
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    41   0.004
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    41   0.004
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    41   0.004
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    41   0.004
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    41   0.004
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    41   0.004
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    41   0.004
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    41   0.004
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    41   0.004
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    41   0.004
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    41   0.004
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    41   0.004
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    41   0.004
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    41   0.005
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    41   0.005
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    40   0.005
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    41   0.005
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    40   0.005
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    41   0.005
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    41   0.005
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    41   0.005
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    41   0.005
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    41   0.005
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    41   0.005
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    41   0.005
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    41   0.005
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    41   0.005
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    41   0.005
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    40   0.005
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    41   0.005
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    41   0.005
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    41   0.005
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    40   0.005
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    41   0.005
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    41   0.006
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    40   0.006
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    41   0.006
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    40   0.006
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               40   0.006
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    41   0.006
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    40   0.006
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    40   0.006
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    40   0.006
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    41   0.006
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    41   0.006
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    40   0.007
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    40   0.007
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    40   0.007
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    40   0.007
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     40   0.007
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    40   0.007
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    40   0.007
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    40   0.007
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    40   0.008
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    40   0.008
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    40   0.008
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    40   0.008
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    40   0.008
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    40   0.008
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    40   0.008
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    40   0.008
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    40   0.008
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    40   0.008
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    40   0.009
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    40   0.009
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    40   0.009
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    40   0.009
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    40   0.009
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    40   0.009
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    40   0.009
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    40   0.009
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    40   0.010
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    40   0.010
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    40   0.010
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    40   0.010
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    39   0.010
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    40   0.011
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    40   0.011
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    39   0.011
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    40   0.011
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    40   0.011
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    40   0.011
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    40   0.012
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    39   0.012
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.012
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    40   0.013
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    40   0.013
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    40   0.013
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    39   0.014
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    39   0.014
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    39   0.014
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    40   0.014
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    39   0.014
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    39   0.015
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    40   0.015
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    39   0.015
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    39   0.016
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    39   0.016
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    39   0.017
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    39   0.017
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    39   0.017
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    39   0.017
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    39   0.017
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    39   0.017
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    39   0.017
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    39   0.018
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    39   0.018
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    39   0.018
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    39   0.018
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    39   0.019
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    39   0.019
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    39   0.019
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    39   0.020
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    39   0.021
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    39   0.021
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    39   0.021
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    39   0.021
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    39   0.021
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    39   0.022
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    39   0.022
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    39   0.022
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    39   0.022
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    39   0.022
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    39   0.022
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    39   0.022
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    39   0.023
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    39   0.023
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    39   0.024
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    39   0.025
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    39   0.025
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    39   0.025
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    38   0.026
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    39   0.026
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    39   0.026
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    39   0.026
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    39   0.026
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    38   0.027
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    39   0.027
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    39   0.028
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    39   0.028
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    39   0.028
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    39   0.030
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    39   0.031
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    38   0.031
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    39   0.032
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    38   0.032
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    38   0.033
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    38   0.033
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    38   0.033
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    38   0.034
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    39   0.034
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    38   0.034
NCAS0H01190 Chr8 complement(226606..227715) [1110 bp, 369 aa] {O...    38   0.035
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    38   0.035
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    38   0.035
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    38   0.035
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    38   0.036
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    38   0.037
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    38   0.038
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    38   0.038
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    38   0.039
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    38   0.040
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    38   0.040
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    38   0.040
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    38   0.040
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    37   0.044
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    38   0.045
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    37   0.046
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    38   0.046
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    38   0.046
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    38   0.046
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    38   0.046
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    38   0.048
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    38   0.048
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    38   0.048
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    38   0.049
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    38   0.049
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    38   0.049
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    38   0.050
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    37   0.051
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    37   0.053
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    38   0.053
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    38   0.053
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    37   0.053
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    38   0.054
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             38   0.056
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     38   0.056
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    37   0.058
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    37   0.058
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    37   0.059
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    37   0.059
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    37   0.060
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    38   0.061
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    37   0.061
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    37   0.062
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    37   0.063
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    37   0.063
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    37   0.065
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    37   0.067
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    37   0.067
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    37   0.067
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    37   0.067
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    37   0.069
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    37   0.070
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             37   0.070
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    37   0.071
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    37   0.072
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    37   0.073
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    37   0.075
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    37   0.076
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    37   0.077
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    37   0.078
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    37   0.079
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    37   0.079
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    37   0.085
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    37   0.085
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.086
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    36   0.088
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    37   0.088
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    37   0.090
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    37   0.091
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    37   0.092
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    37   0.093
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    37   0.094
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    37   0.094
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    37   0.094
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      37   0.095
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    37   0.095
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    37   0.096
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    37   0.098
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    37   0.098
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    37   0.10 
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    37   0.10 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    37   0.10 
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    37   0.11 
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    37   0.11 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    37   0.11 
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    37   0.11 
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    37   0.11 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    37   0.11 
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    36   0.11 
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    37   0.12 
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    37   0.12 
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    36   0.12 
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    36   0.13 
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    36   0.13 
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    36   0.13 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    37   0.14 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    36   0.14 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    36   0.14 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    36   0.14 
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    36   0.14 
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    36   0.14 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    36   0.15 
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    36   0.15 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    36   0.15 
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    36   0.16 
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    36   0.16 
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    36   0.16 
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    36   0.16 
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    36   0.16 
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    36   0.18 
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    36   0.18 
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    36   0.18 
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    35   0.19 
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    36   0.19 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     36   0.19 
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    36   0.19 
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    36   0.19 
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    36   0.19 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    36   0.20 
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               35   0.20 
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    36   0.20 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    36   0.20 
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    36   0.21 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    35   0.22 
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    35   0.22 
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    35   0.22 
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    36   0.22 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    35   0.23 
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    36   0.23 
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    35   0.23 
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    35   0.23 
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    35   0.24 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    35   0.24 
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    36   0.24 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    35   0.24 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    35   0.28 
Kwal_14.1597 s14 complement(383549..384691) [1143 bp, 380 aa] {O...    35   0.29 
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    35   0.29 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    35   0.29 
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    35   0.30 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   0.31 
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    35   0.31 
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    35   0.32 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    35   0.32 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    35   0.32 
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    35   0.33 
NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.1...    35   0.33 
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    35   0.33 
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    35   0.34 
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    35   0.34 
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    35   0.36 
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    35   0.36 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               35   0.36 
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    35   0.36 
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    35   0.37 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    35   0.38 
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    35   0.38 
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    35   0.38 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    35   0.40 
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    35   0.40 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    35   0.41 
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    35   0.42 
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    35   0.42 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    35   0.43 
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    35   0.44 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    35   0.44 
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    35   0.44 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    35   0.45 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    35   0.45 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.46 
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    35   0.49 
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    34   0.50 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    35   0.51 
NDAI0E02310 Chr5 (477468..478811) [1344 bp, 447 aa] {ON}               34   0.51 
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    34   0.51 
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    34   0.52 
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    34   0.56 
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    34   0.56 
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    34   0.57 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    34   0.59 
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    34   0.60 
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    34   0.62 
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    34   0.63 
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    34   0.64 
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    34   0.66 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     34   0.66 
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    34   0.67 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    34   0.72 
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    33   0.76 
Suva_4.491 Chr4 complement(855726..856880) [1155 bp, 384 aa] {ON...    34   0.77 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    34   0.79 
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    34   0.79 
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               33   0.82 
Skud_16.39 Chr16 complement(70011..72143) [2133 bp, 710 aa] {ON}...    34   0.83 
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    34   0.84 
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    34   0.84 
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    33   0.86 
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    34   0.90 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   0.90 
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    33   0.90 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    34   0.91 
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    34   0.91 
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    33   0.93 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   0.95 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   0.96 
Ecym_2148 Chr2 complement(278892..281030) [2139 bp, 712 aa] {ON}...    33   0.97 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    33   0.97 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   0.99 
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    33   1.00 
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    33   1.0  
Kpol_1036.90 s1036 (235306..236667) [1362 bp, 453 aa] {ON} (2353...    33   1.1  
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    33   1.1  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    33   1.1  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    33   1.1  
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    33   1.1  
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    33   1.1  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    33   1.1  
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    33   1.2  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    33   1.2  
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    33   1.2  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    33   1.2  
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    33   1.2  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    33   1.2  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    33   1.3  
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    33   1.3  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    33   1.3  
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    33   1.3  
TBLA0H01140 Chr8 complement(255859..257508) [1650 bp, 549 aa] {O...    33   1.3  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    33   1.4  
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    33   1.4  
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    33   1.4  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    33   1.4  
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    33   1.4  
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    33   1.5  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    33   1.5  
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    33   1.5  
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    33   1.5  
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    33   1.5  
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    33   1.6  
KNAG0A04990 Chr1 complement(726567..727844) [1278 bp, 425 aa] {O...    33   1.6  
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    33   1.6  
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    33   1.6  
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    33   1.7  
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    33   1.7  
ZYRO0E07986g Chr5 (623313..625451) [2139 bp, 712 aa] {ON} highly...    33   1.8  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    32   1.8  
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     33   1.8  
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    33   1.8  
Ecym_2274 Chr2 (539468..540592) [1125 bp, 374 aa] {ON} similar t...    32   1.8  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    33   1.9  
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    32   1.9  
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    32   1.9  
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    32   2.0  
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    33   2.0  
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    33   2.0  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    33   2.1  
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    32   2.2  
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    32   2.2  
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    32   2.2  
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    32   2.3  
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    32   2.3  
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    32   2.3  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   2.3  
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    32   2.3  
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    32   2.4  
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    32   2.4  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    32   2.4  
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    32   2.4  
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    32   2.4  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    32   2.5  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    32   2.6  
KAFR0G03590 Chr7 (740652..741776) [1125 bp, 374 aa] {ON} Anc_6.1...    32   2.8  
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    32   2.8  
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    32   2.8  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...    32   2.9  
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    32   2.9  
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    32   2.9  
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    32   3.0  
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    32   3.0  
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    32   3.1  
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    32   3.3  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    32   3.5  
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    32   3.5  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    32   3.5  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    32   3.6  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    32   3.7  
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    32   3.7  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    32   3.8  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    32   3.9  
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    32   3.9  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   4.0  
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    32   4.0  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    32   4.1  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    32   4.1  
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    31   4.1  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    32   4.2  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    32   4.2  
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    32   4.2  
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    32   4.4  
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    31   4.7  
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    32   4.8  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   4.9  
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    31   5.0  
KNAG0G00920 Chr7 (176863..183252) [6390 bp, 2129 aa] {ON} Anc_8....    32   5.0  
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    31   5.0  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    31   5.2  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    31   5.3  
CAGL0C01661g Chr3 complement(177284..178411) [1128 bp, 375 aa] {...    31   5.3  
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    31   5.3  
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    31   5.6  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    31   5.7  
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    31   5.7  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    31   5.7  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    31   5.9  
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    31   6.0  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    31   6.0  
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    31   6.0  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    31   6.0  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    31   6.2  
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    30   6.2  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    31   6.7  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    31   6.8  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    31   6.8  
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    31   7.0  
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    31   7.1  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    31   7.2  
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    31   7.2  
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    31   7.3  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    31   7.4  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    31   7.4  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    31   7.4  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    31   7.4  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    31   7.6  
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    30   7.6  
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    30   7.7  
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    30   7.8  
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    31   7.8  
CAGL0K07095g Chr11 (698857..699972) [1116 bp, 371 aa] {ON} highl...    30   7.9  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    31   7.9  
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    30   7.9  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    30   8.1  
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    30   8.3  
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    31   8.6  
KAFR0B05890 Chr2 (1215010..1216317) [1308 bp, 435 aa] {ON} Anc_8...    30   8.8  
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               30   9.0  
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    30   9.0  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    30   9.1  
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    30   9.4  
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    30   9.4  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    30   9.6  
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    30   9.6  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    30   9.6  
SAKL0A06314g Chr1 (571580..572701) [1122 bp, 373 aa] {ON} highly...    30   9.6  
TPHA0F00240 Chr6 complement(44772..46340) [1569 bp, 522 aa] {ON}...    30   9.7  

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/398 (100%), Positives = 398/398 (100%)

Query: 1   MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGT 60
           MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGT
Sbjct: 1   MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGT 60

Query: 61  HTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTR 120
           HTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTR
Sbjct: 61  HTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTR 120

Query: 121 ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSC 180
           ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSC
Sbjct: 121 ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSC 180

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK 240
           SDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK
Sbjct: 181 SDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK 240

Query: 241 PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF 300
           PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF
Sbjct: 241 PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF 300

Query: 301 APHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN 360
           APHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN
Sbjct: 301 APHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN 360

Query: 361 IPWLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398
           IPWLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE
Sbjct: 361 IPWLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/399 (70%), Positives = 340/399 (85%), Gaps = 4/399 (1%)

Query: 1   MQATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGT 60
           MQ+T PE E+S+D+EYDLWKSNVPLMYDFVSET+LLWPSLTIQWLP  + S EQEL++GT
Sbjct: 1   MQSTEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGT 60

Query: 61  HTSGTEQNYLKIASVHLPDEVVSDVKCSAPS-TDDSKESGHQPQSKIKIVRKFEHRDEVT 119
           HTS +EQNYLKIA ++LP E++S+     P   +D+  S  Q  SKIKI++KF+H +EVT
Sbjct: 61  HTSDSEQNYLKIAEINLPQEILSN---EGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVT 117

Query: 120 RARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLS 179
           RARYAPF+ NLIATISG+G VFLYDR+KD ++AL  ++++HKENGYGLNFSV SPGEL+S
Sbjct: 118 RARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELIS 177

Query: 180 CSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           CSDDGSIAIWD+ SGK  P  V++ H++IVNECKWHE  P ++GSVS+DS L+IHDKR +
Sbjct: 178 CSDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE 237

Query: 240 KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLE 299
           KP+ K+LQ EP+NT+AFSKHSSNLFAAAGTD+ V L+D RKP   +HSMSGH ++VTSLE
Sbjct: 238 KPLQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLE 297

Query: 300 FAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSP 359
           FA HKDGILCSG SDRRVL+WDLFQIG EQQ+EDADDG PELLMMHAGHKS +NDFS SP
Sbjct: 298 FAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSP 357

Query: 360 NIPWLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398
           N+PWLMASVEEEN+VQIWK S+KLT+PY P+ Y+IRSLE
Sbjct: 358 NVPWLMASVEEENIVQIWKPSRKLTNPYFPQGYDIRSLE 396

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  526 bits (1355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/389 (64%), Positives = 307/389 (78%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNY 69
           +S++EEY+LWK+NVPLMYDFVSETKL WPSLTIQWLP N  S +QE+ILGTHTSG + NY
Sbjct: 10  LSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNY 69

Query: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129
           LKIAS+ LP++++       P + +  E     QS+IKI +K +H +E+TRAR+ P +PN
Sbjct: 70  LKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRARFMPQDPN 129

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
            IATI+G GKVFL+DRSKD + AL +E +FHK+NGYGL+F+  + GELLSCSDDG+IA+W
Sbjct: 130 FIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALW 189

Query: 190 DVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE 249
           +V     +P K  T+H +IVN+C WHE +  LFGSVS+D TL IHDKR +  V ++  S 
Sbjct: 190 NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTNSTVHRLTLSS 249

Query: 250 PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILC 309
           P+NTL FSKHS NLFAAAGTDS V LYDLR     +H+MSGH DSVTSLEF+PHKDGILC
Sbjct: 250 PFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGILC 309

Query: 310 SGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVE 369
           S  SDRRVL+WDL QIG+EQ QEDA DGVPEL+MMHAGHKS VNDFS + NIPWLMASVE
Sbjct: 310 SSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASVE 369

Query: 370 EENVVQIWKASKKLTSPYIPRDYNIRSLE 398
           E+N+V +WK SKKLTSP + +DY+IRSLE
Sbjct: 370 EDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 237/407 (58%), Positives = 304/407 (74%), Gaps = 19/407 (4%)

Query: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE--------QELI 57
           PE   +++EEYDLW SNVP+MYDFVSET+L WPSLT+QWLP+  +  E        QEL+
Sbjct: 7   PEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66

Query: 58  LGTHTSGTEQNYLKIASVHLPDEVVSDVKCSAPS-TDDSKES--GHQPQSKIKIVRKFEH 114
           +GT T+  E NYLKIA++ LP+ V S    S PS +DD+KE+   H+ QSKIKIVRKF+H
Sbjct: 67  IGTLTTDNEPNYLKIAAIDLPENVTS----SKPSVSDDAKENELSHR-QSKIKIVRKFKH 121

Query: 115 RDEVTRARYAPFNPNLIATISGSGKVFLYDRS-KDSDSALTAEFSFHKENGYGLNFSVIS 173
             EVTRARY P +PN+IAT++G+G V+++DR+ K+ D    A FS+HKENGYGL F+   
Sbjct: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181

Query: 174 PGELLSCSDDGSIAIWDVCSGKN-TPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
            G+LLS SDDG++A+WDV S  N +P +    H +IVN+CKWHE    LFG+VS+D+TLI
Sbjct: 182 SGQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLI 241

Query: 233 IHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHH 292
           IHD   D+ + K+  S  +NTLAFSK S NL AAAGTDS V LYDLR+ + P+HSM+GH 
Sbjct: 242 IHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHE 301

Query: 293 DSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPV 352
           DSVTSLEF+PH+DG+L S  SDRR+++WDLF IGAEQQ +DA DGVPEL MMH GH+SPV
Sbjct: 302 DSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPV 361

Query: 353 NDFSCSPNIPWLMASVEEENVVQIWKASKKLTS-PYIPRDYNIRSLE 398
           N+FS + N+PWLM SVEEENV+QIWK + K+   P  P D++I +LE
Sbjct: 362 NEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE 408

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  473 bits (1218), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 293/396 (73%), Gaps = 13/396 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS---NEQELILGTHTS 63
           E+ ++VD+EY+LWKSNV LMYDFVSETKL WPSL+IQWLPS D +    +QE+ILGTHTS
Sbjct: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70

Query: 64  GTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARY 123
           G E NYLKIA++ LP EVV       P  D+S E     +S IK+ +KFEH DEV RARY
Sbjct: 71  GDENNYLKIAAIDLPYEVVG-----LPDEDNSSEP---VKSMIKVTKKFEHEDEVIRARY 122

Query: 124 APFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDD 183
            P N  +IATI+G GK+F+YDRSK     L    S+HK+NGYGL F+    GELLS SDD
Sbjct: 123 MPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDD 182

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
            ++A+WD+ S  + PV +  +H +IVN+ KWHE    +FG+VS+D TL +HDKR      
Sbjct: 183 TTVALWDINS-TDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSA 241

Query: 244 KILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAP 302
           ++L  E P N LAFSKHS NL AAAGTD++V LYDLR+   P+H+M+GH D+VTS+EF+ 
Sbjct: 242 QVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSS 301

Query: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIP 362
           HKDGILCS  SDRR+ IWDL QIGAEQ QEDADDGVPEL+MMHAGH+S +NDFS +P +P
Sbjct: 302 HKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVP 361

Query: 363 WLMASVEEENVVQIWKASKKLTSPYIPRDYNIRSLE 398
           WL+AS EE+NVVQ+WK SKKL S  IP   +++SLE
Sbjct: 362 WLIASAEEDNVVQVWKISKKLVSNIIPEYTDLKSLE 397

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/380 (59%), Positives = 283/380 (74%), Gaps = 10/380 (2%)

Query: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGT 65
           PE  +S+DEEYDLWKSNVPLMYDFVSET L WPSLT++WLP +  SN QE+ILGTHTS  
Sbjct: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDE 66

Query: 66  EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAP 125
           EQNYLKIA+++LPDEVV D         + KE     +S +KI++KFEH +EVTRARY P
Sbjct: 67  EQNYLKIAAIYLPDEVVPDA--------EPKEEEEVLKSNVKIIKKFEHENEVTRARYMP 118

Query: 126 FNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS 185
            + NLIATISG G ++LY+R+ + +S L + F FH ENGYGL+F+    G+LLS SDD +
Sbjct: 119 QDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSN 178

Query: 186 IAIWDVCSGKNTPVKVDT-SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI-DKPVV 243
           I +WDV      P+   T  H++IVN+CKWH     +FGSVS+DSTL +HD+RI D  V 
Sbjct: 179 IVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           K+   +PYNTLAFS HS+NLFAAAGTDS V LYD R+   P+H M GH D+VTSLEF P 
Sbjct: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298

Query: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363
           +DG+L S  SDRR ++WDL +IGAEQ  +DADDG PE++M+HAGH+S +NDFS +PNIPW
Sbjct: 299 EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358

Query: 364 LMASVEEENVVQIWKASKKL 383
           L A+ EEEN+VQ+WK S KL
Sbjct: 359 LTATAEEENIVQVWKPSSKL 378

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 224/388 (57%), Positives = 295/388 (76%), Gaps = 13/388 (3%)

Query: 9   EVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS----NEQELILGTHTSG 64
           E+++DEEYDLWKSNVPLMYDFVSETKL WP+LT++WLPS+  S    N QELILGTHTSG
Sbjct: 36  ELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTSG 95

Query: 65  TEQNYLKIASVHLPDEVV----SDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTR 120
            E NYLKIA++ LPDEVV    + +K      +D  +   +P+S IKIV+KF+H +E+TR
Sbjct: 96  EEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITR 155

Query: 121 ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSC 180
           AR+ P N ++IATI+GSG VF+Y++S D  SAL +   FHKENGYGL+F+    G+LLS 
Sbjct: 156 ARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLSG 215

Query: 181 SDDGSIAIWDV---CSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           SDDG+IA+WD+    +    P+K+ D+ HN+IVN+CKW+E +  +F SVS+DSTL +HD+
Sbjct: 216 SDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHDQ 275

Query: 237 RIDKPVVK-ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
           R    ++  I  ++P+NTLAFSKHS  L AAAGTDS V LYD R    P++SM+GH DS+
Sbjct: 276 REQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSI 335

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDF 355
           T+LEF+PH DG+L S  +DRRV++WD+  IGAEQ  +DA+DG PE++M+HAGH+S VNDF
Sbjct: 336 TNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDF 395

Query: 356 SCSPNIPWLMASVEEENVVQIWKASKKL 383
           S +PNIPWLMAS EEEN++Q+WK S KL
Sbjct: 396 SINPNIPWLMASAEEENIIQVWKCSHKL 423

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 280/376 (74%), Gaps = 10/376 (2%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNY 69
           +S+DEEY+LW+SNVPLMYDFVSET L WP+LT++WLP N  SN QELILGTHTS  E NY
Sbjct: 10  LSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTHTSEEEPNY 69

Query: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129
           LKIA++ LPDE+V       P  +D +  G   +S IKI++KF+H  EVTRARY P + N
Sbjct: 70  LKIAAIDLPDEIV-------PGKEDRERDGFT-KSNIKIIKKFKHEQEVTRARYMPQDSN 121

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           LIATI+GSG VFLYDRSKD D  L +   FH++NGYGL+F+ +  G+LLS SDD  IA+W
Sbjct: 122 LIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALW 181

Query: 190 DVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV-KILQ 247
           D+ +    PV   ++ H + VN+CKWHE +   FGSVS+D TL +HD+R+   V  KI  
Sbjct: 182 DITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKT 241

Query: 248 SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGI 307
              +NT+AFSKHS+NLFAAAGTDS + LYD R+    +H+MSGH  +VT+LEF   KDGI
Sbjct: 242 VTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGI 301

Query: 308 LCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMAS 367
           + S   DRRV++WDL +IGAEQ  +DADDG PE++M+HAGH+SPVNDFS +PNIPWLMAS
Sbjct: 302 VMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMAS 361

Query: 368 VEEENVVQIWKASKKL 383
            EEEN+VQ+WK S KL
Sbjct: 362 AEEENIVQVWKCSSKL 377

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  449 bits (1156), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 217/383 (56%), Positives = 286/383 (74%), Gaps = 9/383 (2%)

Query: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLP---SNDRSNEQELILGTHT 62
           P  E+S+DEEY+LW+SNVPLMYDFVSET+L WPSL+++WLP   S    N QELI+GTHT
Sbjct: 18  PNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHT 77

Query: 63  SGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRAR 122
           SG E NYLKIA++ LP++++     S    +D ++     +S IKI++KF+H +E+TRAR
Sbjct: 78  SGEEDNYLKIAAIDLPNDIIP----STEKLEDQQKGETTTKSNIKIIKKFKHEEEITRAR 133

Query: 123 YAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSD 182
           Y P N NL+ATI+GSGKVFLYDRSKD  S L + F +HKENGYGL+F+    G+LLS SD
Sbjct: 134 YMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSD 193

Query: 183 DGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR-IDK 240
           DG+IA+W+V +  ++P+ V +S H++IVN+CKW      +FGSVS+DSTL +HD+R  D 
Sbjct: 194 DGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDT 253

Query: 241 PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF 300
              +     P+NTLAFSKHS  LFAAAGTDS V L+D R    P+HSM+GH  +VT++EF
Sbjct: 254 FTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEF 313

Query: 301 APHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN 360
           +P +DGIL +   DRR +IWD+  IG EQ  +DA+DG PE+LM+HAGH+S +NDFS +PN
Sbjct: 314 SPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPN 373

Query: 361 IPWLMASVEEENVVQIWKASKKL 383
           IPWLMAS EEEN++Q+WK S KL
Sbjct: 374 IPWLMASSEEENIIQVWKCSHKL 396

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  447 bits (1149), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 278/381 (72%), Gaps = 9/381 (2%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNY 69
           ++V+EEY+LW SNVP+MY+FVSETKL WPSLTIQWLPS+ +S EQ LI GTHT+G E NY
Sbjct: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101

Query: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129
           LK+A+++LP  +           D+  E+     S   I  KF H +EV RARY P N N
Sbjct: 102 LKVATINLPAGI-----AGLDQGDEEDEANDH--SSFAIANKFPHIEEVIRARYMPANSN 154

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           +IATI+G G + ++DR+ +   A  +  +FHKENGYGL F+    GELLS SDD ++A+W
Sbjct: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214

Query: 190 DVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID-KPVVKILQS 248
           D+ + K  P  + TSH++IVN+ KWHE    +FG+VS+D TL +HDKR+  +PV K+  +
Sbjct: 215 DIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273

Query: 249 EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGIL 308
            P+NTL+FSKHS NL AAAG DSQ+ LYD+R   +P+H MSGH DSVT++EF+PH DGI+
Sbjct: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333

Query: 309 CSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASV 368
           CS  SDRR +IWDL QIGAEQ Q+DADDG PEL+MMHAGH+SPVN+FS +P IPWL+AS 
Sbjct: 334 CSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAST 393

Query: 369 EEENVVQIWKASKKLTSPYIP 389
           EE+NV+Q WK S KL +   P
Sbjct: 394 EEDNVIQAWKVSMKLVNASPP 414

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  444 bits (1141), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 280/380 (73%), Gaps = 11/380 (2%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTE 66
           E  ++VD+EY+LWK+NVPLMYDFVSET+L WPSLT QWLP ++    Q +ILGTHTSG E
Sbjct: 8   EEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEE 67

Query: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126
            +YLK+A++ LPDEVV+       + DD++ +    +S IKIV+KFEH  E+ RARY P 
Sbjct: 68  VDYLKVAALDLPDEVVT-----GEANDDNRRT----KSNIKIVKKFEHDGEINRARYMPK 118

Query: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186
           + N+IATI+G G V +YDRSK     L     +HKENGYGL+F+     EL+S SDD +I
Sbjct: 119 DSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTI 178

Query: 187 AIWDVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI 245
           A+WD+ SG  +P  V D  H++IVN+C WH     LFGSVS+DSTL +HDKR    V+  
Sbjct: 179 ALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINT 238

Query: 246 LQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
           +Q++  +NTLAFSKHS+NLFAAAG D+ + LYD R+   P+H M+GH D++T L+F P +
Sbjct: 239 IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKE 298

Query: 305 DGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWL 364
           DGIL SG +DRRV++WDL +IGAEQQ ++ADDG PE+LM+HAGH+S +NDF+  P IPWL
Sbjct: 299 DGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWL 358

Query: 365 MASVEEENVVQIWKASKKLT 384
            ASVEE+NVVQ+WK SK L+
Sbjct: 359 SASVEEDNVVQVWKCSKNLS 378

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  427 bits (1099), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 207/373 (55%), Positives = 274/373 (73%), Gaps = 11/373 (2%)

Query: 14  EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSN--DRSNEQELILGTHTSGTEQNYLK 71
           EEYDLWKSNVP+MYDFVSET+L+WPSLT+QWLP +  +    QELILGTHTS  EQNYLK
Sbjct: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLK 94

Query: 72  IASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLI 131
           IA V LP EV         +++ ++    Q +S I++ RKF+H  EVTRARY P +PN++
Sbjct: 95  IAVVDLPTEVTD-------TSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNIL 147

Query: 132 ATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV 191
           ATISG+G V++YDRS + D+A +    +H +NGYGL F+ +  G LLS SDD ++A+WDV
Sbjct: 148 ATISGTGTVYIYDRSNERDTA-SITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDV 206

Query: 192 CSGKNTPV-KVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEP 250
            S +N PV K +  H++IVN+C+WH     LFG+VS+DS+L IHD R  KPV  I  ++P
Sbjct: 207 TSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTKP 266

Query: 251 YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS 310
           +NTL+FS HS NL A  G +S+V LYD R  E P+H MSGH D+VTSL+F+   DGI+ S
Sbjct: 267 FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326

Query: 311 GSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEE 370
             +D+RV+IWD+  IGAEQ  EDA+D   E++M+HAGH+SP+NDF+ +P+IPWL+AS EE
Sbjct: 327 AGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEE 386

Query: 371 ENVVQIWKASKKL 383
           EN+VQ+WK S KL
Sbjct: 387 ENIVQLWKCSHKL 399

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  425 bits (1093), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 211/386 (54%), Positives = 276/386 (71%), Gaps = 13/386 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+  +  E     QELI+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64

Query: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121
           TSG E+NYLK A ++LP E++++      + +D + S   P+S IKI  K++H +E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124

Query: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181
           RY P NP  +ATI+G G VF+Y RS+     L +   FH+ENGY L+FS +  G LLS S
Sbjct: 125 RYMPQNPGTVATINGQGTVFIYSRSE----GLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 182 DDGSIAIWDVCSGKNTPVKVDT---SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           DD ++A+WDV    ++   + T    H++IVN+ KWH  +  LFG+VS+DS L I+D R+
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
           +       +  EP+NTLAFS HSSNL AAAGTDS V LYDLR  + P+H MSGH D+VT+
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357
           LEF+PH DG++ S  SD R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGHKS VNDF  
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 358 SPNIPWLMASVEEENVVQIWKASKKL 383
           +  IPWL+AS EEEN++Q+WK S  L
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSL 386

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 51/127 (40%), Gaps = 14/127 (11%)

Query: 129 NLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           NL+A       V+LYD     +       S H++    L FS    G ++S   D  + +
Sbjct: 265 NLLAAAGTDSHVYLYDLRNMKEPL--HHMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIM 322

Query: 189 WDV--CSGKNTP----------VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           WD+     + TP          + V   H + VN+   + + P+L  S  +++ L +   
Sbjct: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKC 382

Query: 237 RIDKPVV 243
               PVV
Sbjct: 383 SHSLPVV 389

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/386 (53%), Positives = 280/386 (72%), Gaps = 13/386 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPS-----NDRSNEQELILGTH 61
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+     +    +QELI+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64

Query: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121
           TSG E+NYLK A ++LP E++S+      + ++ + S   P+S I+I  K+EH +E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124

Query: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181
           RY P +PN++ATI+G G VFLY RS+     L +   FHK+NGY L+FS +  G LLS S
Sbjct: 125 RYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 182 DDGSIAIWDVCSGKN--TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           DD ++A+W+V SG +   PV+  +  H++I+N+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
           +   +  ++  +P+NTLAFS HSSNL AAAG DS V LYDLR  + P+H MSGH D+V +
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357
           LEF+ H DG++ S  SD R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 358 SPNIPWLMASVEEENVVQIWKASKKL 383
           +P IPWL+AS EEEN++Q+WK S  L
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSL 386

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 51/127 (40%), Gaps = 14/127 (11%)

Query: 129 NLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           NL+A       V+LYD     +       S H++    L FS    G ++S   D  + +
Sbjct: 265 NLLAAAGMDSYVYLYDLRNMKEPL--HHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMM 322

Query: 189 WDV--CSGKNTP----------VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           WD+     + TP          + V   H + VN+   + + P+L  S  +++ L +   
Sbjct: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKC 382

Query: 237 RIDKPVV 243
               P+V
Sbjct: 383 SHSLPIV 389

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  422 bits (1086), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/386 (54%), Positives = 277/386 (71%), Gaps = 13/386 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+  +  +     QELI+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64

Query: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121
           TSG E+NYLK A ++LP EV+++      +    + S   P+S I+I  K+EH +E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRA 124

Query: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181
           RY P +PN++ATI+G G VFLY RS      L +   FHK+NGY L+FS +  G LLS S
Sbjct: 125 RYMPQDPNMVATINGQGTVFLYSRS----DGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 182 DDGSIAIWDVCSGKN--TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           DD S+A+WDV  G +  TP++  D  H++IVN+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
           +   +   +  +P+NTLAFS HSSN+ AAAG DS V LYDLR  + P+H MSGH D+VT+
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357
           LEF+PH DG++ S  SD R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 358 SPNIPWLMASVEEENVVQIWKASKKL 383
           +  +PWL+AS EEEN++Q+WK S  L
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSL 386

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 14/130 (10%)

Query: 129 NLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           N++A       V+LYD     +       S H++    L FS    G ++S   D  + +
Sbjct: 265 NILAAAGMDSHVYLYDLRNMKEP--LHHMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIM 322

Query: 189 WDV--CSGKNTP----------VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           WD+     + TP          + V   H + VN+   + + P+L  S  +++ L +   
Sbjct: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKC 382

Query: 237 RIDKPVVKIL 246
               P+V  L
Sbjct: 383 SHSLPIVGGL 392

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  421 bits (1083), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 275/380 (72%), Gaps = 14/380 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTE 66
           E  ++VD+EYDLWKSNVPL+YDFVSET+L WPSLT+QWLP +  S  Q LILGT TSG E
Sbjct: 8   EEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAE 67

Query: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126
            +YLKIA++ LPDE++             K+S    +S +K+V+KF H  E+ RARY P 
Sbjct: 68  TDYLKIAALDLPDEIII-----------GKKSDKVVKSNLKVVKKFAHDGEINRARYMPQ 116

Query: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186
           N N+IAT++G G +F+YD S+D  SAL +   +HK+N YGL F+  + GEL+S SDD +I
Sbjct: 117 NTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTI 176

Query: 187 AIWDVCSGK-NTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR-IDKPVV 243
           A+WD  + K   P++   TSH++IVN+C+WH  +  +FGSVS+DSTL + DKR   K  V
Sbjct: 177 ALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDV 236

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI     YN++AFS  S NLFAAAGT + + LYD+R     +HSM+GH + VTSLEF+  
Sbjct: 237 KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSND 296

Query: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363
           KDGIL SGSSDRRV++WDLF+IGAEQQ ++ADDG+PE++M+HAG +S +ND S  P+IPW
Sbjct: 297 KDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPW 356

Query: 364 LMASVEEENVVQIWKASKKL 383
           L ASVEE N+VQ+WK S KL
Sbjct: 357 LNASVEENNIVQVWKCSSKL 376

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  417 bits (1072), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/386 (52%), Positives = 276/386 (71%), Gaps = 13/386 (3%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-----QELILGTH 61
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSL++QWLP+  +  E     QELI+GTH
Sbjct: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90

Query: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121
           TSG E+NYLK A +++P E++++      + +D K + + P+S I+I  K+ H +E+TRA
Sbjct: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150

Query: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181
           RY P NP+ +AT++G G VFLY RS      L +   FHK+NGY L+F+ +  G+LLS S
Sbjct: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 182 DDGSIAIWDVCSGKNT--PVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           DD ++A+W+V S   +  PV+  +  H++IVN+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
               +  ++  +P+NTLAFS HSSNL AAAG DS V LYDLR    P+H MSGH D+VT+
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357
           +EF+ H DG++ S  SD R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 358 SPNIPWLMASVEEENVVQIWKASKKL 383
           +  IPWL+AS EEEN++Q+WK S  L
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNL 412

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 129 NLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           NL+A       V+LYD     +       S H++    + FS    G ++S   D  + +
Sbjct: 291 NLLAAAGMDSHVYLYDLRNMREP--LHHMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIM 348

Query: 189 WDV--CSGKNTP----------VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           WD+     + TP          + V   H + VN+   + + P+L  S  +++ L +   
Sbjct: 349 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKC 408

Query: 237 RIDKPVV 243
             + P+V
Sbjct: 409 SHNLPIV 415

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  410 bits (1053), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/387 (51%), Positives = 271/387 (70%), Gaps = 14/387 (3%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND---RSNEQELILGTHTSGTE 66
           ++VDEEY+LWKSNVP++YDFVSET+L WP+LT++WLP  +       Q+LILGTHTSG E
Sbjct: 28  MTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSGEE 87

Query: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF 126
           QNYLKI +V LP EV  +   S    +  +E      S +KIV+KF H  E+TRARY P 
Sbjct: 88  QNYLKIGAVDLPVEVTEN---SKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQ 144

Query: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186
           + N+IATI+G GK+F+YDRSK+   AL +   +H ENGYGL F+      LLS SDD +I
Sbjct: 145 DDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNI 204

Query: 187 AIWDVCSGKNT---PVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
           A+WD+ + +      +  + +H +I+N+ KWH     +FGSVS+DST+ + DKR  + + 
Sbjct: 205 ALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSSQIIH 264

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
            I   +PYNTLAFS  SSNLFAAAGTD+ V LYD+R    P+++M+GH D+VT++EF P+
Sbjct: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324

Query: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363
            DGIL S  SDRR ++WDL +IGAEQ Q++ +DG PE+LM+HAGHK+ +ND + +PNI W
Sbjct: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384

Query: 364 LMASVEEENVVQIWKASKKLTSPYIPR 390
           L+AS EE+N+VQIWK S       IPR
Sbjct: 385 LVASAEEDNIVQIWKCSSN-----IPR 406

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  402 bits (1032), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 204/394 (51%), Positives = 277/394 (70%), Gaps = 21/394 (5%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS--NEQELILGTHTSG 64
           E E+S+DEEY LWKSNVPLMYDFVSETKL WPSLT++WLP + ++   +QE+I+GTHTS 
Sbjct: 7   ERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSD 66

Query: 65  TEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYA 124
            E NY+KIAS+ LP+EV+          D    S    +S ++I +KF+   E+TR+RY 
Sbjct: 67  QEPNYVKIASIELPNEVI----------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYM 116

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
             +PN+I+TI G+G V ++DR+  SDS +   +S+HK+NGYGL+F+ IS G+LLS +DDG
Sbjct: 117 VQDPNIISTIDGNGTVSIFDRNS-SDSPVKT-YSYHKDNGYGLSFNPISKGQLLSAADDG 174

Query: 185 SIAIWDVCSGKNTPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDD-STLIIHDKRIDKPV 242
            IA++D+ +    PV+   ++ N I+N+ KWH     LFG+VS++ +TL I+D R    V
Sbjct: 175 YIAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDKV 234

Query: 243 VKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAP 302
             I   +P+N+LAFSKHS NLF+AAGTD  V LYDLR     +HSMSGH   VT+LEF  
Sbjct: 235 TSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHD 294

Query: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIP 362
             DGIL S S DRR++IWDL +IG+EQ  EDA D  PEL+M+HAGH+S VNDFS + +IP
Sbjct: 295 SVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIP 354

Query: 363 WLMASVEEENVVQIWKASKKL-----TSPYIPRD 391
           WL+AS EEEN++Q+WK+S +L     + P+I  D
Sbjct: 355 WLIASTEEENIIQVWKSSSRLPRISNSKPFINYD 388

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  383 bits (983), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/397 (49%), Positives = 276/397 (69%), Gaps = 26/397 (6%)

Query: 2   QATIPENE--VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDR----SNEQE 55
           ++TI E E  ++ D+EY+LWKSNVPL+YDFVSETKL+WPSLT++WLPSN+     SNEQ 
Sbjct: 10  KSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQR 69

Query: 56  LILGTHTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHR 115
           L+LGTHTSG EQNYLKIA + LPD+++++       T+D+  S    +S I+I++KF+H 
Sbjct: 70  LLLGTHTSGEEQNYLKIAEITLPDQIINE------KTEDN--SDKHVKSNIRIIKKFKHE 121

Query: 116 DEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSA--LTAEFSFHKENGYGLNFSVIS 173
            EVTRA Y P +  +IATI+G G VF+YD S D + +  + ++ S HKENGYGL F+ + 
Sbjct: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181

Query: 174 PGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLII 233
            G+LLS SDDGS+A W++   K+ P+ +     +I+N+ +W++ +  LFG V++ S L +
Sbjct: 182 KGKLLSSSDDGSVAYWNI--QKSIPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNL 238

Query: 234 HDKRIDKPVVKILQSE------PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHS 287
            D R +   +KI+ +        +N +AFS HS  L AA+G DS + LYD R    P+H 
Sbjct: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG-VPELLMMHA 346
           M GH DSVTSL+F    DGI+ SG SD+RV +WDL QIG EQ  ++ +DG VPELLM+HA
Sbjct: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358

Query: 347 GHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
           GH+SP+NDFS S N+ WL AS+EE+N+VQ+WK +  L
Sbjct: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  149 bits (376), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 117/421 (27%), Positives = 198/421 (47%), Gaps = 57/421 (13%)

Query: 2   QATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTH 61
           Q+TIP +   + + Y  WK N  L+YD+++     WPSLT Q+ P  D +++   IL + 
Sbjct: 10  QSTIPND---LQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILIS- 65

Query: 62  TSGTEQNYLKIASVHLPD-EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRD---- 116
            S T     +  ++H+     +  +  ++ +  D  E   +P + +K+  K    D    
Sbjct: 66  -SFTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIK 124

Query: 117 ----EVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSAL------------------- 153
               +  RARY P NP++IA  S +G V+++DR+K   S +                   
Sbjct: 125 FPNGDCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSET 184

Query: 154 TAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNI----- 208
             E   +      L ++    G L SC   G + IWD+    ++   +D    NI     
Sbjct: 185 VEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDAL 244

Query: 209 -VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE---PYNTLAFSKHSSNLF 264
            VN+  W      LF +  +  TL + D+RI K V +I Q+      N+  F+  ++ L 
Sbjct: 245 GVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLL 304

Query: 265 AAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDL 322
           A+A ++  V ++D+R   + PI S++ H  S++++E+ P+ D I+ + G +D  V +WD+
Sbjct: 305 ASADSEGLVNMWDIRNLDQYPIKSIN-HGSSISTIEWNPNLDTIIATAGQNDGLVKLWDV 363

Query: 323 FQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKK 382
                     + D+   ELL +H GH   VND S   +  WLM SV  +N +QIWK +  
Sbjct: 364 ---------SNTDN---ELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHN 411

Query: 383 L 383
           L
Sbjct: 412 L 412

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  149 bits (375), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 118/420 (28%), Positives = 193/420 (45%), Gaps = 53/420 (12%)

Query: 3   ATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS-NEQELILGTH 61
           + IPE+     + Y  WK N  L+Y++++     WPSLT Q  P  D + +E  ++L + 
Sbjct: 15  SAIPEDR---QQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSF 71

Query: 62  TSGT--EQNYLKIASV----HLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVR-KFEH 114
           TS    E   + +A +    H+P   +++                 P++ ++ +R KF  
Sbjct: 72  TSSQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPA 131

Query: 115 RDEVTRARYAPFNPNLIATISGSGKVFLYDRSK------------DSDSALTAEFSFHKE 162
            D   +ARY P NP+LI++ S +G V+++DR+K            D D  +  + S   E
Sbjct: 132 GD-CNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLE 190

Query: 163 N----GYGLNFSVISPGELLSCSDDGSIAIWDVCS-GKNTPVKVDTSHNNIV------NE 211
                   L ++    G L +C   G + +WD+    K +P  +D  H++++      N+
Sbjct: 191 ERQNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDP-HSSLLADPQGSND 249

Query: 212 CKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKIL----QSEPYNTLAFSKHSSNLFAAA 267
             W      L     + + L + D RI K   +       S   N   F+ +   L  +A
Sbjct: 250 ISWMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSA 309

Query: 268 GTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIG 326
            +  ++ L+D+R   +PI S+  HH SV++L++ PH   IL + G  D  V IWDL Q  
Sbjct: 310 DSAGRINLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPV 368

Query: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSP 386
            +           EL   H GH   VND S  PN PW+M SV  +N +Q+WK S+ L +P
Sbjct: 369 DQ-----------ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLMTP 417

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  146 bits (369), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 120/413 (29%), Positives = 188/413 (45%), Gaps = 49/413 (11%)

Query: 4   TIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQ-ELILGTHT 62
           TIPE    V   Y  WK N  L+YD+++     WPSLT Q+ P  D +N+Q  L+L + T
Sbjct: 25  TIPE---EVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFT 81

Query: 63  SGT----EQNYLKIASV--HLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRD 116
           S      E  Y+   S   HLP   +++             S    ++ IK +       
Sbjct: 82  SSQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMG 141

Query: 117 EVTRARYAPFNPNLIATISGSGKVFLYDRSK---------DSDSALTAEFSF-----HKE 162
           +   ARY P NP++IA  S +G ++++DR+K         D  S    EF       H+E
Sbjct: 142 DCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQE 201

Query: 163 NGYGLNFSVISPGELLSCSDDGSIAIWDVCS-GKNTPV--KVDTSHN---NIVNECKWHE 216
               L ++    G L +C   G + +WDV    +N PV  K D +HN      N+  W  
Sbjct: 202 -VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMV 260

Query: 217 KSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ-----SEPYNTLAFSKHSSNLFAAAGTDS 271
               +     + +++ + D R  K V+   +     S   N+  F+ H+  L  +  +  
Sbjct: 261 NHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG 320

Query: 272 QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSG-SSDRRVLIWDLFQIGAEQQ 330
           +V L+D+R  E P+ S+  H  S++  ++ P+   IL +   SD  V +WD+ Q   E  
Sbjct: 321 RVNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-- 377

Query: 331 QEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
                    ELL +H GH   VND S + + PWLM SV  +N VQ+W+ ++ L
Sbjct: 378 ---------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  144 bits (362), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/418 (27%), Positives = 198/418 (47%), Gaps = 62/418 (14%)

Query: 12  VDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-QELILGTHTSGTEQNYL 70
           + + Y  WK N  L+YD+++     WPSLT Q+ P  D+SN+   L+L T TS    +  
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLSTFTSSQIPDDE 72

Query: 71  KIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRD--------EVTRAR 122
            I   H+    ++ +  S+ +  D  E   +P ++IK   K    D        +  +AR
Sbjct: 73  SIYISHI--STLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKAR 130

Query: 123 YAPFNPNLIATISGSGKVFLYDR------------------SKDSDSALTAEFSFHKENG 164
           Y P NP++I   S +G ++++DR                  SK  ++ L  +  F  E+G
Sbjct: 131 YMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDG 190

Query: 165 YGLN-FSVIS-------PGELLSCSDDGSIAIWDV---CSGKNTPVK---VDTSHNNI-V 209
              + F  +S        G+LLSC  +G+I +WD     S KN  +     DT+ +++  
Sbjct: 191 TKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGC 250

Query: 210 NECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE---PYNTLAFSKHSSNLFAA 266
           NE  W      +F +  +++ + + D R +  V  I Q       N+  F+  ++ L A+
Sbjct: 251 NEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLAS 310

Query: 267 AGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS-DRRVLIWDLFQI 325
             ++  + L+D+RK   PI ++  H  S++++E++P  + ++ SG   D  V +WD   I
Sbjct: 311 GDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD---I 366

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
             E+          E + +H GH   +ND S   + PWL+ SV  +N +QIWK +K L
Sbjct: 367 SNEE----------EPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPAKHL 414

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  139 bits (350), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/423 (26%), Positives = 197/423 (46%), Gaps = 62/423 (14%)

Query: 2   QATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDR-SNEQELILGT 60
           Q++IPE+   + + Y  WK N  L+YD+++     WPSLT Q+    D  S+   ++L  
Sbjct: 11  QSSIPED---LQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLSA 67

Query: 61  HTSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEV 118
            TS    E   + IA +      +  ++ ++ +  D  E   +P++ IK+  K    D  
Sbjct: 68  FTSSQLPEDEAIYIAKL----STLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDIS 123

Query: 119 TR--------ARYAPFNPNLIATISGSGKVFLYDRSKDS-------------DSALTA-- 155
            R        ARY P NP++IA  S  G ++++DR+K               ++AL    
Sbjct: 124 IRFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPP 183

Query: 156 ---EFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNI---- 208
              E   +      +++++   G L SC   G I +WD+    N+ +++DT   N+    
Sbjct: 184 KGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDA 243

Query: 209 --VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI---LQSEPYNTLAFSKHSSNL 263
             VN+  WH     +  +  + + + + D R+   +++    + +   N+  F+ H  +L
Sbjct: 244 LGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSL 303

Query: 264 FAAAGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWD 321
             +  ++ ++ L+DLRK +  PI ++  H  S+++LE+ P+ + I+ S G  D  V +WD
Sbjct: 304 LISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWD 362

Query: 322 LFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASK 381
           +                 EL+  H GH   VND S + +  WLM SV  +N VQ+WK + 
Sbjct: 363 V--------------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAH 408

Query: 382 KLT 384
            L 
Sbjct: 409 NLV 411

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  138 bits (347), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 111/409 (27%), Positives = 187/409 (45%), Gaps = 50/409 (12%)

Query: 14  EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND-RSNEQELILGTHTSGT--EQNYL 70
           + Y  WK N  L YD+++     WPSLT Q  P  D  ++E  ++L + TS    E   L
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESL 82

Query: 71  KIASV----HLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVR-KFEHRDEVTRARYAP 125
            +A +    H+P   +++                  +S ++ +R KF   D   +ARY P
Sbjct: 83  YVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGD-CNKARYCP 141

Query: 126 FNPNLIATISGSGKVFLYDRSK------------DSDSALTAEFSF----HKENGYGLNF 169
            NP+LI + S +G ++++DR+K            D+D  +  + S     HK     L +
Sbjct: 142 SNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAW 201

Query: 170 SVISPGELLSCSDDGSIAIWDVCS-GKNTPVKVDTSHNNIV-----NECKWHEKSPFLFG 223
           +    G L +    G + +WD+    KN+P  ++    + V     NE  W  +   L  
Sbjct: 202 NWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLA 261

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPY-----NTLAFSKHSSNLFAAAGTDSQVQLYDL 278
             S+D+ + I D R +    +   S P+     NT  F+ H   L  +A +  ++ L+D+
Sbjct: 262 YCSEDNLVGIMDIR-NPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDI 320

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVL-IWDLFQIGAEQQQEDADDG 337
           R    P+ ++  H+DS++ L++ P +  +L +G  D  ++ IWDL Q   +         
Sbjct: 321 RNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ--------- 370

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSP 386
             EL+  H GH   VND S  P+  W+M SV  +N +Q+W+ S  L  P
Sbjct: 371 --ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSLVEP 417

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  137 bits (344), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 115/431 (26%), Positives = 196/431 (45%), Gaps = 68/431 (15%)

Query: 2   QATIPENEVSVD--EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS-NEQELIL 58
           +AT   + +S D  E Y  WK N  L+YD+++     WPSLT Q+ P  D + NE  ++L
Sbjct: 7   EATKEASYISADLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILL 66

Query: 59  GTHTSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSK--------IKI 108
            + TS    E   + I+ +      +  +K ++ +  D  E   +P++         +  
Sbjct: 67  SSFTSSQKPEDETIYISRI----STLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDD 122

Query: 109 VRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDS-----DSALTAEFSFHKEN 163
           +R F    E  RARY P NP++IA  S  G ++++DR+K        S ++  F      
Sbjct: 123 IRIFFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLG 182

Query: 164 GYG-------LNFSVISPGE-------------LLSCSDDGSIAIWDVCSGK------NT 197
            +G       ++ S++   E             LLS   +G I +WD+          + 
Sbjct: 183 SHGVIQDVETMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDV 242

Query: 198 PVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK---ILQSEPYNTL 254
           P+    S  + VN+  W      LF + ++ + + + D R  K  +K    +     N+ 
Sbjct: 243 PLMSIDSDGSSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSC 302

Query: 255 AFSKHSSNLFAAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GS 312
            F+  +S + A+A ++ ++ L+D+R   E PI +M  H  SV++LE++P+ D +L + G 
Sbjct: 303 KFNYKNSLILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQ 361

Query: 313 SDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEEN 372
            D  V +WD  +               E +  H GH   VND S   + PWLM SV  +N
Sbjct: 362 EDGLVKLWDTTR--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDN 407

Query: 373 VVQIWKASKKL 383
            V IWK ++ +
Sbjct: 408 SVHIWKPAENI 418

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  135 bits (341), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/412 (27%), Positives = 185/412 (44%), Gaps = 60/412 (14%)

Query: 12  VDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPS-NDRSNEQELILGTHTSGT--EQN 68
           + E Y  WK N  L+YD+++     WPSL+ Q+    N +++   ++L + TSG   EQ 
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 69  YLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEV--------TR 120
            + I S+      +  V  ++ +  D  E   +P + +K+  K  H ++          R
Sbjct: 83  SINIMSI----STLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNR 138

Query: 121 ARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK--------EN--------- 163
           ARY P N ++IA  S  G V++++R+K   S L    SF          EN         
Sbjct: 139 ARYLPQNQDIIAGASSDGTVYIFNRTK-YGSTLRQTSSFQSYQARFAEPENTVQSVDSNP 197

Query: 164 --GYGLNFSVISPGELLSCSDDGSIAIWDV--CSGKNTPVKVDT----SHNNIVNECKWH 215
                ++++V   G L +   DG I  WD+   S  NT +   T       N  N+  W 
Sbjct: 198 NEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWM 257

Query: 216 EKSPFLFGSVSDDSTLIIHDKRIDKPVVKI---LQSEPYNTLAFSKHSSNLFAAAGTDSQ 272
                L  +  + + LII+D R  +    I   +  +  N   F+  ++ + A+A T   
Sbjct: 258 PLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGN 317

Query: 273 VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIGAEQQQ 331
           V ++D+RK    + ++  H  S++++E+ P+ D IL + G  D  V +WD+         
Sbjct: 318 VHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD------- 369

Query: 332 EDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
                   EL+  H GH   VND S + + PWLM SV  +N VQIW+ +  L
Sbjct: 370 -------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  135 bits (340), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 115/414 (27%), Positives = 190/414 (45%), Gaps = 67/414 (16%)

Query: 14  EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPS-NDRSNEQELILGTHTSGT--EQNYL 70
           + Y  WK N  L+Y++++     WPSLT Q+ P  N +++   ++L + TS    E   L
Sbjct: 23  DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVPEDESL 82

Query: 71  KIASVHLPDEVVSDVKCSAPSTDDSKESGHQP-QSKIKI---------VRKFEHRDEVTR 120
            I  +      +  +  ++ +  D  E   +P  S IK+         V +F + D   R
Sbjct: 83  YITRI----STLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNGD-CNR 137

Query: 121 ARYAPFNPNLIATISGSGKVFLYDRSK------DSDSALTAEF-----------SFHKEN 163
           ARY P NP+LIA  S  G V+++DR+K         S  T  +           S + EN
Sbjct: 138 ARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGEN 197

Query: 164 -GYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNT-PV--------KVDTSHNNIVNECK 213
               ++++    G L+    DG +  WD+   K + PV        K+D S     N+  
Sbjct: 198 EALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESG---CNDAV 254

Query: 214 WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI---LQSEPYNTLAFSKHSSNLFAAAGTD 270
           W  +   LF + S+D+ L + D R +  ++ I   +     N   F+  +S L A+  + 
Sbjct: 255 WMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSI 314

Query: 271 SQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIGAEQ 329
             + L+D+RK E PI+ +  H  S++++E+ P+   +L S G  D  V +WD        
Sbjct: 315 GNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA------- 366

Query: 330 QQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
                  G  + + +H GH   VND S + + PWLM SV ++N +QIWK +  L
Sbjct: 367 -------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  134 bits (338), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/414 (27%), Positives = 186/414 (44%), Gaps = 51/414 (12%)

Query: 4   TIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTS 63
           TIPE+     + Y LWK N  L+YD+++     WPSL+ Q+ P  D S++   +L T  +
Sbjct: 3   TIPEDR---QQRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFT 59

Query: 64  GT---EQNYLKIASV----HLPDEVVSDVKCSAPSTDDSKESGHQPQS-KIKIVRKFEHR 115
            +   +   + IAS+    H+P   +++             +   P++ +I++   F H 
Sbjct: 60  SSQLPQDENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPHG 119

Query: 116 DEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSA---LTAEFS---FHKENG----- 164
           D   RA Y P NP+LI+T S  G V+++DR+K   S    L   F        NG     
Sbjct: 120 D-CNRATYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGE 178

Query: 165 -YGLNFSVISPGELLSCSDDGSIAIWDVCS-GKNTPVKVDTSHNNI------VNECKWHE 216
              L+++    G L S   +G + IWD+    K  P+    S + I       N+  W  
Sbjct: 179 TVALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMP 238

Query: 217 KSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPY----NTLAFSKHSSNLFAAAGTDSQ 272
               L     +D+ + + D R +  + +   S  +    N   F+     L A A  D  
Sbjct: 239 SHDCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGL 298

Query: 273 VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS-DRRVLIWDLFQIGAEQQQ 331
           VQL+D+RK   PI +++     +++LE+ P    +L +G   D  V +W           
Sbjct: 299 VQLWDIRKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW----------- 346

Query: 332 EDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTS 385
            +A +G  +LL  H GH   VND + SP+  WLM SV  +N   +WK + +L +
Sbjct: 347 -NASNG--QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRLVT 397

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  134 bits (338), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 102/401 (25%), Positives = 185/401 (46%), Gaps = 36/401 (8%)

Query: 12  VDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLK 71
           V + Y  WK N  L+YD+++     WPSL+ Q+ P    +N+++ IL   +S T Q   +
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRIL--LSSFTSQQLPQ 77

Query: 72  IASVHLPD-EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRK-FEHRDEVT-------RAR 122
             S+++     ++ +K S+ +  D  E   +  + +K+  K  E    +T       R R
Sbjct: 78  DESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCR 137

Query: 123 YAPFNPNLIATISGSGKVFLYDRSKDSDSALTA-EFSFH-KENG-------YGLNFSVIS 173
           Y P NP++I T S +G V+++DR+K  +   T  +F    + NG         L ++   
Sbjct: 138 YMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNYQL 197

Query: 174 PGELLSCSDDGSIAIWDVCSGKNT------PVKVDTSHNNIVNECKWHEKSPFLFGSVSD 227
            G L +C  +G + +WD+     +      P +      N VN+  W      +  S  +
Sbjct: 198 EGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGE 257

Query: 228 DSTLIIHDKRIDKPVV---KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAP 284
            + + + D R D  +    +   ++  N + F+  +  +     +  Q++++D+R  + P
Sbjct: 258 SNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDFKEP 317

Query: 285 IHSMS-GHHDSVTSLEFAPHKDGILCSGSSDRRVL-IWDLFQIGAEQQQEDADDGVPELL 342
           I     G  D ++++++ P    IL +      ++ IWD     A  +QED++     LL
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD-----ASGEQEDSNAENNMLL 372

Query: 343 MMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
            +H GH   VND S S + PW M SV  +N + IWK +  L
Sbjct: 373 FVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  134 bits (338), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 111/421 (26%), Positives = 188/421 (44%), Gaps = 66/421 (15%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND-RSNEQELILGTHTSGT--E 66
           + + E Y  WK N  L+YD+++     WPSLT Q+ P  D  S+E  ++L + TS    E
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKPE 76

Query: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRK--------FEHRDEV 118
              + I+ +      +  +K S+ +  D  E   +P++  +   K        F    E 
Sbjct: 77  DETIYISKI----STLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGEC 132

Query: 119 TRARYAPFNPNLIATISGSGKVFLYDRSKDSDSAL----------TAEFSFHK------- 161
            RARY P NP++IA  S  G ++++DR+K   + +          T  F  H        
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEA 192

Query: 162 --------ENGYGLNFSVISPGELLSCSDDGSIAIWDV--CSGKN----TPVKVDTSHNN 207
                        L +++     LLS   +G + +WD+   S +N     P+    S   
Sbjct: 193 MDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGT 252

Query: 208 IVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE---PYNTLAFSKHSSNLF 264
            VN+  W      LF + ++ + + + D R  K  ++  + +     N+  F+  +S + 
Sbjct: 253 AVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLIL 312

Query: 265 AAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDL 322
           A+A ++ ++ L+D+R   ++PI +M  H  SV++LE++P+ D +L + G  D  V +WD 
Sbjct: 313 ASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT 371

Query: 323 FQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKK 382
                            E +  H GH   VND S   + PWLM SV  +N V IWK +  
Sbjct: 372 --------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGN 417

Query: 383 L 383
           L
Sbjct: 418 L 418

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  131 bits (329), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 191/421 (45%), Gaps = 66/421 (15%)

Query: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS-NEQELILGTHTSGT--E 66
           + + E Y  WK N  L+YD+++     WPSLT Q+ P  D + +E  ++L + TS    E
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPE 76

Query: 67  QNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKI--------VRKFEHRDEV 118
              + I+ +      +  +K S+ +  D  E   +P++  ++        +  F    + 
Sbjct: 77  DETIYISKI----STLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDC 132

Query: 119 TRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK----------------- 161
            RARY P NP++IA  S  G ++++DR+K   + +    + H                  
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEA 192

Query: 162 --------ENGYGLNFSVISPGELLSCSDDGSIAIWDV--CSGKN----TPVKVDTSHNN 207
                        L +++     LLS   +G + IWD+   S +N    +P+    S  +
Sbjct: 193 MDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDAS 252

Query: 208 IVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ---SEPYNTLAFSKHSSNLF 264
            VN+  W      LF + ++ + + + D R  K  ++  +   +   N+  F+  +S + 
Sbjct: 253 GVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVL 312

Query: 265 AAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDL 322
           A+A ++ ++ L+D+RK  E+PI +M  H  S+++LE+ P+   +L + G  D  V +WD 
Sbjct: 313 ASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWDT 371

Query: 323 FQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKK 382
            +               E +  H GH   VND S   + PWLM SV  +N V IWK ++ 
Sbjct: 372 AR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAEN 417

Query: 383 L 383
           L
Sbjct: 418 L 418

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/425 (27%), Positives = 193/425 (45%), Gaps = 65/425 (15%)

Query: 3   ATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQ-ELILGTH 61
           +TIPE+   V   Y  WK N  L+YD+++     WPSLT Q+ P  D S++Q  L+L + 
Sbjct: 15  STIPED---VQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSF 71

Query: 62  TSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRK-------- 111
           TS    E   + I+ +      +  +  S+ +  D  E   +P   +K+  K        
Sbjct: 72  TSSQLPEDESVYISKI----STLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSI 127

Query: 112 -FEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFS--FHKENGYG-- 166
            F + D   R+RY P NP+LIA  S  G V++++++K  +S L ++ S  F      G  
Sbjct: 128 RFPNGD-CNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSH 186

Query: 167 -------------LNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVD------TSHNN 207
                        L+++    G L      G   IWDV     + + +       T  +N
Sbjct: 187 DAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSN 246

Query: 208 IVNECKWHEKSPFLFGSVSDDSTLIIHDKRID-----KPVVKILQSEPYNTLAFSKHSSN 262
             N+  W      +F +  + + L + D R++       +      +  NT  F+  +S 
Sbjct: 247 GCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSL 306

Query: 263 LFAAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIW 320
           L A+A T  ++ L+D+RK  + PI +M  H  S++++E+ P+   +  S G  D  V +W
Sbjct: 307 LVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLW 365

Query: 321 DLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
           D   +G E             + +H GH   VND S   + PWLMASV  +N +QIW+ +
Sbjct: 366 DA-SVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPA 411

Query: 381 KKLTS 385
           K + S
Sbjct: 412 KNIVS 416

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 111/421 (26%), Positives = 193/421 (45%), Gaps = 62/421 (14%)

Query: 3   ATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-QELILGTH 61
           ++IP++   + E Y  WK N  L+Y +++     WPSLT Q+ P  D + +   ++L T 
Sbjct: 10  SSIPDD---LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTF 66

Query: 62  TSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRD--- 116
           TS    E   L IA++   +     +  S+ +  D  E   +P +  K   K  + D   
Sbjct: 67  TSSQLPEDESLYIANLSTSNH----LNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISI 122

Query: 117 -----EVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTA-----EFSFHKENGYG 166
                +  RARY P NP+L+A  S +G +++++R+K     L +     E   +  +   
Sbjct: 123 PFPNGDCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMD 182

Query: 167 LNFS-----------VISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNI------V 209
            NF+           +   G L S    GSI IWD+     +   +  +   I       
Sbjct: 183 ENFTNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGC 242

Query: 210 NECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ-----SEPYNTLAFSKHSSNLF 264
           NE  W      +F + S+ + L + D R  + ++K+ +     S   N+  F+ ++  L 
Sbjct: 243 NEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLL 302

Query: 265 AAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDL 322
           A+A +  ++ ++D+RK  + PI S + H+ S+++LE+ P+ + IL + G  D  V IWD 
Sbjct: 303 ASADSTGKINMWDIRKLDKEPIKSFN-HNSSISTLEWNPNLETILVTAGQDDGLVKIWDT 361

Query: 323 FQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKK 382
               A  Q           + +H GH   VND S   + PWL++SV  +N + +WK +  
Sbjct: 362 ----ANGQN----------IFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATN 407

Query: 383 L 383
           L
Sbjct: 408 L 408

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  129 bits (324), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 185/412 (44%), Gaps = 58/412 (14%)

Query: 14  EEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNE-QELILGTHTSGT--EQNYL 70
           + Y  WK N  L+YD+++     WPSLT ++ P  D + +   L+L + TS    E   +
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDESI 76

Query: 71  KIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRD--------EVTRAR 122
            I+ +      +  +  S+ +  D  E   +P++  K+  +    D        +  RAR
Sbjct: 77  YISRI----STLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRAR 132

Query: 123 YAPFNPNLIATISGSGKVFLYDRSKDSDS----------------ALTAEFSFHKENGYG 166
           Y P NP++I+  S  G ++++DR+K + +                A   E          
Sbjct: 133 YLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVS 192

Query: 167 LNFSVISPGELLSCSDDGSIAIWDVCS------GKNTPV-KVDTSHNNIVNECKWHEKSP 219
           L+++    G L SC   G + +WD+           TP+  +D       N+  W     
Sbjct: 193 LDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHD 252

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKI---LQSEPYNTLAFSKHSSNLFAAAGTDSQVQLY 276
            L  +  + +T+ I+D R    V KI   L +   N+  F+ H+  L A+A +   V ++
Sbjct: 253 SLLAACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMW 312

Query: 277 DLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILC-SGSSDRRVLIWDLFQIGAEQQQEDA 334
           D+RK  + PI S+S H  S++++++ P+   I+  +G  D  V +WD            A
Sbjct: 313 DIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------A 359

Query: 335 DDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSP 386
            +G  +L+  H GH   VND + + + PWLM SV  +N + +W+ S  L  P
Sbjct: 360 SNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLVEP 409

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  128 bits (321), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 110/428 (25%), Positives = 191/428 (44%), Gaps = 69/428 (16%)

Query: 3   ATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRS-NEQELILGTH 61
           + IP N   + E Y  WK N  L+Y++++     WPSLT Q+ P  D + +E  ++L + 
Sbjct: 13  SNIPPN---LQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSF 69

Query: 62  TSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKI--------VRK 111
           TS    E   + I+ +      +  +K S+ +  D  E   +P++  +         +  
Sbjct: 70  TSSQKPEDESIYISKI----STLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISI 125

Query: 112 FEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAE----------FSFHK 161
           F    E  RARY P NP++IA  S  G ++++DR+K   + +             F  H 
Sbjct: 126 FFPNGECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHG 185

Query: 162 ---------------ENGYGLNFSVISPGELLSCSDDGSIAIWDV--CSGKN----TPVK 200
                               + +++     LLS   +G + +WD+   S +N     P+ 
Sbjct: 186 VIQDVETMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLV 245

Query: 201 VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI---LQSEPYNTLAFS 257
              S  + VN+  W      LF + ++ +T+ + D R  K  +K      +   N+  F+
Sbjct: 246 SINSDGSGVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFN 305

Query: 258 KHSSNLFAAAGTDSQVQLYDLRK-PEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDR 315
             +S + A+A ++ ++ L+D+R   + P+ +M  H  SV++LE++P+ D +L + G  D 
Sbjct: 306 YRNSLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDG 364

Query: 316 RVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQ 375
            V +WD  +               E +  H GH   VND S   + PWLM SV  +N V 
Sbjct: 365 LVKLWDTSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVH 410

Query: 376 IWKASKKL 383
           IWK +  L
Sbjct: 411 IWKPAVNL 418

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  124 bits (312), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 107/420 (25%), Positives = 180/420 (42%), Gaps = 59/420 (14%)

Query: 15  EYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND-RSNEQELILGTHTSGT--EQNYLK 71
            Y  WK N  L+YD+++     WPSLT Q+ P  D  ++   ++L ++TS    E   + 
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDENVY 77

Query: 72  IASV----HLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFN 127
           +AS+    HL    +++           + +   P++    V     R +  RARY P N
Sbjct: 78  VASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPRGDCNRARYMPQN 137

Query: 128 PNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYG--------------------- 166
           P++IA  S +G V++++R+K     +    +   E  YG                     
Sbjct: 138 PDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRTPVDN 197

Query: 167 ----LNFSVISPGELLSCSDDGSIAIWDV-------CSGKNTPVKVDTSHNNIVNECKWH 215
               L ++    G L      G++ +WD+        +   T  +     +  VN+  W 
Sbjct: 198 EAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVNDVSWM 257

Query: 216 EKSPFLFGSVSDDS-TLIIHDKRIDKPVVKI---LQSEPYNTLAFSKHSSNLFAAAGTDS 271
            +   +  +  + S +L + D R    V KI    +SE  N   F+  ++ L A+  +  
Sbjct: 258 SQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG 317

Query: 272 QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIGAEQQ 330
           +  L+D+RK  A       H  SV++LE+ PH   +L + G SD  + IWD        +
Sbjct: 318 RTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD-----TSLE 372

Query: 331 QEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL----TSP 386
            ED      + + +H+GH   VND +   + PWLM SV  +N V +WK +  L    TSP
Sbjct: 373 IED------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLVQRCTSP 426

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  121 bits (303), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 101/405 (24%), Positives = 181/405 (44%), Gaps = 45/405 (11%)

Query: 12  VDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDR-SNEQELILGTHTSGT----E 66
           + + Y  WK N  L+YD+++     WPSLT Q++P  +  +++  L+L + TS      E
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDE 80

Query: 67  QNYLKIASV--HLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYA 124
             Y+   S   H+P   +++            ++    ++ ++ VR      +  RA Y 
Sbjct: 81  AVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYM 140

Query: 125 PFNPNLIATISGSGKVFLYDRSKDS-------DSALTAEFSFHKENGYG---------LN 168
           P NP++I  I+ +G V ++DR+K          SA + E   ++    G         L 
Sbjct: 141 PQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLA 200

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIV------NECKWHEKSPFLF 222
           ++    G + S   +G I +WD+   + +   +      I+      N+  W      + 
Sbjct: 201 WNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSIL 260

Query: 223 GSVSDDSTLIIHDKRID---KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLR 279
            +  + +T+ + D R     KP      +   N L F+  +  L  AA ++  + L+D R
Sbjct: 261 AACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWDCR 320

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIGAEQQQEDADDGV 338
               P+ S+  H DSV++L++ P+   I+ + G  D  + IWD       ++ ED+    
Sbjct: 321 AFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSREPEDS---- 370

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
             LL +H GH   VND + + + PWLM SV  +N V +WK +  L
Sbjct: 371 --LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 187/419 (44%), Gaps = 59/419 (14%)

Query: 3   ATIPENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSND-RSNEQELILGTH 61
           ++IPE    + + Y  WK N  L+Y++++     WPSLT Q++P  D  S++  ++L + 
Sbjct: 15  SSIPE---PLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSF 71

Query: 62  TSGT--EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEH----- 114
           TS    E   + I+ +      +  +  S+ +    +E   +  +++K+ +         
Sbjct: 72  TSAQLPEDEAIYISEI----STMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQ 127

Query: 115 --RDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDS---ALTAEFSFH---KENGYG 166
               +  RARY P NP++IA+ S  G V+++DR+K   +    L   F +    KE   G
Sbjct: 128 FPEGDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESG 187

Query: 167 LNFSVIS-------PGELLSCSDDGSIAIWDVCS-GKNTPV--------KVDTSHNNIVN 210
            N+   S        G L +   DG + IWD+    K  P         +VD       N
Sbjct: 188 CNYEASSLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEG---AN 244

Query: 211 ECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQS---EPYNTLAFSKHSSNLFAAA 267
           E  W      +     + + L I D R          S      N + F+  +  L  +A
Sbjct: 245 EVSWMVHHSSILAVCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSA 304

Query: 268 GTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIG 326
            ++  + + D+R+ E P+ + S H D+V+++++ P    ++ S G +D  V IWDL Q  
Sbjct: 305 DSEGTLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ-- 361

Query: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTS 385
                   DD    L+ +H GH   VND + + + PW+M SV  +N V IWK +  + +
Sbjct: 362 -------EDD---PLVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVN 410

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 92/401 (22%), Positives = 167/401 (41%), Gaps = 51/401 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLPSN----DRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP +T+  +P N     R+  Q L++ T T  + +   ++  + L +
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRK--FEHRDEVTRARYAPFNPN----LIAT 133
            V + VK      ++  ++         I+       RD   R + +PF  +    L AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 134 ISGSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFSVISP-GELL 178
           +S +G+V+++D    S +  T  +   K                GY L++S ++  G LL
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 179 SCSDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           +    G I      + K      P  V  ++N  + + +W      +F S   D  + I 
Sbjct: 292 TGDCSGQIYFTQRHTSKWITDKQPFTV--ANNQSIEDIQWSRTESTVFASAGCDGYIRIW 349

Query: 235 DKRIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PE-----AP 284
           D R  K  P + +  S    N +++S+    L A+   +    ++DLR+  PE      P
Sbjct: 350 DTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQP 409

Query: 285 IHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV----- 338
           +     H  ++TS+ F P  + I+  GS D  V +WDL  +   E+ ++ A +       
Sbjct: 410 VAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 469

Query: 339 -PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
            P+LL +H   +  V D      IP  + S   +  + IWK
Sbjct: 470 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 93/400 (23%), Positives = 163/400 (40%), Gaps = 50/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP LT+  +P    +  R+  Q ++L T T  + +   ++  + L +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + +K      D+  E        I+       RD   R + +PF  +    L AT+S
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIE-NENIPLRDTTNRLKVSPFAVSNQEVLTATMS 232

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G V++YD +  S +  T  +   K                GYGL++S +I  G LLS 
Sbjct: 233 ENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG 292

Query: 181 SDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G I +    + +    K     S+N  + + +W      +F + + D  + I D R 
Sbjct: 293 DCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRS 352

Query: 239 DK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIHSM 288
            K  P + +  S    N +++S     L A+   +    ++DLR+          P+   
Sbjct: 353 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 412

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF---------QIGAEQQQEDADDGVP 339
             H  ++TS+ F P  + I+  GS D  V +WDL          Q  AE ++    D  P
Sbjct: 413 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE--LQDIPP 470

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 471 QLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWKT 507

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 98/408 (24%), Positives = 172/408 (42%), Gaps = 65/408 (15%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLPSN----DRSNEQELILGTHTSGT--EQNYLKIASV-H 76
           P +YD +    + WP LT+  +P N     R+  Q L++ T T  +  ++N L + S+  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 77  LPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEH-----RDEVTRARYAPFNPN-- 129
           L   +V D        DD   S  + + + +     E+     RD   R R +PF  +  
Sbjct: 179 LAKTLVKD--------DDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNK 230

Query: 130 --LIATISGSGKVFLYDRSKDSDSALTAEFSFHKEN--------------GYGLNFS-VI 172
             L AT+S +G+V+++D    S +  +  +   K +              GY L++S +I
Sbjct: 231 EVLTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLI 290

Query: 173 SPGELLSCSDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
             G LL+    G I +    + K      P  V   +N  V + +W      +F S   D
Sbjct: 291 KTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTV--GNNKSVEDIQWSRTEATVFASCGCD 348

Query: 229 STLIIHDKRID--KPVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PE- 282
             + I D R    KP + +  S    N +++++    L A+   +    ++DLR+  P+ 
Sbjct: 349 GYVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDN 408

Query: 283 ----APIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDG 337
                P+     H  ++TS+ F P ++ I+   S D  V +WDL  +   E+ ++ A + 
Sbjct: 409 INNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAET 468

Query: 338 V------PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
                  P+LL +H   +  V D      IP  + S   +  + IWK 
Sbjct: 469 KELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKT 513

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/404 (23%), Positives = 167/404 (41%), Gaps = 57/404 (14%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLPSN---DRSNEQELIL---GTHTSGTEQNYLKIASV-H 76
           P +Y+ +    L WP LT+  +P N   +R N  + IL    T  S  + N L +  + H
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 77  LPDEVVSDVKCSAPSTDDSKES-GHQPQSKIKIVRKFEHRDEVTRARYAPF----NPNLI 131
           L   +V D        DD  +    +P   I        RD   R R +P+       L 
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEP---ILENESLPLRDTTNRLRISPYATVQQEILT 235

Query: 132 ATISGSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGE 176
           +T+S +G+VF+YD +  + +  T  +   K                GYGL++S +I  G 
Sbjct: 236 STMSENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGA 295

Query: 177 LLSCSDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
           LL+    G + +    + K     TP  V   +N  + + +W      +F +   D  + 
Sbjct: 296 LLTGDCSGMVYLTQRHTSKWVTDKTPFTV--GNNKSIEDIQWSRTESTVFATAGCDGYIR 353

Query: 233 IHDKRIDK--PVVK-ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK------PEA 283
           I D R  K  PV+  ++ +   N +++++    L A+        ++DLR+         
Sbjct: 354 IWDTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKAL 413

Query: 284 PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQ--------EDAD 335
           P+     H  ++TS+ F P  + I+   S D  V +WDL  + A+ ++        ++ +
Sbjct: 414 PVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDL-SVEADDEEIKQQKAEIKELE 472

Query: 336 DGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
              P+LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 473 QIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 513

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 171/399 (42%), Gaps = 50/399 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP L++  +P    S  R+  Q +++ T T  +++   ++  + L +
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + +K      ++  +   +P   I        RD   R + +PF       L AT+S
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEP---IIENENIALRDTTNRIKVSPFASQSQEVLTATMS 235

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKEN--------------GYGLNFS-VISPGELLSC 180
            +G+V+++D    +    +  +   K++              GYGL++S +I  G LLS 
Sbjct: 236 ENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSG 295

Query: 181 SDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G I +    + K    K      +N  + + +W +    +F +   D  + + D R 
Sbjct: 296 DCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRS 355

Query: 239 DK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PE-----APIHSM 288
            K  P + +  S    N +++++    L A+   +    ++DLR+  P+      P+   
Sbjct: 356 KKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQY 415

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAE-----QQQEDADDGV---PE 340
           + H  ++TS+ F P ++ I+  GS D  V +WDL  + A+     QQ E+  +     P+
Sbjct: 416 NFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDL-SVEADDEEIKQQTEETKELKEIPPQ 474

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           LL +H   +  + D      IP  + S   +  + IWK 
Sbjct: 475 LLFVH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWKT 510

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/400 (22%), Positives = 163/400 (40%), Gaps = 51/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP LT+  +P    S  R+  Q ++L T T  + +   ++  + L +
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + +K      D+ ++                 RD   R + +PF  +    L AT+S
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIEN--ENIPLRDTTNRLKVSPFAVSNQEVLTATMS 231

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G V++YD +  S +  T  +   K                GYGL++S +I  G LLS 
Sbjct: 232 ENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSG 291

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G +      + +      P  V  S+N  + + +W      +F +   D  + I D 
Sbjct: 292 DCSGQVYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRSESTVFATAGCDGYIRIWDT 349

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIH 286
           R  K  P + +  S    N +++S     L A+   +    ++DLR+          P+ 
Sbjct: 350 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQPVA 409

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ--QEDAD-----DGVP 339
               H  ++TS+ F P  + I+  GS D  V +WDL     +++  Q+ A+     +  P
Sbjct: 410 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPP 469

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 470 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 506

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 164/400 (41%), Gaps = 50/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP LT+  +P    S  R+  Q ++L T T  + +   ++  + L +
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + +K      DD ++        I+       RD   R + +PF  +    L AT+S
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIE-NENIPLRDTTNRLKVSPFAISNQEVLTATMS 233

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G V++Y+ +  S +  T  +   K                GYGL++S +I  G LLS 
Sbjct: 234 ENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG 293

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G I      + +      P  V  S+N  + + +W      +F +   D  + I D 
Sbjct: 294 DCSGQIYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDT 351

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIH 286
           R  K  P + +  S    N +++S     L A+   +    ++DLR+          P+ 
Sbjct: 352 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVA 411

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------P 339
               H  ++TS+ F P  + I+  GS D  V +WDL  +   E+ ++ A +        P
Sbjct: 412 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPP 471

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 472 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 508

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 90/400 (22%), Positives = 161/400 (40%), Gaps = 51/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP LT+  +P    S  R+  Q ++L T T  + +   ++  + L +
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + +K          E        +        +D   R + +PF  +    L AT+S
Sbjct: 174 LTKTLLKDDNEED--DDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMS 231

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G V++YD +  S +  T  +   K                GYGL++S +I  G LLS 
Sbjct: 232 ENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSG 291

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G I      + +      P  V  S+N  + + +W      +F +   D  + I D 
Sbjct: 292 DCSGQIYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDT 349

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIH 286
           R  K  P + +  S    N +++S     L A+   +    ++DLR+          P+ 
Sbjct: 350 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVA 409

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ--QEDAD-----DGVP 339
               H  ++TS+ F P  + I+  GS D  V +WDL     +++  Q+ A+     +  P
Sbjct: 410 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPP 469

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 470 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 506

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 87/397 (21%), Positives = 165/397 (41%), Gaps = 44/397 (11%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP LT+  +P    +  R+  Q +++ T T  +++   ++  + L  
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN---LIATISG 136
              + VK  A   +D ++        I    +   RD   R + +PF  +   L AT+S 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 137 SGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSCS 181
           +G+V+++D    + +  T  +   K                GYGL++S +I  G LL+  
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 182 DDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
             G + +    + K    K     S+N  + + +W      +F +   D  + I D R  
Sbjct: 298 CSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRSK 357

Query: 240 K--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE-------APIHSMS 289
           K  P +    S    N +++++    L A+   D +  ++DLR+          P+    
Sbjct: 358 KHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVAQYD 417

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------PELL 342
            H  ++TS+ F P  + I+   S D  V +WDL  +   E+ ++ A +        P+LL
Sbjct: 418 FHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLL 477

Query: 343 MMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
            +H   +  V D      IP  + S   +  + +WK 
Sbjct: 478 FVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKT 511

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 85/397 (21%), Positives = 164/397 (41%), Gaps = 46/397 (11%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP +T+  +P    S  R+  Q L++ T T  +++N  ++  + +  
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPF----NPNLIATIS 135
              + VK      +   E        I+       +D   R + +PF       L +T+S
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIE-NENISLKDTTNRLKVSPFANAAQEVLCSTMS 245

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G+V+++D +    +  T  +   K+               GY  ++S +I  G +LS 
Sbjct: 246 ENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSG 305

Query: 181 SDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G + +    + K    K     ++N  + + +W      +F S   D  + I D R 
Sbjct: 306 DCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRS 365

Query: 239 DK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PE-----APIHSM 288
            K  P + +  S    N +++S+    L A+   D    ++DLR+  P+     +P+   
Sbjct: 366 KKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQY 425

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------PEL 341
             H  ++TS+ F P  + I+   S D  V +WDL  +   E+ ++ A +        P+L
Sbjct: 426 QFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
           L +H   +  V D      IP  + S   +  + +WK
Sbjct: 486 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 519

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 92/401 (22%), Positives = 158/401 (39%), Gaps = 51/401 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L WP +T+  +P    S  R+  Q +++ T T  +++   ++  + L  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + VK      +D           I      +  D   R + +PF       L AT+S
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G+V+++D +  S +  T  +   K                GY L++S +I  G LL+ 
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 181 SDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G I      + K    K      +N  V + +W      +F S   D  + I D R 
Sbjct: 300 DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRS 359

Query: 239 DK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PE-----APIHSM 288
            K  P + +  S    N +++S+    L A+   +    ++DLR+  P+      P+   
Sbjct: 360 KKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPVAQY 419

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF----------QIGAEQQQEDADDGV 338
             H  ++TS+ F P  D I+   S D  V +WDL           QI   ++ E      
Sbjct: 420 DFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKIP--- 476

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           P+LL +H   +  V D      IP  + S   +  + IWK 
Sbjct: 477 PQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWKT 514

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 93/402 (23%), Positives = 165/402 (41%), Gaps = 51/402 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHT--SGTEQNYLKIASVHL 77
           P +Y+ +    + WP LT+  +P    S  R+  Q L++ T T  S  ++N L + S+  
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 78  PDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIAT 133
             + + +        +D +++    +  +        RD   R + +PF  +    L AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 134 ISGSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELL 178
           +S +G+V+++D    S +  T  +   K                GY L++S  I  G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 179 SCSDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           +    G I      + K      P  V  S+N  + + +W      +F S   D  + I 
Sbjct: 293 TGDCSGQIYFTQRHTSKWVTDKQPFTV--SNNKSIEDIQWSRTEGTVFASAGCDGYIRIW 350

Query: 235 DKRIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--PEA-----P 284
           D R  K  P + +  S    N +++S     L A+   +    ++DLR+  P+      P
Sbjct: 351 DTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFSPDTANSVQP 410

Query: 285 IHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV----- 338
           +     H  ++TS+ F P  + I+   S D  V +WDL  +   E+ ++ A +       
Sbjct: 411 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 470

Query: 339 -PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
            P+LL +H   +  V D      IP  + S   +  + IWK 
Sbjct: 471 PPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWKT 509

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 163/399 (40%), Gaps = 48/399 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLPSN----DRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L WP +T+  +P N     R+  Q +++ T T  +++   ++  + L  
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              +  K      +D ++   +    I      + RD   R + +PF       L AT+S
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G+  ++D      +  +  +   K                GYGL++S +I  G LL+ 
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G + +    S K      P  VD  +N  + + KW      +F +   D  + I D 
Sbjct: 305 DCSGRVFLTQRTSSKWITDKQPFTVD--NNKSIEDIKWSPSENTVFATCGVDGHVRIWDI 362

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK------PEAPIHS 287
           R  K  P + +  S+   N +++++  S L A    +    ++DLR+        +P+  
Sbjct: 363 RSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVAQ 422

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------PE 340
              H  ++TS+ F P  + I+   S D  V +WDL  +   E+ ++ A +        P+
Sbjct: 423 YDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPPQ 482

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 483 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 518

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/403 (21%), Positives = 165/403 (40%), Gaps = 56/403 (13%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQ--NYLKIASVHL 77
           P +Y+ +    + WP +T+  +P    S  R+  Q +++ T T  +++  N L +  +  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 78  PDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN------LI 131
             + ++         ++  +    P   I      + RD   R + +PF  +      L 
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDP---IIENENIQLRDTTNRLKVSPFASSSNSQEILT 238

Query: 132 ATISGSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGE 176
           AT+S +G+V+++D +    +  T  +   K                GY L++S +I  G 
Sbjct: 239 ATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGA 298

Query: 177 LLSCSDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
           LL+    G + +    + K      P  V  ++N  V + +W      +F S   D  + 
Sbjct: 299 LLTGDCSGQVYLTQRHTSKWISDKEPFTV--ANNQSVEDIQWSRTESTVFASCGCDGYIR 356

Query: 233 IHDKRIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PE 282
           + D R  K  P + +  S    N +++S+    L A+   +    ++DLR+         
Sbjct: 357 VWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNNT 416

Query: 283 APIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV--- 338
           +P+     H  ++TS+ F P  + I+   S D  V +WDL  +   E+ ++ A +     
Sbjct: 417 SPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQ 476

Query: 339 ---PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
              P+LL +H   +  V D      IP  + S   +  + IWK
Sbjct: 477 QIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 162/400 (40%), Gaps = 48/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    + WP +T+  +P    S  RS  Q L+L T T  T +   ++  + L  
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRK-FEHRDEVTRARYAPFNPN----LIATI 134
              + VK      D+  E      S   I  +    +D   R + +PF  +    L AT+
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 135 SGSGKVFLYDRSKDSDSALTAEFSFHKEN--------------GYGLNFS-VISPGELLS 179
             +G+V+++D    + +  T  +   K +              GYGL++S +I  G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 180 CSDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
               G I +    + K    K     ++N  V + +W      +F +   D  + I D R
Sbjct: 298 GDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTR 357

Query: 238 IDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIHS 287
             K  P +    S    N +++++    L A+   +    ++DLR+          P+  
Sbjct: 358 SKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVAQ 417

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAE----QQQ----EDADDGVP 339
              H   +TS+ F P  D ++   S D  V +WDL  + A+    QQQ    ++     P
Sbjct: 418 YDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDL-SVEADDDEIQQQTKEYKELQKIPP 476

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 477 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKT 513

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/400 (20%), Positives = 163/400 (40%), Gaps = 49/400 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L W  +T+  +P    S  R+  Q +++ T T  +++   ++  + +  
Sbjct: 125 PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSILMTTATQASKKKDNELLVLKMSQ 184

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + VK      D+ +++       I        +D   R + +PF       L AT+S
Sbjct: 185 LTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLKDTTNRIKISPFAAESPEVLAATMS 244

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G+ ++YD      +  +  +   K                GYGL++S +I  G +L+ 
Sbjct: 245 ENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGYGLDWSPLIKTGSILTG 304

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G + +    + +      P  V   +N  + + +W      +F +   D  + I D 
Sbjct: 305 DCSGRVYLTQRTASRWVTDKQPFTV--GNNKSIEDIQWSRAEMTVFATCGVDGHIRIWDT 362

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEA-------PIH 286
           R  K  P + ++ S+   N +++++    L A+        ++DLR+  A       P+ 
Sbjct: 363 RSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWGVWDLRQFSAQNTEKTTPVA 422

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ--QEDADDGV-----P 339
             + H  ++TS+ F P  + I+   S D  V +WDL     +++  Q+ A+        P
Sbjct: 423 QYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQTAETAELQQIPP 482

Query: 340 ELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           +LL +H   +  V D      IP  + S   +  + IWK 
Sbjct: 483 QLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWKT 519

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 88/399 (22%), Positives = 163/399 (40%), Gaps = 49/399 (12%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L WP +T+  +P    S  R+  Q +++ T T   ++   ++  + L  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN----LIATIS 135
              + VK +    +D   S ++    I        +D   R R +PF  +    L AT+S
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNE-SDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMS 238

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFS-VISPGELLSC 180
            +G+V+++D +  S +  T  +   K                GY L++S +I  G LL+ 
Sbjct: 239 ENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTG 298

Query: 181 SDDGSIAIWDVCSGK----NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
              G +      + K      P  V  S+N  + + +W      +F +   D  + + D 
Sbjct: 299 DCSGQVYFTQRHTSKWVTDKQPFTV--SNNKSIEDIQWSRTEATVFATAGCDGYIRVWDT 356

Query: 237 RIDK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK------PEAPIHS 287
           R  K  P +    S    N +++++    L A+   +    ++DLR+         P+  
Sbjct: 357 RSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQ 416

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ--QEDADDGV-----PE 340
              H  ++TS+ F P  + I+   S D  V +WDL     +++  Q+ A+        P+
Sbjct: 417 YDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQ 476

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           LL +H   +  V D      IP  + S   +  + IWK 
Sbjct: 477 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWKT 512

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 13/163 (7%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L+S S D +  +WD+ S      ++  +H++ V + ++  +S  LF S   D ++ + D 
Sbjct: 248 LISSSIDTTCIVWDLQSSNYVKTQL-IAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDL 306

Query: 237 R-------IDKPVVKILQSEPYN----TLAFSKHSSNLFAAAGTDS-QVQLYDLRKPEAP 284
           R       I +P V  L  +        L  S H  N+ A    DS ++ + D+R PE+P
Sbjct: 307 RSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESP 366

Query: 285 IHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGA 327
           +  + GH  SV  +++ P K  +L SG  D +VL WDL +  A
Sbjct: 367 LMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTA 409

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 84/397 (21%), Positives = 159/397 (40%), Gaps = 46/397 (11%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L WP L++  +P    S  R+  Q L+L T T  +++   ++  + +  
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNP----NLIATIS 135
              + VK      ++  +     Q  I        RD   R + +PF       L A++S
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDED-QDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMS 245

Query: 136 GSGKVFLYDRSKDSDSALTAEFSFHKE--------------NGYGLNFSVISP-GELLSC 180
            +G+V+++D         T  +   K                GY L++S ++  G LL+ 
Sbjct: 246 ENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTG 305

Query: 181 SDDGSIAIWDVCSGK--NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G + +    + K           +N  + + ++      +F +   D  + I D R 
Sbjct: 306 DCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRS 365

Query: 239 DK--PVVKI-LQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIHSM 288
            K  P + +   S   N +++++    L A+   +    ++DLR+         +P+   
Sbjct: 366 KKHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQY 425

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------PEL 341
           S H  ++TS+ F P  D I+   S D  V +WDL  +   E+ ++ A +        P+L
Sbjct: 426 SFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 485

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
           L +H   +  V D      IP  + S   +  + IWK
Sbjct: 486 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 135/323 (41%), Gaps = 53/323 (16%)

Query: 25  LMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDEVVSD 84
           L +D V+E  +++P   IQWLPS         +       T  + L+I S++  D  +++
Sbjct: 142 LSWDKVAEHNIIYPVSNIQWLPS---------VQQPRKFATSSDSLRIWSLNEEDSSLTE 192

Query: 85  -VKCSAPSTDDSKES-GHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFL 142
            V  S    +D   S      S   I+ +F     VT   + P + NL+ + S      +
Sbjct: 193 QVNLSLCKYNDQHHSLSKNTTSSSDILGQFP---PVTSFHWNPIDTNLLISSSIDTTCIV 249

Query: 143 YDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCS-GKNTPVKV 201
           +D    S + +  +   H    + + F   S     SC  DGS+ ++D+ S   +T +  
Sbjct: 250 WDL--QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYE 307

Query: 202 DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSS 261
             S  N  +    +EKSP                         +L+ +P      S    
Sbjct: 308 SNSDQNGSDTLTDNEKSP-----------------------SALLRLQP------SPSDP 338

Query: 262 NLFAAAGTDSQ-VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIW 320
           N+ A    DS+ + + D+R P +P+ ++ GH  +V  +++ P K  +L S   D +VL W
Sbjct: 339 NVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYW 398

Query: 321 DLFQ------IGAEQQQEDADDG 337
           DL +      + A + + +A+DG
Sbjct: 399 DLNEWLSPTSLSANENKVNANDG 421

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/399 (21%), Positives = 163/399 (40%), Gaps = 49/399 (12%)

Query: 26  MYDFVSETKLLWPSLTIQWLP---SNDRSN-EQELILGTHTSGTEQNYLKIASVHLPDEV 81
           +Y+ +    L WP +++  +P    N+R N  Q ++L T T  +++   ++  + L    
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 82  VSDVKCSAPSTDDSKESGHQPQSKIKIVR--KFEHRDEVTRARYAPFNPN-----LIATI 134
            + +K      DD  +   + +    I+       RD   R +  PF  N     L AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 135 SGSGKVFLYD--------------RSKDSDSALTAEFSFHKENGYGLNFS-VISPGELLS 179
           S +G+V+++D               SK S   +    S     G+GL++S +I  G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 180 CSDDGSIAIWDVCSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
               G I +    + K    K      +N  + + +W +    +F +   D  + I D R
Sbjct: 309 GDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTR 368

Query: 238 IDK--PVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK------PEAPIHSM 288
             K  P +    S    N +++++    L A+        ++DLR+        +P+   
Sbjct: 369 SKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWGVWDLRQFSPSQENASPVAQY 428

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQ--------EDADDGVPE 340
             H  ++TS+ F P  +  +   S D  V +WDL  + A+ ++        ++ +   P+
Sbjct: 429 DFHKGAITSISFNPLDESTVAVASEDNTVTLWDL-SVEADDEEIKQQTHETKELEQIPPQ 487

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           LL +H   +  V D      IP  + S   +  + +WK 
Sbjct: 488 LLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWKT 523

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/397 (21%), Positives = 160/397 (40%), Gaps = 46/397 (11%)

Query: 24  PLMYDFVSETKLLWPSLTIQWLP----SNDRSNEQELILGTHTSGTEQNYLKIASVHLPD 79
           P +Y+ +    L WP L++  +P    S  R+  Q L+L T T  +++   ++  + +  
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNP----NLIATIS 135
              + VK      +D  +     Q  I        +D   R + +PF       L AT+S
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDED-QDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMS 244

Query: 136 GSGKVFLYDRS--------------KDSDSALTAEFSFHKENGYGLNFSVISP-GELLSC 180
            +G+V+++D                K +   +    S     GY L++S ++  G LL+ 
Sbjct: 245 ENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTG 304

Query: 181 SDDGSIAIWDVCSGK--NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
              G + +    + K           +N  + + ++      +F S   D  + I D R 
Sbjct: 305 DCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRS 364

Query: 239 DK--PVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRK-------PEAPIHSM 288
            K  P + +  S    N +++++    L A+   +    ++DLR+         +P+   
Sbjct: 365 KKHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQY 424

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL-FQIGAEQQQEDADDGV------PEL 341
           + H  ++TS+ F P  D I+   S D  V +WDL  +   E+ ++ A +        P+L
Sbjct: 425 NFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEIPPQL 484

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
           L +H   +  V D      IP  + S   +  + IWK
Sbjct: 485 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 127 NPNLIATISGSGKVFLYDRSKDSDS-ALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS 185
           N  +IA    +G + LY  ++ +D+ + TA+F  H  +   + F+      L S  ++G 
Sbjct: 73  NNEIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGE 132

Query: 186 IAIWDV--CS---GKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           I IWD+  C+      TP+    S +++  VN   W++    +F S    +   I D + 
Sbjct: 133 IFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 239 DKPVVKILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHSM 288
            K V+ +  + P + +           K+S+ +  A G+D+   + ++DLR    P+ ++
Sbjct: 193 KKEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQTL 252

Query: 289 S-GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           + GH   + SL++    + +L S   D  VL+W+
Sbjct: 253 NQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 96/223 (43%), Gaps = 15/223 (6%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H E    ++FS  S  + ++CSDD  + IW+  +G+    +V + H+  V  C WH K  
Sbjct: 162 HTECMRDISFSY-SDQKFVTCSDDNVLKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMG 218

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL 278
            +  S S D+ + + D R  + V  IL          F     NL A    D  +++YD+
Sbjct: 219 LIV-SGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDM 277

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
           R+    + ++    D + SL + P  + I   G  +  +  +DL          D  +  
Sbjct: 278 RQHMRELQTIRDDMDYM-SLSWHPINETIFSVGCYNGAIKHFDLLH--------DNSNST 328

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASK 381
           P    +   H+  V   + SP +  ++AS  ++  ++ W  S+
Sbjct: 329 PACHTIPYAHEKSVTSLAYSP-VGHILASAAKDRTIRFWARSR 370

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 101/214 (47%), Gaps = 19/214 (8%)

Query: 127 NPNLIATISGSGKVFLYDRSKDSDS-ALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS 185
           N  +IA    +G + LY  ++ +D+ +  A+FS H  +   + F+      L S  ++G 
Sbjct: 73  NNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 186 IAIWDV--CS---GKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           I IWD+  C+      TP+    S +++  VN   W++    +F S    +   I D + 
Sbjct: 133 IFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKA 192

Query: 239 DKPVVKILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHSM 288
            K V+ +  + P + +           K+S+ +  A G+D+   + ++DLR    P+ ++
Sbjct: 193 KKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTL 252

Query: 289 S-GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           + GH   + SL++    + +L S   D  VL+W+
Sbjct: 253 NQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 67/150 (44%), Gaps = 11/150 (7%)

Query: 239 DKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSM---SGHHDSV 295
           +KP+  +     +N L +S H++ + A A  +  ++LY   +    I SM   S H  SV
Sbjct: 53  EKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSV 111

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDF 355
            +++F   +D +L SG ++  + IWD+ +       E   +  P            VN  
Sbjct: 112 KTVKFNAKQDNVLASGGNNGEIFIWDMNKC-----TESPANYTPLTPGQSMSSVDEVNSL 166

Query: 356 SCSPNIPWLMASVEEENVVQIW--KASKKL 383
           + + ++  + AS    N   IW  KA K++
Sbjct: 167 AWNQSLAHVFASAGSSNFASIWDLKAKKEV 196

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 99/211 (46%), Gaps = 22/211 (10%)

Query: 133 TISGS---GKVFLYDRSKDSDSAL-TAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           TI+G+   G + LY      D+ + TA+FS H  +   + F+      L S  ++G I I
Sbjct: 76  TIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFI 135

Query: 189 WDV--CS---GKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKP 241
           WD+  C+      TP+    S +++  VN   W++    +F S    +   I D +  K 
Sbjct: 136 WDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE 195

Query: 242 VVKILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHSMS-G 290
           V+ +  + P + +           K+S+ +  A G+D+   + ++DLR    P+ ++S G
Sbjct: 196 VIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQG 255

Query: 291 HHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           H   + SL++    + +L S   D  VL+W+
Sbjct: 256 HQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 11/150 (7%)

Query: 239 DKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHS---MSGHHDSV 295
           +KP+  +     +N L +S H++   A A  +  ++LY +      I S    S H  SV
Sbjct: 53  EKPMASLQVDSKFNDLDWS-HNNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSV 111

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDF 355
            +++F   +D +L SG ++  + IWD+ +       E      P            VN  
Sbjct: 112 KTVKFNSKQDNVLASGGNNGEIFIWDMNKC-----TESPSSYTPLTPGQSMSSVDEVNSL 166

Query: 356 SCSPNIPWLMASVEEENVVQIW--KASKKL 383
           + + ++  + AS    N   IW  KA K++
Sbjct: 167 AWNQSLAHVFASAGSSNFASIWDLKAKKEV 196

>Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADR108C
          Length = 311

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 74/168 (44%), Gaps = 15/168 (8%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNE----CKWHEKSPFLFGSVSDDSTL 231
           +LL+   +G + I+DV +G+    +    H  +VNE    C+ H     LFGSVSDD TL
Sbjct: 68  QLLAGCANGKVCIYDVETGRKMR-QWGGGHKRVVNEIVGLCEEH-----LFGSVSDDGTL 121

Query: 232 IIHDKRIDKPVVKILQSEPYNTLAFSKHS-----SNLFAAAGTDSQVQLYDLRKPEAPIH 286
              D R+ KPV +++   P  TLA  +       S     +G +  V+ YDLRK    I 
Sbjct: 122 CWWDSRVRKPVGRVVGEFPLLTLALGRRGDGDERSPFLYTSGVEPVVRCYDLRKNTDLIA 181

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDA 334
                H +  S          +CS   D  +   D+   G  + ++D 
Sbjct: 182 ECETTHATGVSSLCVSSNGSRVCSLGFDDNLQFHDIDASGKLKNRQDG 229

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 134/333 (40%), Gaps = 65/333 (19%)

Query: 21  SNVPLMYDFVSETKLLWPSLTIQWLPS-------------------NDRSNEQELILGTH 61
           SN  L ++ V+E  + +P   IQWLPS                   +D S +   +   +
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRKLATSSECLRIWSLDDNSMDNSSVFNNN 249

Query: 62  TSG-----------TEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVR 110
            S            TEQ  L +   +   +++++   S  +  +++  G  P        
Sbjct: 250 ISNNSRHNTYKKSLTEQVNLSLCKYNEQHQIINNSTNSVSNKSNARLLGQLP-------- 301

Query: 111 KFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFS 170
                  VT   +   + NL+ + S      ++D    S + +  +   H    + + F 
Sbjct: 302 ------PVTSFHWNSIDTNLLISSSIDTTCIVWDLQ--SSNYVKTQLIAHDSEVFDVKFL 353

Query: 171 VISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDST 230
           + S     SC  DGSI ++D+ + +++ +  +T+++   N             + ++D T
Sbjct: 354 IQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNN------------TFNNDVT 401

Query: 231 LIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQ-VQLYDLRKPEAPIHSMS 289
             I +   +     +L+ EP      S    NL A  G D + + + D+R P  P+  +S
Sbjct: 402 TKIDNSSANSLSHALLRLEP------SPTDPNLIATFGLDKKAILILDMRNPGVPVLVLS 455

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           GH  SV  +++ P K  +L S   D +VL WDL
Sbjct: 456 GHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 27/151 (17%)

Query: 172 ISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTL 231
           + P  L+S S D +I  WD+CSGK     +D S  N++      + S          STL
Sbjct: 504 LDPNFLVSGSQDRTIRQWDLCSGKCMQT-IDLSFANVLTTATNVDLSK---------STL 553

Query: 232 IIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH 291
           +   +R ++P +  LQS       F        A    D  V+L+DLR  +  I ++ GH
Sbjct: 554 LT--QRSERPTIGALQS-------FDAA----LATGTKDGIVRLWDLRSGKV-IRTLEGH 599

Query: 292 HDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
            D++TSL+F       L +GS DR V +WDL
Sbjct: 600 TDAITSLKF---DSACLVTGSYDRTVRVWDL 627

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 79/148 (53%), Gaps = 9/148 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVD-TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
            ++ S+D ++ +WD+ SGK   +KV  T H   V +    ++ P+LF SVS+D T+   D
Sbjct: 155 FVTGSNDTTMKVWDLASGK---LKVTLTGHVMTVRDIAVSDRHPYLF-SVSEDKTVKCWD 210

Query: 236 KRIDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
              ++ +++            S H + +L A AG DS V+L+D+R    P+ ++ GH   
Sbjct: 211 LEKNQ-IIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIR-TRVPVITLVGHKGP 268

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           +  +E AP  D  + S S+D  V +WD+
Sbjct: 269 INQVECAP-VDPQIVSSSTDATVRLWDI 295

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 67/161 (41%), Gaps = 30/161 (18%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++S S D ++ +WD+ +GK   +KV T H   V     H     +  + +DD   I   
Sbjct: 280 QIVSSSTDATVRLWDIVAGK--AMKVLTHHKRSVRAIALHPNEFSMASACTDD---IRSW 334

Query: 236 KRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH-HD 293
              D  ++   +SE    +   S +  ++  A G D  +  YD +         SGH + 
Sbjct: 335 GLADGSLLTNFESEKTGIINTLSINQDDVLFAGGDDGMLSFYDYK---------SGHKYQ 385

Query: 294 SVTSLEFA---PHKDGILCS-----------GSSDRRVLIW 320
           S+ + E       + G+LCS           G +D+ + IW
Sbjct: 386 SLATREMIGSLESERGVLCSTFDKTGLRLITGETDKSIKIW 426

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 42/106 (39%), Gaps = 19/106 (17%)

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAG 347
           ++GH   V      P  +    +GS+D  + +WDL                 +L +   G
Sbjct: 135 INGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDL--------------ASGKLKVTLTG 180

Query: 348 HKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
           H   V D + S   P+L  SV E+  V+ W   K      I RDY+
Sbjct: 181 HVMTVRDIAVSDRHPYLF-SVSEDKTVKCWDLEKN----QIIRDYH 221

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 90/175 (51%), Gaps = 28/175 (16%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKI--LQSEPYNTLAFSKHSSNLFAA----AGTDSQVQL 275
           F + S+DS  I  D R+++ V  +   ++ P+ +L  S+H   + A     +GTD+++ L
Sbjct: 74  FVTASEDSVKIF-DLRLNQCVATVQNAKNSPFISLD-SRHG--MLACGTELSGTDAEIHL 129

Query: 276 YDLRKPEAPIHSMS-GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDA 334
           YDL+K +AP+ S    HHD +T ++F      +L SGS+D  V ++DL Q    Q++E+A
Sbjct: 130 YDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ----QEEEEA 185

Query: 335 DDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKLTSP 386
              V     +H          SC   SP   W ++ +E  ++ ++   S +L  P
Sbjct: 186 LHQVINFASIH----------SCGWLSPKRIWALSHMETFSIHELNDKSDELVEP 230

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 81/194 (41%), Gaps = 24/194 (12%)

Query: 129 NLIATISGSGKVFLYD--RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186
           N +A  + S  V L+D  R+  +DSAL +  + H  +    +F+++    L+S   DG +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 187 AIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKIL 246
            IWD+ +  N P K       IVN C     +   FGS+ D   +  ++           
Sbjct: 265 KIWDIRT--NNPTK-------IVNTCDVRINT--TFGSIRDIKWMPGYN----------F 303

Query: 247 QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG 306
                N      H    FA+      +  +D+R+P  P   ++ H      L + PH+D 
Sbjct: 304 SGNDRNYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQDY 363

Query: 307 ILCSGSSDRRVLIW 320
           I  SG  D +  +W
Sbjct: 364 I-ASGGRDGKCCLW 376

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 124/298 (41%), Gaps = 43/298 (14%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYDRSKDSDSALTAEFSFHKENG-YGLNFSVI 172
            +Y+PF  N +A  +G+       GKV+L +   DS   +    SF  ++  + + ++ +
Sbjct: 14  VQYSPFFDNKLAVATGANFGLVGNGKVYLLE--IDSKGQIHETNSFLTQDCLFDVAWNEL 71

Query: 173 SPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
              ++L    DGS+ ++D  + K+ P+++   H   V  C W+  +   F S S D T+ 
Sbjct: 72  HENQVLVAQGDGSLRLFDT-TLKDYPIEIFNEHEREVFSCSWNLITKNTFTSSSWDGTVK 130

Query: 233 IHD------------------KRIDKPVVKILQSEPYNTLA----------FSKHSSNLF 264
           I                    K  D+  + I   + +  ++          FS H  NL 
Sbjct: 131 IWSPLRKASLLTLVPHPLKVMKNFDQVDIPISNQKAHTAISKNKNCIYQAQFSPHDPNLV 190

Query: 265 AAAGTDSQVQLYDLRKPEAPIHSMSGH-HDSVTSL--EFAPHKDGILCSGSSDRRVLIWD 321
                +S   L+DLR+P    +  +   H  + +L  +F  ++  I+ +G  D  + IWD
Sbjct: 191 ICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLEALTCDFNKYRPNIVATGGVDNTIRIWD 250

Query: 322 LFQIGAE-QQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
           L  +  + Q     D+ +  +  +  GH+  V   S SP+    + S   +    +W+
Sbjct: 251 LRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKVSWSPHSSTTLLSTSYDMTCCVWQ 308

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 113 EHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKE-NGYGLNFSV 171
           ++++ + +A+++P +PNL+   +G+    L+D  + S S     F  H        +F+ 
Sbjct: 172 KNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLEALTCDFNK 231

Query: 172 ISPGELLSCSDDGSIAIWDV 191
             P  + +   D +I IWD+
Sbjct: 232 YRPNIVATGGVDNTIRIWDL 251

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 27/166 (16%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L+S S D +  IWD+ S      ++  +H++ V + ++  +S  LF S   D ++ + D 
Sbjct: 264 LISSSIDTTCIIWDLESSNYVKTQL-IAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDL 322

Query: 237 R-------IDKPVVK------------ILQSEPYNTLAFSKHSSNLFAAAGTDS-QVQLY 276
           R       I +P  +            +L+ EP      S H  N+ A    DS ++ + 
Sbjct: 323 RSLAHSTIIYEPPAQMDPSSSAAASNALLRLEP------SPHDPNIVATFAADSNKIIIL 376

Query: 277 DLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           D+R PE P+ ++ GH  S+  +++ P +  IL S + D +VL WDL
Sbjct: 377 DMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 43/96 (44%), Gaps = 3/96 (3%)

Query: 100 HQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISG-SGKVFLYDRSKDSDSALTAEFS 158
           ++P +++         + + R   +P +PN++AT +  S K+ + D        LT +  
Sbjct: 332 YEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQG- 390

Query: 159 FHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSG 194
            H  +   + +       LLSC+DD  +  WD+ S 
Sbjct: 391 -HSSSLNQIKWHPTERNILLSCADDCQVLYWDLNSS 425

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 100/200 (50%), Gaps = 13/200 (6%)

Query: 129 NLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAI 188
           +L+A  S SG + L D S    S +    S       GL++SV S   +  C+ DG I I
Sbjct: 192 DLMACGSWSGNLSLVDNSL---SKIYCNRSLSGTKISGLDWSVDSK-NIFVCTHDGRIVI 247

Query: 189 WDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQS 248
           +D  SG  T VK+   ++    + + H  + F+ GS S D T I+ D     P++ I + 
Sbjct: 248 YD--SGDETTVKILYKNDARFAQVRCHPCNSFI-GSTSFDKTWILIDTVKQAPIL-IQEG 303

Query: 249 EPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGI 307
                 + S H+  +L + AG D+   ++D+R  +  I S+ GH   + S++++  ++G 
Sbjct: 304 HSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGK-NIMSLQGHSKPIYSVDWS--QNGY 360

Query: 308 -LCSGSSDRRVLIWDLFQIG 326
            L SGS D  + +WD+ + G
Sbjct: 361 QLASGSGDGTIKVWDIRKKG 380

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 68/171 (39%), Gaps = 22/171 (12%)

Query: 214 WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGT-DSQ 272
           W   S  +F   + D  ++I+D   D+  VKIL            H  N F  + + D  
Sbjct: 229 WSVDSKNIF-VCTHDGRIVIYDSG-DETTVKILYKNDARFAQVRCHPCNSFIGSTSFDKT 286

Query: 273 VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS-DRRVLIWDLFQIGAEQQQ 331
             L D  K +API    GH   V SL F  H DG L S +  D   LIWD+         
Sbjct: 287 WILIDTVK-QAPILIQEGHSAEVFSLSF--HNDGSLVSTAGLDAIALIWDIRS------- 336

Query: 332 EDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKK 382
                   + +M   GH  P+     S N  + +AS   +  +++W   KK
Sbjct: 337 -------GKNIMSLQGHSKPIYSVDWSQN-GYQLASGSGDGTIKVWDIRKK 379

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 105/263 (39%), Gaps = 46/263 (17%)

Query: 102 PQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           P+ ++   R +  +D +    ++  N N      G G + L+D + D      A +  H+
Sbjct: 47  PEGQMVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDKYPV--AVYQEHR 104

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVC-----------SGKNTPV------KVDTS 204
           +     N+S+I     +S   DG + +W V            +  NT V         T+
Sbjct: 105 DEVASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTN 164

Query: 205 HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKP----VVKILQSEPYNTLA--FSK 258
             + V + K+      L    S DST+ + D R  +P      + +      TL+  F+K
Sbjct: 165 GKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNK 224

Query: 259 HSSNLFAAAGTDSQVQLYDLRK------------PEAPIHS---------MSGHHDSVTS 297
           + +N+ A  G D++++++DLR             PE P  +         + GH  +V  
Sbjct: 225 YRTNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRK 284

Query: 298 LEFAPHKDGILCSGSSDRRVLIW 320
           + ++PH    L S S D    IW
Sbjct: 285 VNWSPHSSNYLLSTSYDMTCCIW 307

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 98/263 (37%), Gaps = 38/263 (14%)

Query: 156 EFSFHKENGYGLNFS-------VISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNI 208
            F     +GY + +S        ++ G       +G + I D+        + D    + 
Sbjct: 3   RFEMRGFSGYAVQYSPFLDSRLAVATGTNYGLIGNGKLWILDISPEGQMVTRRDYLTQDC 62

Query: 209 VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ--SEPYNTLAFSKHSSNLFAA 266
           + +  W E +         D +L + D  +DK  V + Q   +   +  +S    N F +
Sbjct: 63  LFDLAWSELNENQCLVAQGDGSLRLFDTTLDKYPVAVYQEHRDEVASCNWSLIGRNTFVS 122

Query: 267 AGTDSQVQLYDLRKPEAPIH------------------SMSGHHDSVTSLEFAPHKDGIL 308
           +G D  V+++ + +P + +                     +   D V   +F+PH D ++
Sbjct: 123 SGWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLM 182

Query: 309 CSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFS-CSPNIPWLMAS 367
              S D  V    LF + A Q  +    G     M H+G ++   DF+    N+   +A+
Sbjct: 183 VCCSGDSTV---SLFDLRASQPGQ----GPTHQFMAHSGSETLSVDFNKYRTNV---IAT 232

Query: 368 VEEENVVQIWKASKKLTSPYIPR 390
              +N ++IW      T P   R
Sbjct: 233 GGVDNKIKIWDLRMLRTGPLSIR 255

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/305 (23%), Positives = 128/305 (41%), Gaps = 43/305 (14%)

Query: 21  SNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDE 80
           SN  L ++ V +  +++P   IQW+PS          L      T  + L+I SV  P+E
Sbjct: 160 SNDLLSWESVVDADVVYPVSKIQWVPSQ---------LYPRKLATCSDSLRIWSVS-PEE 209

Query: 81  VVSDVKCSAPSTDDSKESGHQPQSK--IKIVRKFEHRDEVTRARYAPFNPNLIATISGSG 138
                + +      +++    P +   +K++  F     +T   +   + NLI + S   
Sbjct: 210 RQFQEQINLSLCKYNRQHPANPAAADDMKVIGTFP---PITSFDWNTVDTNLIISSSIDT 266

Query: 139 KVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTP 198
              ++D    S   +  +   H    + + F   S     SC  DGS+ ++D+ S     
Sbjct: 267 TCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS----- 319

Query: 199 VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSK 258
                +H+ I+ E      S    G+++  S          K    +L+ EP      S 
Sbjct: 320 ----LAHSTIIYEPPSSSVSGATAGTITPSS----------KGSDALLRLEP------SP 359

Query: 259 HSSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRV 317
           +  N+ A    DS ++ + D+R PE+PI ++ GH  SV  +++ P K  +L S   D +V
Sbjct: 360 YDPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQV 419

Query: 318 LIWDL 322
           L WDL
Sbjct: 420 LYWDL 424

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 116 DEVTRARYAPFNPNLIATISG-SGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISP 174
           D + R   +P++PN++AT +  S K+ + D        L  +   H  +  G+ +     
Sbjct: 350 DALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQG--HGSSVNGIKWHPTKR 407

Query: 175 GELLSCSDDGSIAIWDVCS 193
             LLSC DD  +  WD+ S
Sbjct: 408 NVLLSCGDDCQVLYWDLNS 426

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + +SCSDD  + IW+  +G+    +V + H+  V  C WH K   +  S S D+ +   D
Sbjct: 179 KFVSCSDDNVLKIWNFSNGQQE--RVLSGHHWDVKSCDWHPKMGLIV-SGSKDNLIKFWD 235

Query: 236 KRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            R    V  +L       +  F     NL +    D   ++YD+R+    + S+    D 
Sbjct: 236 PRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDDVDY 295

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVND 354
           +T L++ P  + +   G  D  +  +DL Q   E Q       +P        H+  V  
Sbjct: 296 MT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP------YAHEKCVTS 345

Query: 355 FSCSPNIPWLMASVEEENVVQIWKASKKL 383
            + SP I  +MAS  ++  ++ W  S+ +
Sbjct: 346 LAYSP-IGHIMASASKDRTIRFWTRSRAV 373

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 19/129 (14%)

Query: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D+Q+ +YD+RK + P+ S+   HHD VT+L+F P    +L SGS+D    ++DL    
Sbjct: 127 GVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDL---- 182

Query: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKL 383
               Q+D DD + +++   + H       SC   SPN  + ++ +E   + ++   S++L
Sbjct: 183 ---TQQDEDDALHQVMNYASIH-------SCGWLSPNRIFTLSHMETFAIHELNDKSEEL 232

Query: 384 TSPYIPRDY 392
             P  P D+
Sbjct: 233 KEPQ-PLDF 240

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 124/315 (39%), Gaps = 53/315 (16%)

Query: 25  LMYDFVSETKLLWPSLTIQWLPSNDRSN---------------EQELILGTHTSGTEQNY 69
           L +D V+E  + +P  TIQW PS                    E+E  L       EQ  
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFCEEERNL------QEQIN 203

Query: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129
           L +       +  S V  +A  +   + +  Q Q  I  +        +T   + P +PN
Sbjct: 204 LSLCKYDKQQQGASRVNAAAGGSGSIRTNPQQQQGLIGEL------PPITSFHWNPVDPN 257

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           L+ + S      ++D    S + +  +   H    Y + F   +     SC  DGS+ ++
Sbjct: 258 LLISSSIDTTCIVWD--LQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVF 315

Query: 190 DV-CSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQS 248
           D+ C           +H+ I+ E      SP      +   +    D     P+++ L+ 
Sbjct: 316 DLRC----------LAHSTIIYE---PPSSPATLQPTTAAGSSSAADSDTGVPLLR-LEP 361

Query: 249 EPYNTLAFSKHSSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGI 307
            P++         N+ A    DS +V + D+R P +P+  + GH  +V  + + P K  +
Sbjct: 362 SPFD--------PNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNV 413

Query: 308 LCSGSSDRRVLIWDL 322
           L S + D +VL WDL
Sbjct: 414 LLSCADDCQVLYWDL 428

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 75/352 (21%), Positives = 134/352 (38%), Gaps = 54/352 (15%)

Query: 25  LMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDEVVSD 84
           L +D V+E  + +P  TIQW P+  +           T  T  + L        DE    
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPARAQP---------RTFATCSDSLXXFWSLTEDETAIQ 179

Query: 85  VKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYD 144
            + +      +K+   + +  +           +T   + P +PNL+ + S      ++D
Sbjct: 180 EQINLSLCKHNKQQSEKGKELVGTNGVLGELPPITSFHWNPTDPNLLISSSIDTTCIVWD 239

Query: 145 RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV-CSGKNTPVKVDT 203
               S + +  +   H    + + F   S     SC  DGS+ ++D+ C           
Sbjct: 240 L--QSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRC----------L 287

Query: 204 SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV--KILQSEPYNTLAFSKHSS 261
           +H+ I+ E    + +P L                   P V   +L+ EP      S    
Sbjct: 288 AHSTIIYEPTIPDGAPDL-----------------PSPTVPPALLRLEP------SPFDP 324

Query: 262 NLFAAAGTD-SQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIW 320
           N+ A    D S+V + D+R P +P+ ++  H   +  +++ P +  +L S S D +VL W
Sbjct: 325 NVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYW 384

Query: 321 DL-FQIGAEQQQEDADDGVPELL-----MMHAGHKSPVNDFSCSPNIPWLMA 366
           DL   + +E  ++   D  P+       M +A     VN+    P   W  A
Sbjct: 385 DLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 81/197 (41%), Gaps = 37/197 (18%)

Query: 209 VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKIL---QSEPYNTLAFSKHSSNLFA 265
           +    W+   P L  S S D+T I+ D +    +   L    SE ++ + F   S+ LFA
Sbjct: 213 ITSFHWNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFD-VRFLTQSTQLFA 271

Query: 266 AAGTDSQVQLYDLR----------------KPEAPIHSMSGHHDSVTSLEFAPHKDGILC 309
           + G D  V+++DLR                 P+ P  ++     ++  LE +P    ++ 
Sbjct: 272 SCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVP---PALLRLEPSPFDPNVIA 328

Query: 310 SGSSD-RRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASV 368
           + + D  +VLI D+   G+             LL + A H +P+N     P    ++ S 
Sbjct: 329 TFAIDSSKVLILDMRSPGS------------PLLTLEA-HTAPINQIKWHPTRRNVLLSA 375

Query: 369 EEENVVQIWKASKKLTS 385
            ++  V  W  +  L S
Sbjct: 376 SDDCQVLYWDLNTHLDS 392

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/295 (20%), Positives = 117/295 (39%), Gaps = 44/295 (14%)

Query: 122 RYAPFNPNLIATISGS-------GKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISP 174
           +Y+PF  N +A  SGS       G++F+ D +       +  F   K+  + + ++ +  
Sbjct: 15  QYSPFFDNKLAVASGSNFGLVGNGRLFIMDLTAQGTMVESNSF-LTKDGLFDVAWNELHE 73

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
            ++L+   DGS+ ++D+ + +  P+ +   H   V  C W+      F S S D T+ + 
Sbjct: 74  NQVLAAQGDGSLRLFDI-TLQQYPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVW 132

Query: 235 DKRIDKPVVKILQSEPYNTLA------------------------------FSKHSSNLF 264
                + ++ +L +    ++                               FS H  NL 
Sbjct: 133 TPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLV 192

Query: 265 AAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSL--EFAPHKDGILCSGSSDRRVLIWDL 322
            +   +S V L+DLR+P A        H  + +L  +F  ++  ++ +G  D+ V +WDL
Sbjct: 193 MSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVWDL 252

Query: 323 FQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             +   +Q        P  +    GH   V     SP+   ++ S   +   + W
Sbjct: 253 RMV---RQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAW 304

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 15/169 (8%)

Query: 113 EHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVI 172
           +++D + +A+++P +PNL+ + SG+  V L+D  + + S      +         +F+  
Sbjct: 174 DNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKY 233

Query: 173 SPGELLSCSDDGSIAIWD-------VCSGKNTPVKVD--TSHNNIVNECKWHEKSPFLFG 223
            P  + +   D  + +WD       + + +  PV ++    H+  V +  W      +  
Sbjct: 234 RPHVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILL 293

Query: 224 SVSDDSTLIIHDKRIDKP----VVKILQSEPYN--TLAFSKHSSNLFAA 266
           S S D T        D P      +   S+P    +  FSKHS  +F A
Sbjct: 294 STSYDMTCRAWHDLADGPGGQHSGRTNNSDPQRGCSYVFSKHSEFVFGA 342

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 99/194 (51%), Gaps = 23/194 (11%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECK-----WHEKSPFLFGSVSDDSTL 231
           LL+   +G +   D  +GK+  V+VD + N+ +N+ K     ++E S +   S  +DS  
Sbjct: 29  LLTSLSNGEVHHIDWVTGKS--VRVDQAGNSSINKLKIIDSNFNEGSSYAVAS--NDSVN 84

Query: 232 IIHDKRIDKPV-VKILQSEPYNTLAFSKHSSNLFAAA----GTDSQVQLYDLRKPEAPIH 286
           I+  +  DK   +K  ++ P+ +L  S+H   + A      G D+++ +YD+R    PI 
Sbjct: 85  ILDVRSRDKLASLKNDKNAPFLSLD-SRHG--MLACGTELSGVDAELHIYDVRNWSTPIR 141

Query: 287 S-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMH 345
           S +  HHD VT + F P    +L SGS+D    ++DL Q    Q+++DA   V     +H
Sbjct: 142 SFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ----QEEDDALHQVINYASIH 197

Query: 346 A-GHKSPVNDFSCS 358
           + G  SP   F+ S
Sbjct: 198 SCGWLSPKRIFTLS 211

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 77/156 (49%), Gaps = 20/156 (12%)

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE 282
           S S+D T+ +   + DKP+V     E P   + FS   +NLFA A  D   +L+   +  
Sbjct: 591 SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRV- 649

Query: 283 APIHSMSGHHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL 341
            P+  M+GH + V  + F  H +G  + +GSSD+ V +WD+          +  D V  L
Sbjct: 650 YPLRVMAGHLNDVDCVSF--HSNGRYIFTGSSDKTVRMWDI----------NTGDSV-RL 696

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
            M   GH S V   S SP+  W+ ++  ++ ++ IW
Sbjct: 697 FM---GHNSTVTSLSVSPDGKWI-STGSDDGIITIW 728

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 29/138 (21%)

Query: 253 TLAFSKHSSNLFAAAGTDSQVQLYDL---------RKPEAPIHSMS----GHHDSVTSLE 299
           +L FS ++  L A+   DS ++++ L           P  PI S      GH  +V S  
Sbjct: 523 SLEFS-NNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSGTVYSTS 581

Query: 300 FAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSP 359
           F+   D  L S S D+ V +W +        Q+D      + L+ + GH+ PV D   SP
Sbjct: 582 FSAG-DEYLLSASEDKTVRLWSV--------QDD------KPLVSYKGHEKPVWDVEFSP 626

Query: 360 NIPWLMASVEEENVVQIW 377
           +   L A+   +   ++W
Sbjct: 627 SCNNLFATASNDQTARLW 644

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 106/267 (39%), Gaps = 59/267 (22%)

Query: 112 FEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRS-KDSDSALTAEFSFHKENGYGLNFS 170
           + HRD V          N +AT SG G +  ++ S ++  S+  A +      G  +  S
Sbjct: 64  YGHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGM--VTGLCVTPS 121

Query: 171 VISPGE---LLSCSDDGSIAIWDVCSGKNTPVKVDTSHN--------------------- 206
            +SP     +LSC DD ++ +W V S   + VK DT  N                     
Sbjct: 122 YLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHH 181

Query: 207 ----NIV---------------------------NECKWHEKSPFLFGSVSDDSTLIIHD 235
               N V                           N  ++++    +  S   D++++++D
Sbjct: 182 RQKSNFVTGGAQIELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVVLYD 241

Query: 236 KRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
            R + P  KI+Q+   N++ ++   +  F  A  D     YD+R     +H    H  +V
Sbjct: 242 LRTNSPTQKIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDMRNMSKALHVFKDHVSAV 301

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
             ++F+P  D ++ +GS D+ + I+ +
Sbjct: 302 MDVDFSPTGDEVV-TGSYDKTIRIYQV 327

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 124/299 (41%), Gaps = 47/299 (15%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYDRSKDSDSALTAEFSFHKENG-YGLNFSVI 172
            +Y+PF  N +A  SGS       G +F+ D   D    + +  SF  ++  Y + ++ +
Sbjct: 15  VQYSPFFDNRLAVASGSNFGLVGNGNLFILD--IDPQGRIHSMNSFMTQDCLYDVAWNEL 72

Query: 173 SPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
              ++L    DGS+ ++D  S +  P+ +   H+  V  C W+  +   F S S D T+ 
Sbjct: 73  HENQVLVAQGDGSLRLFDT-SLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVK 131

Query: 233 IHDKRIDKPVVKILQSEPY-------NTLA--------------------FSKHSSNLFA 265
           I      K  ++ LQ +P        NT+A                    FS H  NL  
Sbjct: 132 IWTPN-RKESLRTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVM 190

Query: 266 AAGTDSQVQLYDLRKPEA--PIHSMSGHHDSVT-SLEFAPHKDGILCSGSSDRRVLIWD- 321
               +S V L+DLR+P +         H+ S T + +F  ++  ++ +   D  + IWD 
Sbjct: 191 CCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSSIRIWDI 250

Query: 322 --LFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
             L  +G + Q  ++       +     H+  V   + SP+ P ++ S   +    +W+
Sbjct: 251 RMLVNLGPQSQHINSSAACINEIT--RAHELAVRKVAWSPHHPNVLLSASYDMTCSVWQ 307

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVI 172
           +++ + +A+++P + NL+   SG+  V L+D R  +S++      + +       +F+  
Sbjct: 172 NKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKY 231

Query: 173 SPGELLSCSDDGSIAIWDV 191
            P  + +   D SI IWD+
Sbjct: 232 RPTVVATSGVDSSIRIWDI 250

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 141/333 (42%), Gaps = 52/333 (15%)

Query: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELI---LGTHTS 63
            N++ V    DL+K      +D V+E  +++P   IQW+PS  RS +       L   + 
Sbjct: 133 RNKLQVIHSPDLFK------WDNVAECDVIYPVSNIQWMPSAFRSRKIATASDSLRIWSL 186

Query: 64  GTEQNYLK----IASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVT 119
            TE+N L+    ++      +  ++      S   +K S   P     ++ +F     +T
Sbjct: 187 NTEENKLEEQLNLSLCKFHKQHPNNKAFVGLSQIPTKTSDVNP----SVLGEFP---PIT 239

Query: 120 RARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLS 179
              + P + N++ + S      ++D    S + +  +   H    + + F   S     S
Sbjct: 240 SFHWNPVDTNILISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFAS 297

Query: 180 CSDDGSIAIWDV-CSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           C  DGS+ ++D+ C           +H+ I+ E    E       S SD +         
Sbjct: 298 CGGDGSVRVFDLRC----------LAHSTIIYEPPASEPGTGNNSSRSDST--------- 338

Query: 239 DKPVVKILQSEPYNTLAFSKHSSNLFAA-AGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
           D+    +L+ EP      S H  N+ A  A   +++ + D+R P++P+  ++GH  S+  
Sbjct: 339 DENSHALLRLEP------SPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQ 392

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDL---FQIGA 327
           +++ P K   L S S D +VL WD+   F  GA
Sbjct: 393 IKWHPTKKNTLISCSDDCQVLFWDISSYFDQGA 425

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 79/155 (50%), Gaps = 12/155 (7%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           LLS   D  + +WD+ S     ++    H   V+  K H  S  L  S S D T I+ D 
Sbjct: 230 LLSGGGDNLVKLWDMTSNSFEELR---GHAGRVSRVKVH-PSGRLAASASFDLTWILWD- 284

Query: 237 RIDKPVVKILQ---SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            +++ V   LQ   S+   T+AF    + L A+AG D+   ++DLR  E PI  + GH  
Sbjct: 285 -LERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRSGE-PIMKLEGHAG 341

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAE 328
           +++ ++++P+   +  +G+ D  V +WD+  +G E
Sbjct: 342 AISGVDWSPNGYQLATAGA-DGTVRVWDIRNVGTE 375

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 118/247 (47%), Gaps = 33/247 (13%)

Query: 158 SFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEK 217
           SF  EN + L         LL+   +G I + D  +GK  P++   +    +N+ K  + 
Sbjct: 11  SFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNTGK--PLQKIRASETAINDMKIID- 66

Query: 218 SPFLFGSVSDDSTL---IIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGT----- 269
           S F+ G++   +++    + D R +  V KI  +   N+   S  S +   A GT     
Sbjct: 67  SDFVAGNLISSASIDSVKVFDIRSNDCVAKI--NNETNSPFLSLDSRHGLLACGTELQGI 124

Query: 270 DSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAE 328
           D+ + +YD+RK +AP+ S+   HHD VT ++F P    +L SGS+D    I+DL      
Sbjct: 125 DAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDL------ 178

Query: 329 QQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKLTS 385
            +Q+D +D + +++   + H       SC   SP   + ++ +E  ++ ++   S +L  
Sbjct: 179 -KQDDEEDALHQVINYASIH-------SCGWLSPKRIYTLSHMETFSIHELNDKSDELKE 230

Query: 386 PYIPRDY 392
           P  P D+
Sbjct: 231 PQ-PLDF 236

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 68/137 (49%), Gaps = 3/137 (2%)

Query: 186 IAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI 245
           I +WD  S ++ P+   +   + V+  K+++    +F S   D++++++D R + P  K 
Sbjct: 196 INLWD--STRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKF 253

Query: 246 LQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKD 305
           +Q    N L ++   +  F  A  D     YD+R     +H    H  +V  ++F+P  D
Sbjct: 254 VQKMRTNALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGD 313

Query: 306 GILCSGSSDRRVLIWDL 322
            I+ +GS D+ + I+ +
Sbjct: 314 EIV-TGSYDKTIRIYQV 329

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 116/298 (38%), Gaps = 27/298 (9%)

Query: 102 PQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           PQ KI     F  +D +    +   + N +    G G + L+D   +      A F  H+
Sbjct: 48  PQGKIVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFD--INLQKYPVAIFQEHE 105

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
              +  N+++I     LS S DG++ IW     ++    + T  NN              
Sbjct: 106 REVFSCNWNLIDKQTFLSSSWDGTVKIWSPARKQSLRTLLPTPTNN-------------- 151

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTL---AFSKHSSNLFAAAGTDSQVQLYDL 278
             +V  DST++  D  +         S   + +    +S H SNL  +   +S V ++D+
Sbjct: 152 --TVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGNSYVSIFDI 209

Query: 279 RKPEAPIHSMSGHHDSVTSL--EFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADD 336
           R+P          H  + +L  +F  ++  I+ +G  D+ + +WDL  +   +Q      
Sbjct: 210 RQPVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKLIKVWDLRMV---RQSLLHTR 266

Query: 337 GVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK-ASKKLTSPYIPRDYN 393
             P  +    GH   V     SP+   ++ S   +   + W+  +   TS Y P   N
Sbjct: 267 SSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTWQDLTDNNTSGYTPGRTN 324

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/305 (24%), Positives = 125/305 (40%), Gaps = 41/305 (13%)

Query: 21  SNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDE 80
           SN  L +D V E  +++P   IQW PS          L      T  + L+I +V+ P+E
Sbjct: 160 SNDLLSWDSVVEADVVYPVSRIQWAPSQ---------LHPRKLATCSDSLRIWNVN-PEE 209

Query: 81  --VVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSG 138
                 +  S    +    +       +K++  F     +T   +   + NLI + S   
Sbjct: 210 RQFQEQINLSLCKYNRQHPTSTATTEDMKVIGTFP---PITSFDWNTVDTNLIISSSIDT 266

Query: 139 KVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTP 198
              ++D    S   +  +   H    + + F   S     SC  DGS+ ++D+ S     
Sbjct: 267 TCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS----- 319

Query: 199 VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSK 258
                +H+ I+ E      S     + +  +T    D         +L+ EP      S 
Sbjct: 320 ----LAHSTIIYE---PPSSSSSSSAPAAGTTTPSSDGS-----YALLRLEP------SP 361

Query: 259 HSSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRV 317
           +  N+ A    DS ++ + D+R PE+PI ++ GH  SV  +++ P K  +L S S D +V
Sbjct: 362 YDPNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQV 421

Query: 318 LIWDL 322
           L WDL
Sbjct: 422 LYWDL 426

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 98/233 (42%), Gaps = 49/233 (21%)

Query: 150 DSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIV 209
           DS     F  H +    L+   + P  L+S S D +I  WD+ SGK     +D S  N++
Sbjct: 489 DSPCVYTFEAHTDEVTALS---LDPSFLVSGSQDRTIRQWDLRSGKCMQT-IDLSFANVL 544

Query: 210 NECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGT 269
                 + S          STL+   +R ++P +  LQS                A    
Sbjct: 545 TAATNVDLSK---------STLLT--QRSERPSIGALQS-----------FDAALATGTK 582

Query: 270 DSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQ 329
           D  V+L+DLR  +  I ++ GH D++TSL+F       L +GS DR V +WDL + G   
Sbjct: 583 DGIVRLWDLRSGKV-IRTLKGHTDAITSLKFGSE---CLVTGSYDRTVRVWDL-RTG--- 634

Query: 330 QQEDADDGVPELLMMHAGHKSPVNDFS-CSPNIPWLMASVEEENVVQIWKASK 381
                      LL     +  P+     C  N   ++A+   E  VQI+ ++K
Sbjct: 635 -----------LLSKFHAYSEPILSLDLCQENAAVIVAN---ETAVQIYDSNK 673

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 66/144 (45%), Gaps = 10/144 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + + DG + +WD+ SGK   ++    H + +   K+  +   + GS   D T+ + D 
Sbjct: 577 LATGTKDGIVRLWDLRSGK--VIRTLKGHTDAITSLKFGSEC-LVTGSY--DRTVRVWDL 631

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           R          SEP  +L   + ++ +  A   ++ VQ+YD  K E+      G+  +VT
Sbjct: 632 RTGLLSKFHAYSEPILSLDLCQENAAVIVA--NETAVQIYDSNKDESWSCVEQGNEVNVT 689

Query: 297 SLEFAPHKDGILCSGSSDRRVLIW 320
           ++++   K+  +  G     V IW
Sbjct: 690 AIKY---KENYMVEGRESGDVHIW 710

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 9/143 (6%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G I I+DV   K   ++  + H +      W+     +  S S D T++  D R+  P 
Sbjct: 489 NGIIEIYDVT--KRKCIRTLSGHTDRTACLSWNSH---ILTSGSRDRTILHRDVRMKDPF 543

Query: 243 VKILQSEPYNTLAFS-KHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
            + ++S            S N   + G D+ V +YD   P  P+ ++  H  +V +L ++
Sbjct: 544 FERIKSHTQEVCGLKWNESDNKLVSGGNDNTVNIYDGCMP-TPLLTLDEHTAAVKALAWS 602

Query: 302 PHKDGILCS--GSSDRRVLIWDL 322
           PHK GIL +  G++DR++ IW++
Sbjct: 603 PHKRGILATGGGTADRKLKIWNI 625

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 88/207 (42%), Gaps = 14/207 (6%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +G+    +V + H+  V  C WH +   +  S S D+ +   D
Sbjct: 177 KFVTCSDDNVLKIWNFSNGQQE--RVLSGHHWDVKSCDWHPRFGLIV-SGSKDNLIKFWD 233

Query: 236 KRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            R  + V  IL          F     NL A    D   ++YD+R+    + ++    D 
Sbjct: 234 PRTGRNVSTILGLKHTIIKTKFQPTQGNLLAVVAKDKSTKIYDIRQNMRELQTIRDDVDY 293

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVND 354
           + SL + P  + +   G  +  +  +DL          D +  VP    +   H+  V  
Sbjct: 294 M-SLVWHPINETMFSVGCYNGAIKHFDLLH--------DNNSPVPSSHTITYAHEKSVTS 344

Query: 355 FSCSPNIPWLMASVEEENVVQIWKASK 381
            + SP +  ++AS  ++  ++ W  S+
Sbjct: 345 LAYSP-VGHILASAAKDRTIRFWARSR 370

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           G ++S S D  I  WD  +G+N    +   H  I  + K+      L   V+ D +  I+
Sbjct: 218 GLIVSGSKDNLIKFWDPRTGRNVSTILGLKHTII--KTKFQPTQGNLLAVVAKDKSTKIY 275

Query: 235 DKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDL----RKPEAPIHSMS 289
           D R +   ++ ++ +  Y +L +   +  +F+    +  ++ +DL      P    H+++
Sbjct: 276 DIRQNMRELQTIRDDVDYMSLVWHPINETMFSVGCYNGAIKHFDLLHDNNSPVPSSHTIT 335

Query: 290 -GHHDSVTSLEFAPHKDGILCSGSSDRRVLIW 320
             H  SVTSL ++P    IL S + DR +  W
Sbjct: 336 YAHEKSVTSLAYSP-VGHILASAAKDRTIRFW 366

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 69/141 (48%), Gaps = 3/141 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  S ++TP+   +   + +   K+++    +F S   D++++++D R + P  
Sbjct: 193 AQIQLWD--SNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F     D     YD+R     I+    H  +V  ++F+P 
Sbjct: 251 KIVQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPT 310

Query: 304 KDGILCSGSSDRRVLIWDLFQ 324
            D I+ +GS D+ + I+   Q
Sbjct: 311 GDEIV-TGSYDKTIRIFKTNQ 330

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 69/139 (49%), Gaps = 3/139 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  +G++ PV   +   + V   K+++    +  S   D++++++D R + P  
Sbjct: 193 AQIELWD--TGRSKPVSNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 251 KIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT 310

Query: 304 KDGILCSGSSDRRVLIWDL 322
            D I+ +GS D+ V I+ +
Sbjct: 311 GDEIV-TGSYDKTVRIYQV 328

>Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa]
           {ON} YLR208W (SEC13) - cytoplasmic protein involved in
           release of transport vesicles from the ER [contig 161]
           FULL
          Length = 294

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 73/171 (42%), Gaps = 24/171 (14%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L SCS DG + IW   +G+ T + V   H+  VN  +W  HE  P L  + S
Sbjct: 66  FGVI----LASCSYDGKVLIWKEENGRWTQIAVHAVHSASVNSVQWAPHEYGPLLLAASS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAFS---------KHSSNLFAAAGTDSQVQL 275
           D    ++  K      P++    S   NT +++               F   G D+ V++
Sbjct: 122 DGKVSVVEFKENGTTSPILVDAHSIGVNTASWASAALQGGAVSQQMRRFVTGGADNLVKV 181

Query: 276 YDLRKPEAPIH----SMSGHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
           +    P+A  +    ++ GH D V  + ++P       L S S DR  +IW
Sbjct: 182 WKFN-PDANTYLLEDTLEGHTDWVRDVAWSPSVLLRSYLASVSQDRTCIIW 231

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 80/152 (52%), Gaps = 7/152 (4%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           L++ + +G I IW++ +   +P    T H N V   ++H    ++  S S D T  + D 
Sbjct: 240 LVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYV-ASASFDMTWRLWDV 298

Query: 236 -KRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            K+I+  + +    E Y  +AF K  S L  + G DS   ++DLR  ++ I ++ GH   
Sbjct: 299 EKQIELQLQEGHAKEVY-CVAFQKDGS-LLCSTGLDSVGLVWDLRSGKS-IMALEGHIKP 355

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           +  L+++P+   I  +GS+D  + +WD+ ++G
Sbjct: 356 IYGLDWSPNGYDI-ATGSADGTIRLWDVRKVG 386

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 165 YGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGS 224
           YGL++S  +  ++ + S DG+I +WDV   K   +    +HN+IV+E K+ + +     S
Sbjct: 357 YGLDWSP-NGYDIATGSADGTIRLWDVR--KVGILGALPAHNSIVSEVKFDKANGHYLVS 413

Query: 225 VSDDSTLIIH 234
            S D TL I+
Sbjct: 414 SSYDKTLNIY 423

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 91/212 (42%), Gaps = 23/212 (10%)

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYG--LNFSVISPGELLSCSDDGSIA 187
           +IA    SG V L+  + DS   L +E  F +  G    + F+      L S    G I 
Sbjct: 76  IIAGALDSGVVELFSSTGDS---LKSEARFQQHQGAAKTVKFNSKQNNVLASGGSKGEIY 132

Query: 188 IWDV--C---SGKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK 240
           IWD+  C   S   TP+    +   I  V    W++    +F S    S   I D +  K
Sbjct: 133 IWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAKK 192

Query: 241 PVVKILQSEPYNTLA--------FSKHSSNLFAAAGTDSQ--VQLYDLRKPEAPIHSMS- 289
            V+ +  + P   L           K+S+ +  A G+D++  + ++DLR    P+  +S 
Sbjct: 193 EVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVLSK 252

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           GH   + SL++    + +L S   D  +++W+
Sbjct: 253 GHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 122/300 (40%), Gaps = 53/300 (17%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYDRSKDSDSALTAEFSFHKENG-YGLNFSVI 172
            +Y+PF  N +A  +GS       GK+F+ D   D    +    SF  ++G + + ++  
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILD--IDPHGRMVESNSFLTQDGLFDVAWNEG 71

Query: 173 SPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
              ++L+   DGS+ ++D+ +    P+ +   H   V  C W+  +   F S S D T+ 
Sbjct: 72  HANQVLAAQGDGSLRLFDI-NLPQYPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVK 130

Query: 233 IHDKRIDKPVVKI-------------------LQSEPYNTL-----------AFSKHSSN 262
           I      + +  +                   L ++  +++            FS H  N
Sbjct: 131 IWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPN 190

Query: 263 LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSL--EFAPHKDGILCSGSSDRRVLIW 320
           L      +S V L+DLR+P          H  + +L  +F  ++  I+ +G  D+ V IW
Sbjct: 191 LIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIW 250

Query: 321 DLFQI---GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
           DL  +       QQ  + + +P       GH+  +   S SP+   L+ S   +   ++W
Sbjct: 251 DLRMVRKFSNPLQQPMSINEIP-------GHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/260 (17%), Positives = 99/260 (38%), Gaps = 42/260 (16%)

Query: 102 PQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           P  ++     F  +D +    +   + N +    G G + L+D   +      + F  H+
Sbjct: 47  PHGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFD--INLPQYPISIFQEHQ 104

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWD-------------------VCSGKNTPVKVD 202
           +  +  N+++++    +S S DG++ IW                    +   K   + + 
Sbjct: 105 KEVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLS 164

Query: 203 TSHN--------NIVNECKWHEKSPFLFGSVSDDSTLIIHDKR--IDKPVVKILQSEPYN 252
              N        + + + ++    P L    + +S + + D R   +      +      
Sbjct: 165 NQQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLE 224

Query: 253 TLA--FSKHSSNLFAAAGTDSQVQLYDLR---------KPEAPIHSMSGHHDSVTSLEFA 301
           TL   F+K+  ++ A  G D  V+++DLR         +    I+ + GH  ++  + ++
Sbjct: 225 TLTCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWS 284

Query: 302 PHKDGILCSGSSDRRVLIWD 321
           PH   ++ S S D    +WD
Sbjct: 285 PHHSNLVLSTSYDMTCRVWD 304

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 70/167 (41%), Gaps = 13/167 (7%)

Query: 113 EHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVI 172
           +++D + +A+++P +PNLI   +G+  V L+D  + +++      S         +F+  
Sbjct: 174 KNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKY 233

Query: 173 SPGELLSCSDDGSIAIWDVCSGK--NTPVKVDTSHNNI------VNECKWHEKSPFLFGS 224
            P  + +   D  + IWD+   +  + P++   S N I      + +  W      L  S
Sbjct: 234 RPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLS 293

Query: 225 VSDDSTLIIHDKRID---KPVVKILQSEPYN--TLAFSKHSSNLFAA 266
            S D T  + D   D   +P  K    +P       F  H+  +F A
Sbjct: 294 TSYDMTCRVWDDLSDSNGRPTGKTNSIDPTKGCRFIFPHHTEFVFGA 340

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 87/196 (44%), Gaps = 17/196 (8%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  S ++ P    +   + V+  K+++    +F S   D++++++D R + P  
Sbjct: 193 AEINLWD--SSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           K  Q    N L ++   +  F  A  D     YD+R     +H    H  +V  ++F+P 
Sbjct: 251 KFTQRMRTNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPT 310

Query: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363
            D I+ +GS D+ + I   +Q+     +E          + H      V     S +  +
Sbjct: 311 GDEIV-TGSYDKTIRI---YQVKHGHSRE----------VYHTKRMQHVFQVKYSMDSKY 356

Query: 364 LMASVEEENVVQIWKA 379
           +M+  ++ N +++W+A
Sbjct: 357 IMSGSDDGN-IRMWRA 371

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 67/139 (48%), Gaps = 3/139 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  S ++ P+   T   + V   K+++    +  S   D++++++D R + P  
Sbjct: 193 AQIQLWD--SSRSKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+QS   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 251 KIVQSMRSNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP- 309

Query: 304 KDGILCSGSSDRRVLIWDL 322
               L +GS D+ + I+D+
Sbjct: 310 TGTELVTGSYDKTIRIYDI 328

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 108/225 (48%), Gaps = 26/225 (11%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNE---CKWHEKSPFLFGSVSDDSTLII 233
           LL+   +GS+ + D    KN  +    +H   +++         + FL  + ++DS  I 
Sbjct: 28  LLASLSNGSVQLIDWV--KNKQISQIQAHGTTISDMVVLNNDRNNGFLIATAAEDSVKIF 85

Query: 234 HDKRIDK-PVVKILQSEPYNTLAFSKHSSNLFAAA----GTDSQVQLYDLRKPEAPIHSM 288
             +  D    +K  +S P+ +L  S+H   + A      G D+++ +YD++    P+ S+
Sbjct: 86  DLRSSDTVATLKNEKSAPFLSLD-SRHG--MLACGTELSGVDAELHIYDMKAWHQPLRSL 142

Query: 289 -SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAG 347
              HHD +T+++F P    +L SGS+D  V I+DL        Q + DD + +++   + 
Sbjct: 143 VDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDL-------TQPEEDDALHQVINFASI 195

Query: 348 HKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY 392
           H S      C+P   + ++ +E   + ++    ++ T P+ P+D+
Sbjct: 196 HSSGW----CAPKRIYTLSHMETFGIHELNDKLEEPTEPH-PKDF 235

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYDRSK-DSDSALTAEFSF 159
           H D++T  ++ P +PN++ + S  G V +YD ++ + D AL    +F
Sbjct: 146 HHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQPEEDDALHQVINF 192

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 27/151 (17%)

Query: 172 ISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTL 231
           + P  L+S S D +I  WD+ SGK     +D S  N++      + S          STL
Sbjct: 510 LDPSFLVSGSQDRTIRQWDLRSGKCLQT-IDLSFANVLTTSTNVDLSK---------STL 559

Query: 232 IIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH 291
           +   +R ++P +  LQS       F        A    D  V+L+DLR  +  I ++ GH
Sbjct: 560 LT--QRNERPSIGALQS-------FDAA----LATGTKDGVVRLWDLRSGKV-IRTLKGH 605

Query: 292 HDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
            D++TSL+F       L +GS DR V IWDL
Sbjct: 606 TDAITSLKF---DSACLVTGSYDRTVRIWDL 633

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 63/144 (43%), Gaps = 10/144 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + + DG + +WD+ SGK   ++    H + +   K+ + +  + GS   D T+ I D 
Sbjct: 579 LATGTKDGVVRLWDLRSGK--VIRTLKGHTDAITSLKF-DSACLVTGSY--DRTVRIWDL 633

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           R    ++    +     L+      N       +  VQ+YD  K E+      G+  SV+
Sbjct: 634 RT--GLLNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVS 691

Query: 297 SLEFAPHKDGILCSGSSDRRVLIW 320
           ++++   K+  +  G  +  V IW
Sbjct: 692 TVKY---KENYMVEGRENGDVNIW 712

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD    K+T   +    +NI +  K+++    +  S   D++++++D R + P  
Sbjct: 192 AQIQLWDTSRSKSTS-NLSWGADNITS-VKFNQNDSNILASTGSDNSIVLYDLRTNSPTQ 249

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q    N+L ++      F     D     YD+RK    ++    H  +V  ++FAP 
Sbjct: 250 KIVQQMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPT 309

Query: 304 KDGILCSGSSDRRVLIW 320
            D I+ +GS D+ + I+
Sbjct: 310 GDEIV-TGSYDKTIRIF 325

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 88/218 (40%), Gaps = 46/218 (21%)

Query: 112 FEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSV 171
           + HRD V        + N +AT SG G V  ++ S    S     F  H     GL  S 
Sbjct: 64  YGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMS---SSEELCSFKAHYGIVTGLCVSP 120

Query: 172 ISPGE------LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSV 225
           +   +      +LSC DD ++ +W V          DT                  +  V
Sbjct: 121 VLASKNKNLQYMLSCGDDKTVKLWSV----------DTDD----------------YADV 154

Query: 226 SDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN-LFAAAGTDSQVQLYDLRKPEAP 284
            DD  L        + ++K    + ++      H SN  F   G  +Q+QL+D  + ++ 
Sbjct: 155 KDDQNLNT------RGLLKTFYGD-HSFQGIDHHRSNSAFVTGG--AQIQLWDTSRSKS- 204

Query: 285 IHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
             ++S   D++TS++F  +   IL S  SD  ++++DL
Sbjct: 205 TSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDL 242

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 72/169 (42%), Gaps = 35/169 (20%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGK---NTPVKVDTSHNNIVNECK 213
           F  H +    L+F       L+S S D  I  WD+ +GK      +    +HN+     +
Sbjct: 423 FELHNDEITALSFD---SEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTSTR 479

Query: 214 WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQV 273
             +   +L G+              + P++  LQ   YN+           A    D  V
Sbjct: 480 SGKNGTYLLGT--------------EAPMIGALQC--YNSA---------LATGTKDGVV 514

Query: 274 QLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           +L+DLR  + P+ S+ GH D +TSL+F   K   L +GS D  V IWDL
Sbjct: 515 RLWDLRIGK-PVRSLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 559

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 39/90 (43%), Gaps = 22/90 (24%)

Query: 252 NTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE------AP-------------IHSMSGHH 292
           N +   K + N+      D+ ++++DL   +      +P             IH+   H+
Sbjct: 368 NCMQMDKTNYNILITGSKDATLKMWDLNLSKELYLDHSPLRQNMEETIITPCIHNFELHN 427

Query: 293 DSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           D +T+L F       L SGS D+++  WDL
Sbjct: 428 DEITALSFDSEA---LISGSKDKKIFHWDL 454

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 92/220 (41%), Gaps = 20/220 (9%)

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           +IA    +G V L+  + DS  +  A+F  HK       F+      L +    G I IW
Sbjct: 76  IIAGALDNGSVELFSYNADSLKS-EAKFQRHKTTAKVARFNAKQFNVLATGGTKGEIFIW 134

Query: 190 DV--C---SGKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           DV  C       TP+    S   +  +    W++    +F S    S   I D +  K V
Sbjct: 135 DVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKAKKEV 194

Query: 243 VKILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHSMS-GH 291
           + +  + P   L           K+S+ +  A G+D+   + ++DLR    P+  +S GH
Sbjct: 195 IHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQGH 254

Query: 292 HDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQ 331
              V SL++    + +L S   D  V++W+  Q G E  Q
Sbjct: 255 SKGVLSLDWCNQDENLLLSSGRDNTVVLWNP-QEGQELTQ 293

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 100/215 (46%), Gaps = 21/215 (9%)

Query: 127 NPNLIATISGSGKVFLYDRSKDSDSALT--AEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           N  +IA    +G + LY  + ++++A+   A FS H  +   + F+      L S  ++G
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 185 SIAIWDV--CS---GKNTPVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
            I IWD+  C+      TP+    S +++  V    W++    +F S    +   I D +
Sbjct: 132 EIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 238 IDKPVVKILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHS 287
             K V+ +  + P + +           K+S+ +  A G+D+   + ++DLR    P+ +
Sbjct: 192 AKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQT 251

Query: 288 MS-GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           ++ GH   + SL++    + +L S   D  VL+W+
Sbjct: 252 LNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 239 DKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSM---SGHHDSV 295
           +KP+  +     +N L +S H++ + A A  +  ++LY   +    I+SM   S H  SV
Sbjct: 53  EKPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSV 111

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
            +++F   +D +L SG ++  + IWD+
Sbjct: 112 KTVKFNAKQDNVLASGGNNGEIFIWDM 138

>SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly
           similar to uniprot|Q04491 Saccharomyces cerevisiae
           YLR208W SEC13 Component of both the Nup84 nuclear pore
           sub-complex and of the COPII complex (Sar1p Sec13p
           Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p) which is
           important for the formation of ER to Golgi transport
           vesicles
          Length = 296

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 73/173 (42%), Gaps = 26/173 (15%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L SCS DG + IW   +G  + + V   H+  VN  +W  HE  P L  + S
Sbjct: 66  FGVI----LASCSYDGKVLIWREENGTWSQIAVHNVHSASVNSVQWAPHEYGPLLLAASS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAF-----------SKHSSNLFAAAGTDSQV 273
           D    ++  K      P++    +   NT ++           S+     F   G D+ V
Sbjct: 122 DGKVSVVEFKENGTTAPIIIDAHAIGVNTASWGPTTIQESTGDSQQQLRRFVTGGADNLV 181

Query: 274 QLYDLRKPEAPIH----SMSGHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
           +++    PEA  +    ++ GH D V  + ++P       L S S DR  +IW
Sbjct: 182 KIWRF-NPEANTYLLEDTLEGHSDWVRDVAWSPSVLLRSYLASVSQDRTCIIW 233

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 25/200 (12%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           S+D SI +WD+ SGK   +K+  S H   V +    E+ P++F S S+D T+   D   +
Sbjct: 142 SNDTSIKVWDLASGK---LKLTLSGHIMTVRDLAISERHPYMF-SASEDKTIKCWDLEKN 197

Query: 240 KPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSL 298
             V++            S H + +L  +AG DS V+L+D+R    P+ ++ GH   +  +
Sbjct: 198 M-VIRNYHGHLSGVHTVSLHPTLDLVVSAGRDSVVKLWDMRT-RVPVMNLIGHKSPINKV 255

Query: 299 EFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCS 358
              P  D  + S S+D  + +WD+              G    ++ H  HK  V DF+  
Sbjct: 256 RCLP-VDPQIISCSTDANIRLWDITA------------GKSAKILTH--HKRSVRDFALH 300

Query: 359 PNIPWLMASVEEENVVQIWK 378
           P+  + MAS   ++ ++ WK
Sbjct: 301 PS-EFSMASACTDD-IRSWK 318

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 23/136 (16%)

Query: 254 LAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
           LA S+    +F+A+  D  ++ +DL K    I +  GH   V ++   P  D ++ +G  
Sbjct: 171 LAISERHPYMFSAS-EDKTIKCWDLEK-NMVIRNYHGHLSGVHTVSLHPTLDLVVSAGR- 227

Query: 314 DRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENV 373
           D  V +WD+               VP  +M   GHKSP+N   C P  P +++   + N 
Sbjct: 228 DSVVKLWDM------------RTRVP--VMNLIGHKSPINKVRCLPVDPQIISCSTDAN- 272

Query: 374 VQIW-----KASKKLT 384
           +++W     K++K LT
Sbjct: 273 IRLWDITAGKSAKILT 288

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 34/180 (18%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++SCS D +I +WD+ +GK+   K+ T H   V +   H     +  + +DD   I   
Sbjct: 263 QIISCSTDANIRLWDITAGKS--AKILTHHKRSVRDFALHPSEFSMASACTDD---IRSW 317

Query: 236 KRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH-HD 293
           K  +  ++   QS     + + S +  ++  A G D  +  YD +         SGH + 
Sbjct: 318 KLPEGILLTNFQSTSTGIINSLSINHDDVLFAGGDDGTLSFYDYK---------SGHKYQ 368

Query: 294 SVTSLEF---APHKDGILCS-----------GSSDRRVLIWDLFQIGAEQQQEDADDGVP 339
           S+ + E       + GILCS           G  D+ + IW       E    D++ G+P
Sbjct: 369 SLLTTEIPGSLESERGILCSSFDQTGLRLITGEIDKSIKIWK----QEESATPDSNPGLP 424

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 32/172 (18%)

Query: 226 SDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLR----KP 281
            D   LI  +K+ ++P  K +  + YN  A  +HS         + Q QL   +     P
Sbjct: 61  GDSKQLIEFNKKAEEPS-KAMIKKVYN-YAGGQHSV-------MERQEQLISQKPSWHAP 111

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL 341
              I  ++GH   V  +E  P  +    +GS+D  + +WDL                 +L
Sbjct: 112 WKLIRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWDL--------------ASGKL 157

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
            +  +GH   V D + S   P+ M S  E+  ++ W   K +    + R+Y+
Sbjct: 158 KLTLSGHIMTVRDLAISERHPY-MFSASEDKTIKCWDLEKNM----VIRNYH 204

>KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa]
           {ON} highly similar to uniprot|Q04491 Saccharomyces
           cerevisiae YLR208W SEC13 Component of both the Nup84
           nuclear pore sub-complex and of the COPII complex (Sar1p
           Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p)
           which is important for the formation of ER to Golgi
           transport vesicles
          Length = 302

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 96/243 (39%), Gaps = 54/243 (22%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L SCS DG + IW   +G+ + +     H+  VN  +W  HE  P L  + S
Sbjct: 66  FGVI----LASCSYDGKVLIWKEVNGRWSQIAAHEVHSASVNSIQWAPHEYGPLLLAASS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAFS----KHSSN-------------LFAAA 267
           D    ++  K      P++    S   NT  ++    +  SN              F   
Sbjct: 122 DGKVSVVEFKENGTTSPIIIDAHSIGANTACWAPATLQQQSNQGTSGSASPQQVRRFVTG 181

Query: 268 GTDSQVQLYDLRKPEAPI---HSMSGHHDSVTSLEFAPH--KDGILCSGSSDRRVLIWDL 322
           G D+ V+++      A     H++ GH D V  + ++P       L S S DR  +IW  
Sbjct: 182 GADNLVKIWKYNSDAATYLLEHTLEGHSDWVRDVAWSPTVLSRSYLASVSQDRTCIIW-- 239

Query: 323 FQIGAEQQQEDA-------DDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQ 375
                +  +ED        +D  P++L   +        +S S NI   +A    +N V 
Sbjct: 240 ----TQDSKEDTWKKTLLKEDKFPDVLWRAS--------WSLSGNI---LALSCGDNTVT 284

Query: 376 IWK 378
           +WK
Sbjct: 285 LWK 287

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 124/304 (40%), Gaps = 41/304 (13%)

Query: 21  SNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASV-HLPD 79
           SN  L ++ V +  +++P   IQW+PS          L      T  + L+I +V H   
Sbjct: 160 SNDLLSWENVVDADVVYPVSKIQWVPSQ---------LHPRKLATCSDSLRIWNVNHEER 210

Query: 80  EVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGK 139
           +    +  S    +    +       +K++  F     +T   +   + NLI + S    
Sbjct: 211 QFQEQINLSLCKYNRQHPANPAATDDMKVIGTFP---PITSFDWNMVDTNLIISSSIDTT 267

Query: 140 VFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPV 199
             ++D    S   +  +   H    + + F   S     SC  DGS+ ++D+ S      
Sbjct: 268 CIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS------ 319

Query: 200 KVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH 259
               +H+ I+ E      +P L    +  ++         K    +L+ EP      S +
Sbjct: 320 ---LAHSTIIYEPP-ASSAPGLNADTTTPAS---------KGSDALLRLEP------SPY 360

Query: 260 SSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVL 318
             N+ A    +S ++ + D+R PE+PI ++ GH  SV  +++ P K  +L S   D +VL
Sbjct: 361 DPNVLATFAAESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVL 420

Query: 319 IWDL 322
            WDL
Sbjct: 421 YWDL 424

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 6/179 (3%)

Query: 145 RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS--IAIWDVCSGKNTPVKVD 202
           RS D+DS +  E      +G    F  I    + S    G   I +WDV   K  PV   
Sbjct: 159 RSSDNDSVINEEGLVRTFDGESA-FQGIDSHRVNSTFATGGAKIQLWDVNRVK--PVSNL 215

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
           +   + +   K+++    +  S   D++++++D R + P  KI+Q+   N + ++   + 
Sbjct: 216 SWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAF 275

Query: 263 LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
            F  A  D     YD+R     ++    H  +V  ++F+P  D I+ +GS D+ + I++
Sbjct: 276 NFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIV-TGSYDKSIRIYN 333

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 85/188 (45%), Gaps = 29/188 (15%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC----KWH 215
           H++  Y +  +  S  +L + S DG I  W++ S +   V     +  I   C     +H
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNM-STREEFVSFKAHYGLITGLCVTQPHFH 124

Query: 216 EKSPFLFG-----SVSDDSTLIIHDKRID----------------KPVVKILQSEPYNTL 254
           +K P L       S SDD T+ +    +D                + +V+    E     
Sbjct: 125 DKKPDLKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVINEEGLVRTFDGESAFQG 184

Query: 255 AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSD 314
             S   ++ FA  G  +++QL+D+ + + P+ ++S   D++TS++F  ++  IL S  SD
Sbjct: 185 IDSHRVNSTFATGG--AKIQLWDVNRVK-PVSNLSWGADNITSVKFNQNETDILASTGSD 241

Query: 315 RRVLIWDL 322
             ++++DL
Sbjct: 242 NSIVLYDL 249

>Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 86/180 (47%), Gaps = 14/180 (7%)

Query: 162 ENGYGLNFSVISPGELLSCS-DDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S I  G  L+   ++G + I+DV   K   ++  + H + V    W+     
Sbjct: 302 ENEY-TSLSWIGAGSHLAVGQENGLVEIYDVI--KRKCIRTLSGHVDRVACLSWNNH--- 355

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R+  P  + ++S          + + N  A+ G D+ V +Y+  
Sbjct: 356 VLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNMVHVYE-G 414

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
             ++PI +   H  +V ++ ++PHK GIL +  G++DR++ IW+   +    +  D D G
Sbjct: 415 TSKSPILTFDEHKAAVKAMAWSPHKRGILATGGGTADRKLKIWN---VNTSTKMSDIDSG 471

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 112/300 (37%), Gaps = 52/300 (17%)

Query: 123 YAPFNPNLIATISGS-------GKVFLYDRSKDSDSALTAEFSFHKENG-YGLNFSVISP 174
           Y+PF  N +A  SGS       GK+ + D   +    L    SF  ++G + L ++    
Sbjct: 16  YSPFYDNKLAVASGSNFGLVGNGKLIILDIMPNGQ--LVESNSFLTQDGLFDLAWNESHE 73

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDS----- 229
            + L    DGS+ ++D+   K+ P+ +   H   V  C W+     +F S S D      
Sbjct: 74  NQCLVAQGDGSLRLFDI-KLKDYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLW 132

Query: 230 ---------TLIIHDKRIDKPVVKILQSEPYNT--------------------LAFSKHS 260
                    T+  +D      + +     P                         FS H 
Sbjct: 133 SLMRPQSLMTMSPNDTNAASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHD 192

Query: 261 SNLFAAAGTDSQVQLYDLRKPE--APIHSMSGHHD-SVTSLEFAPHKDGILCSGSSDRRV 317
            NL   +  +S + LYDLR P    P H   GH      + +F  ++  I+ +G  D+ +
Sbjct: 193 PNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMI 252

Query: 318 LIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
            +WDL        Q      + E+     GH+  V   + SP+   ++ S   +   ++W
Sbjct: 253 KVWDLRMCRKMLSQGHQPININEI----QGHELAVRKVTWSPHHSNMLLSTSYDMTCRVW 308

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 104/265 (39%), Gaps = 49/265 (18%)

Query: 102 PQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYD-RSKDSDSALTAEFSFH 160
           P  ++     F  +D +    +   + N      G G + L+D + KD   A+  E   H
Sbjct: 47  PNGQLVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLKDYPIAIYKE---H 103

Query: 161 KENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN---------------------TPV 199
           +   +  N+++I     +S S DG + +W +   ++                      PV
Sbjct: 104 QREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSLMTMSPNDTNAASTLSRTSAVAPV 163

Query: 200 KVDTS------HNNIVNECKWHEK----SPFLFGSVSDDSTLIIHDKRIDK---PVVKIL 246
           +V  S      H +   EC +        P L    S +S + ++D R+     P  + L
Sbjct: 164 RVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFL 223

Query: 247 QSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYDLR-------KPEAP--IHSMSGHHDSV 295
               +  L   F+K+  ++ A  G D  ++++DLR       +   P  I+ + GH  +V
Sbjct: 224 GHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAV 283

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIW 320
             + ++PH   +L S S D    +W
Sbjct: 284 RKVTWSPHHSNMLLSTSYDMTCRVW 308

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L+S S D +  +WD+ S      ++  +H++ V + ++  KS  LF S   D ++ + D 
Sbjct: 296 LISSSIDTTCIVWDLQSSNYVKTQL-IAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDL 354

Query: 237 RI-----------DKPVVKILQSEPYNTLAF---SKHSSNLFAAAGTDS-QVQLYDLRKP 281
           R              PV     S+  N L     S   +N+ A   ++S ++ + D+R  
Sbjct: 355 RSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNS 414

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           E+P+  + GH  ++  +++ P K  IL S S D +VL WDL
Sbjct: 415 ESPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 113 EHRDEVTRARYAPFNPNLIAT-ISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSV 171
           + ++ + R   +P + N+IAT +S S K+ + D        L  E   HK     + +  
Sbjct: 378 QQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEG--HKSAINQIKWHP 435

Query: 172 ISPGELLSCSDDGSIAIWDVCS 193
                LLSCSDD  +  WD+ S
Sbjct: 436 TKRYILLSCSDDCQVLYWDLNS 457

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 120/305 (39%), Gaps = 62/305 (20%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYD-----RSKDSDSALTAEFSFHKENGYGLN 168
            +Y+PF  N +A +SGS       GK+F+ D     +  +S+S LT +  F       + 
Sbjct: 14  VQYSPFFDNRLAVVSGSNFGLVGNGKLFILDIDPQGKIHESNSFLTQDCLFD------VA 67

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           ++ +   ++L    DGS+ ++D    +  P+ +   H   V  C W+  +   F S S D
Sbjct: 68  WNELHENQVLVAQGDGSLRLFDTKLAQ-YPIAIFKEHQKEVFSCNWNLLNKNTFVSSSWD 126

Query: 229 STLIIHDKRIDKPVVKILQSEPYNTL------------------------------AFSK 258
            T+ I      K  +  L  +P  T+                               FS 
Sbjct: 127 GTVKIWSP-TRKDSLLTLTPQPLKTVNRVDHSMNIPMSNQRNHADITRNKNCIYQAQFSP 185

Query: 259 HSSNLFAAAGTDSQVQLYDLRKPEAPIHSMS--GHHD-SVTSLEFAPHKDGILCSGSSDR 315
           H  NL      +S + ++DLR+P +P +  +  GH      + +F  ++   + +G  D 
Sbjct: 186 HDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIATGGVDN 245

Query: 316 RVLIWDLFQIGAEQQQEDADDGVPELLM--MHAGHKSPVNDFSCSPNIPWLMASVEEENV 373
            + IWDL       +    ++  P + +  +  GH+  V     SP+   +  S   +  
Sbjct: 246 VIRIWDL-------RMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMT 298

Query: 374 VQIWK 378
             +W+
Sbjct: 299 CCVWQ 303

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 127/309 (41%), Gaps = 51/309 (16%)

Query: 21  SNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDE 80
           SN  L ++ V +  +++P   IQW+PS          L      T  + L+I +V+ P+E
Sbjct: 160 SNDLLSWENVVDANVVYPVSKIQWVPSQ---------LHPRKLATCSDSLRIWNVN-PEE 209

Query: 81  --VVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSG 138
             +   V  S    +    +       +K++  F     +T   +   + NLI + S   
Sbjct: 210 RHLQEQVNLSLCKYNRQHPTSPATADDMKVIGTFP---PITSFDWNTVDTNLIISSSIDT 266

Query: 139 KVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTP 198
              ++D    S   +  +   H    + + F   S     SC  DGS+ ++D+ S     
Sbjct: 267 TCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRS----- 319

Query: 199 VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK----ILQSEPYNTL 254
                +H+ I+ E      S    G+ +              P +K    +L+ EP    
Sbjct: 320 ----LAHSTIIYEPPSSPASGPNAGATT--------------PSLKGSDALLRLEP---- 357

Query: 255 AFSKHSSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
             S +  N+ A    DS ++ + D+R PE+PI ++ GH  SV  +++ P K  +L S S 
Sbjct: 358 --SPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSD 415

Query: 314 DRRVLIWDL 322
           D + L WDL
Sbjct: 416 DCQALYWDL 424

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 67/142 (47%), Gaps = 9/142 (6%)

Query: 184 GSIAIWDVCSGK---NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK 240
             I +WDV   K   N    VD      V+  ++++    +  S   D++++++D R + 
Sbjct: 196 AQIQLWDVNRKKPLSNLSWGVDN-----VSFVRFNQNEEDILASTGSDNSIVLYDLRTNS 250

Query: 241 PVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEF 300
           P  K++Q    N L ++      FA A  D     YD+R     +H    H  +V  ++F
Sbjct: 251 PTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDF 310

Query: 301 APHKDGILCSGSSDRRVLIWDL 322
           +P  + I+ +GS D+ + I++L
Sbjct: 311 SPTGEEIV-TGSYDKTIRIFNL 331

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 69/147 (46%), Gaps = 33/147 (22%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           +LSC DD +I +W V S                            F S+ DD T I+ D 
Sbjct: 132 MLSCGDDKTIKLWSVNSDD--------------------------FNSIKDD-TKIVSDT 164

Query: 237 RIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
             D  ++K    E  + ++   + + N F   G  +Q+QL+D+ + + P+ ++S   D+V
Sbjct: 165 G-DGALLKTFYGEHAFQSIDHHRRNPN-FVTGG--AQIQLWDVNRKK-PLSNLSWGVDNV 219

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
           + + F  +++ IL S  SD  ++++DL
Sbjct: 220 SFVRFNQNEEDILASTGSDNSIVLYDL 246

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 55/94 (58%), Gaps = 6/94 (6%)

Query: 267 AGTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           +G D+++ +YD+R  + P+ S+   HHD +TS++F P    +L SGS+D  V I+DL Q 
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ- 198

Query: 326 GAEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358
              Q+++DA   V     +H+ G  SP   ++ S
Sbjct: 199 ---QEEDDALHQVINFASIHSCGWLSPKRIYTLS 229

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 44/88 (50%), Gaps = 5/88 (5%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYDRS-KDSDSALTAEFSFHKENGYGLNFSVI 172
           H D++T  ++ P +PN++ + S  G V +YD + ++ D AL    +F   +  G     +
Sbjct: 165 HHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEEDDALHQVINFASIHSCGW----L 220

Query: 173 SPGELLSCSDDGSIAIWDVCSGKNTPVK 200
           SP  + + S   +  I ++   ++ P +
Sbjct: 221 SPKRIYTLSHMETYGIHELNDKRDEPTE 248

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 91/190 (47%), Gaps = 15/190 (7%)

Query: 177 LLSCSDDGSIAIWDVCSGKNT-PVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           LL+   +G I + D  +GK+   +K   +  N +        +  L  S S D+  +  D
Sbjct: 29  LLTGLSNGEIRLLDWSTGKSVQKIKASETAINDMKVIGSDFSAGHLVSSASIDAVKVF-D 87

Query: 236 KRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGT-----DSQVQLYDLRKPEAPIHSM-S 289
            R +  + +I Q+E  N+   S  S +   A GT     D+ V +YD+RK + P+ S+  
Sbjct: 88  IRTNDRIAQI-QNEA-NSPFISLDSRHGLLACGTELQGIDAAVYIYDIRKWDTPLRSLID 145

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHA-GH 348
            HHD VT ++F P    IL SGS+D    I+DL Q     ++EDA   V     +H+ G 
Sbjct: 146 SHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ----DEEEDALHQVINYASIHSCGW 201

Query: 349 KSPVNDFSCS 358
            SP   F+ S
Sbjct: 202 LSPKRIFTLS 211

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 65/141 (46%), Gaps = 3/141 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD    K  P+   T   + V   K+++    +  S   D++++++D R + P  
Sbjct: 193 AQIQLWDANRSK--PISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI QS   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 251 KIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT 310

Query: 304 KDGILCSGSSDRRVLIWDLFQ 324
            D I+ +GS D+ + I+   Q
Sbjct: 311 GDEIV-TGSYDKTIRIYKTNQ 330

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 60/148 (40%), Gaps = 38/148 (25%)

Query: 177 LLSCSDDGSIAIWDVCSGK-NTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           ++SC DD ++ +W V S   +   K DT H           K   L  +   D       
Sbjct: 132 MISCGDDKTVKLWSVDSNDFSNNKKDDTIH-----------KGDGLLKTYYGDHAF---- 176

Query: 236 KRIDKPVVKILQSEPYNTLAFSKHSSN-LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
                                  H +N  F   G  +Q+QL+D  + + PI +++   D+
Sbjct: 177 ------------------FGLDHHRNNSTFVTGG--AQIQLWDANRSK-PISNLTWGADN 215

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           VTS++F   +  IL S  SD  ++++DL
Sbjct: 216 VTSVKFNQTETDILASTGSDNSIVLYDL 243

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 108/258 (41%), Gaps = 40/258 (15%)

Query: 151 SALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCS---------GKNTPVKV 201
           + L  + +F  +N + L    +    LL  S +GS+ + D  S         G+     +
Sbjct: 3   AKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINSL 61

Query: 202 DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSS 261
              +N+  N C        +F + S  S  I   +  D PV  I   +    L+      
Sbjct: 62  RVINNDFENGC--------IFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHD 113

Query: 262 NLFAAA---GTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRV 317
            L       G D+++ +YD+R    P+ + +  HHD +T ++F P    IL SGS+D   
Sbjct: 114 MLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYT 173

Query: 318 LIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVV 374
            I+DL        QED D+ + +++   + H       SC   SP   + ++ +E   + 
Sbjct: 174 NIYDL-------AQEDEDEALHQVINYASIH-------SCGWLSPKRIYTLSHMETFAIH 219

Query: 375 QIWKASKKLTSPYIPRDY 392
           ++   S +LT P  P D+
Sbjct: 220 ELNDKSDELTEPR-PLDF 236

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  S ++ P+   +   + +   K+++    +  S   D+ ++++D R + P  
Sbjct: 192 AQIHLWD--SNRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQ 249

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F  A  D     YD+R     +H    H  +V  ++F+P 
Sbjct: 250 KIIQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPT 309

Query: 304 KDGILCSGSSDRRVLIW 320
            D I+ +GS D+ + I+
Sbjct: 310 GDEIV-TGSYDKTIRIF 325

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 37/147 (25%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           +LSC DD ++ +W V +   + VK D   N                              
Sbjct: 132 MLSCGDDKTVKLWSVNNDDFSNVKSDAELNT----------------------------- 162

Query: 237 RIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
              + ++K    E  +  +   + +S  F   G  +Q+ L+D  + + PI ++S   D++
Sbjct: 163 ---EGLLKTFYGEHAFQGIDHHREAST-FVTGG--AQIHLWDSNRSK-PISNLSWGADNI 215

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
           TS++F  ++  IL S  SD  ++++DL
Sbjct: 216 TSVKFNQNEVDILASTGSDNAIVLYDL 242

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 71/134 (52%), Gaps = 20/134 (14%)

Query: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D+Q+ ++DLRK + P  S+   HHD +TS++F P    +L SGS+D    I+DL    
Sbjct: 123 GVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDL---- 178

Query: 327 AEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKL 383
               QE+ DD + +++   + H       SC   +P   + ++ +E   + ++   S +L
Sbjct: 179 ---SQEEEDDSLHQVINFTSIH-------SCGWVNPKRIYTLSHMETFAIHELNNKSDEL 228

Query: 384 TSPYIPRDY-NIRS 396
           T P  P D+ +IR+
Sbjct: 229 TEPQ-PLDFGDIRA 241

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 84/180 (46%), Gaps = 14/180 (7%)

Query: 162 ENGYGLNFSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S I  G  L+    +G + I+DV   K   ++  + H + V    W+     
Sbjct: 302 ENEY-TSLSWIGAGSHLAVGQGNGLVEIYDVM--KRKCIRTLSGHVDRVACLSWNNH--- 355

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R+  P  + ++S          +   N  A+ G D+ V +Y+  
Sbjct: 356 VLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVIDNKLASGGNDNMVHVYE-G 414

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
             ++PI +   H  +V ++ ++PHK GIL +  G++DRR+ IW+   +    +  D D G
Sbjct: 415 TSKSPILTFDEHKAAVKAMAWSPHKRGILATGGGTADRRLKIWN---VNTSTKLSDIDSG 471

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 74/147 (50%), Gaps = 7/147 (4%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
            ++ S+D ++ +WD+ +GK         H   V +    ++ P+LF SVS+D T+   D 
Sbjct: 155 FITGSNDTTMKVWDLATGKLRTTLA--GHVMTVRDIAISDRHPYLF-SVSEDKTVKCWDL 211

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
             ++ +++            S H + +L A AG DS ++L+D+R    P+ ++ GH   +
Sbjct: 212 EKNQ-IIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDIR-TRVPVITLVGHKGPI 269

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
             ++  P  D  + S S+D  V +WD+
Sbjct: 270 NQVQCTP-VDPQIVSSSTDATVRLWDV 295

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 69/161 (42%), Gaps = 30/161 (18%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++S S D ++ +WDV +GK   +KV T H   V     H K   +  + +DD   I   
Sbjct: 280 QIVSSSTDATVRLWDVVAGK--AMKVLTHHKRSVRATALHPKEFSVASACTDD---IRSW 334

Query: 236 KRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH-HD 293
             ++  ++   +SE    +   S +  ++  A G +  +  YD +         SGH + 
Sbjct: 335 GLVEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGILSFYDYK---------SGHKYQ 385

Query: 294 SVTSLEFAPHKDG---ILCS-----------GSSDRRVLIW 320
           S+ + E     +G   +LCS           G +D+ + IW
Sbjct: 386 SLATKEMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 41/105 (39%), Gaps = 19/105 (18%)

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAG 347
           ++GH   V      P  +    +GS+D  + +WDL                 +L    AG
Sbjct: 135 INGHLGWVRCAAIDPVNNEWFITGSNDTTMKVWDL--------------ATGKLRTTLAG 180

Query: 348 HKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY 392
           H   V D + S   P+L  SV E+  V+ W   K      I RDY
Sbjct: 181 HVMTVRDIAISDRHPYLF-SVSEDKTVKCWDLEKN----QIIRDY 220

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 68/133 (51%), Gaps = 15/133 (11%)

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKIL--QSEPYNTLAFSKHSSNLFAA----AGTDSQVQ 274
           LF S S DS  I  D R    V  +   +S P+ +L  S+H  ++ A     +G D+++ 
Sbjct: 73  LFASASKDSVKIF-DVRTSSCVATLHNDKSAPFLSLD-SRH--DMLACGTELSGVDAELH 128

Query: 275 LYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQED 333
           +YD++K   P+ S +  HHD +T  +F P   G+L SGS+D  V I+DL        +ED
Sbjct: 129 IYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDL----TNSDEED 184

Query: 334 ADDGVPELLMMHA 346
           A   V     +H+
Sbjct: 185 ALHQVINFASVHS 197

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/171 (25%), Positives = 79/171 (46%), Gaps = 16/171 (9%)

Query: 167 LNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVS 226
            +++ +    L+S S D +  +WD+ S      ++  +H++ V + ++  +S  LF S  
Sbjct: 252 FDWNTVDTNLLVSSSIDTTCIVWDLQSPNYVKTQL-IAHDSEVYDVRFLSQSTHLFASCG 310

Query: 227 DDSTLIIHDKR-------IDKPVVK-------ILQSEPYNTLAFSKHSSNLFAAAGTDSQ 272
            D ++ + D R       + +P            Q+     L  S    N+ A    DS+
Sbjct: 311 GDGSVRVFDLRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSK 370

Query: 273 -VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
            + + D+R PE+P  ++ GH   V  +++ P K  +L S S D +VL WDL
Sbjct: 371 DILILDMRNPESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 69/138 (50%), Gaps = 3/138 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WD  S ++ P+   +   + ++  K+++    +  S   D++L+++D R + P  
Sbjct: 193 AKIQLWD--SNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQ 250

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 251 KIVQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT 310

Query: 304 KDGILCSGSSDRRVLIWD 321
            D I+ +GS D+ + I++
Sbjct: 311 GDEIV-TGSYDKTIRIFN 327

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 31/190 (16%)

Query: 112 FEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSV 171
           + HRD V        N N +AT S  G V  ++ S   +      F  H    YGL   +
Sbjct: 64  YGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREE---LCSFKAH----YGLITGL 116

Query: 172 -ISPGEL---------LSCSDDGSIAIWDVCSGKNTPVK-----------VDTSHNNIVN 210
            ++P  L         LSCSDD ++ +W V S     +K           + T +++   
Sbjct: 117 CVTPEHLSKQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAF 176

Query: 211 ECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI-LQSEPYNTLAFSKHSSNLFAAAGT 269
           +   H +S   F  V+  + + + D    KP+  +   ++  +T+ F+++ +++ A+AG+
Sbjct: 177 QGIDHHRSKSNF--VTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGS 234

Query: 270 DSQVQLYDLR 279
           D+ + LYDLR
Sbjct: 235 DNSLVLYDLR 244

>YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}
           CDH1Cell-cycle regulated activator of the
           anaphase-promoting complex/cyclosome (APC/C), which
           directs ubiquitination of cyclins resulting in mitotic
           exit; targets the APC/C to specific substrates including
           Cdc20p, Ase1p, Cin8p and Fin1p
          Length = 566

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 85/180 (47%), Gaps = 14/180 (7%)

Query: 162 ENGYGLNFSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S I  G  L+    +G + I+DV   K   ++  + H + V    W+     
Sbjct: 302 ENEY-TSLSWIGAGSHLAVGQANGLVEIYDVM--KRKCIRTLSGHIDRVACLSWNNH--- 355

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R+  P  + ++S          + + N  A+ G D+ V +Y+  
Sbjct: 356 VLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYE-G 414

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
             ++PI +   H  +V ++ ++PHK G+L +  G++DRR+ IW+   +    +  D D G
Sbjct: 415 TSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWN---VNTSIKMSDIDSG 471

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 90/201 (44%), Gaps = 14/201 (6%)

Query: 163 NGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLF 222
           N + L    +  G L S S  G + +  +   K    KV  +  N ++     E    LF
Sbjct: 13  NNWCLKLQPVHNGILTSVSS-GEVHLLGLDLSKQDSFKVGETSINALSRVDGQEN---LF 68

Query: 223 GSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAF-SKHSSNLFAA--AGTDSQVQLYDLR 279
            + S+ + + + D R +K V  + Q    N L+  S H    + +   G D+ + L+D+R
Sbjct: 69  AA-SNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIR 127

Query: 280 KPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
               P+ S +  H D +TS+ F P    +L SGS+D    ++DL     E ++EDA   V
Sbjct: 128 NWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLL----EPEEEDALHQV 183

Query: 339 PELLMMHA-GHKSPVNDFSCS 358
                +H+ G  +P   F+ S
Sbjct: 184 INYASIHSCGWLAPRRIFTLS 204

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 97/207 (46%), Gaps = 20/207 (9%)

Query: 135 SGSGKVFLYDRSKDSDSAL--TAEFSFHKENGYGLNFSVISPGELLSCSD-DGSIAIWDV 191
           +G+ ++F +D    +  +L   ++ + HK +   L F+      L+S SD +G I IWD+
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 192 CSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE 249
            +   TP+   +  +  N +    W++    +F   S+ S + I D +  K V+ +  + 
Sbjct: 143 NNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTN 202

Query: 250 PYNTLA--FS------KHSSNLFAAAGTDSQVQ-----LYDLRKPEAPIHSMS--GHHDS 294
           P N +   FS      K+S+ +  A   +   +     ++DLR    P+  +S  GH + 
Sbjct: 203 PVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNG 262

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWD 321
           + SL++    + +L S   D  V++W+
Sbjct: 263 ILSLDWCSTDENLLLSSGRDNSVMLWN 289

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 90/180 (50%), Gaps = 20/180 (11%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEK---SPFLFGSVSDDSTLII 233
           LL+   +G I + D  SG++   K+  S  +I N+ K  +    +  L  S S D+  + 
Sbjct: 29  LLTGLSNGEIRLLDWNSGQSLQ-KIKASETSI-NDLKVIDSDFAAGHLVSSASIDAVKVF 86

Query: 234 HDKRIDKPVVKILQ--SEPYNTLAFSKHSSNLFAAA----GTDSQVQLYDLRKPEAPIHS 287
            D R +  V KI    + P+ +L  S+H   L A      G D+ V +YD+R+ +AP+ S
Sbjct: 87  -DIRTNACVAKIHNEANSPFISLD-SRHG--LLACGTELQGIDAAVYIYDIRRWDAPLRS 142

Query: 288 M-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHA 346
           +   HHD VT ++F P    +L SGS+D    I+DL Q     ++EDA   V     +H+
Sbjct: 143 IIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ----DEEEDALHQVINYASIHS 198

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 69/137 (50%), Gaps = 3/137 (2%)

Query: 186 IAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKI 245
           I +WD  S ++ P+   +   + V   K+++    +  S   D++++++D R + P  KI
Sbjct: 194 IELWD--SNRSNPISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQKI 251

Query: 246 LQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKD 305
           +Q+   N+L ++   +  F  A  D     YD+R     ++    H  +V  ++F+P   
Sbjct: 252 VQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPTGQ 311

Query: 306 GILCSGSSDRRVLIWDL 322
            I+ +GS D+ + I+++
Sbjct: 312 EIV-TGSYDKTIRIYNI 327

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 65/136 (47%), Gaps = 3/136 (2%)

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
           +I +WD    K  P+   +   + +   K+++    +  S   D++++++D R + P  K
Sbjct: 194 TIQLWDTARSK--PLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQK 251

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
           I+Q    N + ++   +  F  A  D     YD+R     ++    H  +V  ++FAP  
Sbjct: 252 IVQRLRTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTG 311

Query: 305 DGILCSGSSDRRVLIW 320
           D I+ +GS D+ + I+
Sbjct: 312 DEIV-TGSYDKTIRIF 326

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 74/147 (50%), Gaps = 7/147 (4%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
            ++ S+D ++ +WD+ +GK         H   V +    ++ P+LF SVS+D T+   D 
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLA--GHVMTVRDVAVSDRHPYLF-SVSEDKTVKCWDL 211

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
             ++ +++            S H + +L A AG DS ++L+D+R    P+ ++ GH   +
Sbjct: 212 EKNQ-IIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMR-TRIPVITLVGHKGPI 269

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
             ++  P  D  + S S+D  V +WD+
Sbjct: 270 NQVQCTP-VDPQVVSSSTDATVRLWDV 295

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 68/161 (42%), Gaps = 30/161 (18%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++S S D ++ +WDV +GK   +KV T H   V     H K   +  + +DD   I   
Sbjct: 280 QVVSSSTDATVRLWDVVAGKT--MKVLTHHKRSVRATALHPKEFSVASACTDD---IRSW 334

Query: 236 KRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH-HD 293
              +  ++   +SE    +   S +  ++  A G +  +  YD +         SGH + 
Sbjct: 335 GLAEGSLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYK---------SGHKYQ 385

Query: 294 SVTSLEFAPHKDG---ILCS-----------GSSDRRVLIW 320
           S+ + E     +G   +LCS           G +D+ + IW
Sbjct: 386 SLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 57/159 (35%), Gaps = 28/159 (17%)

Query: 234 HDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
           HD      V KI Q E    L  +++   L          Q  +   P      ++GH  
Sbjct: 90  HDTHASAFVNKIFQPEVAEELIVNRYEKLL---------SQRPEWHAPWKLSRVINGHLG 140

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            V  +   P  +    +GS+D  + +WDL                 +L    AGH   V 
Sbjct: 141 WVRCVAIDPVDNEWFITGSNDTTMKVWDL--------------ATGKLKTTLAGHVMTVR 186

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY 392
           D + S   P+L  SV E+  V+ W   K      I RDY
Sbjct: 187 DVAVSDRHPYLF-SVSEDKTVKCWDLEKN----QIIRDY 220

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 267 AGTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           +G+D+++ +YD+RK ++P+ S+   HHD +T + F P    +L SGS+D    I+DL Q 
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQ- 179

Query: 326 GAEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358
               ++EDA   V     +H+ G  +P   F+ S
Sbjct: 180 ---AEEEDALHQVINFASIHSCGWLAPRRIFTLS 210

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 23/112 (20%)

Query: 184 GSIAIWDVCSG---------KNTP-VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLII 233
           G++ IWD+ S          KN P + +D+ HN +    +       L GS   D+ L I
Sbjct: 80  GAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTE-------LSGS---DAELHI 129

Query: 234 HD-KRIDKPVVKILQS--EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE 282
           +D ++ D P+  ++ S  +    +AF     N+  +  TD    +YDLR+ E
Sbjct: 130 YDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAE 181

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 80/172 (46%), Gaps = 31/172 (18%)

Query: 152 ALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNE 211
           A    F  H +    L+FS      L+S S D +I  WD+ SGK     +D +  + VN 
Sbjct: 543 ACVYTFDAHVDEITALSFS---GDNLISGSQDRTIRQWDLNSGKCVQT-IDINFASRVNS 598

Query: 212 CKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDS 271
                 S       S  STL++ +   ++PV+  LQ   Y+            A    D 
Sbjct: 599 STSGTLS-------SRSSTLLVPN---EQPVIGALQC--YDAA---------LATGTKDG 637

Query: 272 QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGI-LCSGSSDRRVLIWDL 322
            V+L+DLR  +  + ++ GH D++TSL+F    D I L +GS DR + IWDL
Sbjct: 638 LVRLWDLRSGQV-VRTLQGHTDAITSLQF----DSINLITGSIDRSIRIWDL 684

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 14/148 (9%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + + DG + +WD+ SG+   V+    H + +   ++ +    + GS+  D ++ I D 
Sbjct: 630 LATGTKDGLVRLWDLRSGQ--VVRTLQGHTDAITSLQF-DSINLITGSI--DRSIRIWDL 684

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           R            P + L F     +    A  ++ V++YD ++ E       G++D  T
Sbjct: 685 RTGTLADAFAYENPVSHLEFDL---DKIVVANNENTVKIYDRKQDEHWF--CGGNNDGET 739

Query: 297 ----SLEFAPHKDGILCSGSSDRRVLIW 320
               ++EF  +K G +  G+S+  V +W
Sbjct: 740 NDSETVEFVKYKHGYMVEGNSNGDVHVW 767

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 90/208 (43%), Gaps = 20/208 (9%)

Query: 133 TISGS---GKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           TI+G+   G + L+  S D  +++ A+ + H  +   L F+      L+S S+ G I +W
Sbjct: 76  TIAGALDNGIIELFYLSNDQLTSV-AKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVW 134

Query: 190 DVCSGKNT---PVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
           D    K T   P+   T+   +  +    W++    +F S        I D +  K V+ 
Sbjct: 135 DTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKEVIH 194

Query: 245 ILQSEPYNTLA--------FSKHSSNLFAAAGTDS--QVQLYDLRKPEAPIHSM-SGHHD 293
           +  + P   L            +S+ +  A G D+   + ++DLR    P+  +  GH  
Sbjct: 195 LSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHSK 254

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWD 321
            + SL++    + ++ S   D  VL+W+
Sbjct: 255 GIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 240 KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE-APIHSMSGHHDSVTSL 298
           KPV  I     +N L +S + +   A A  +  ++L+ L   +   +  ++ H  SV +L
Sbjct: 54  KPVASISTDTKFNDLDWS-YDNKTIAGALDNGIIELFYLSNDQLTSVAKLTTHTSSVKTL 112

Query: 299 EFAPHKDGILCSGSSDRRVLIWD 321
           +F   ++ +L SGS+   + +WD
Sbjct: 113 KFNSKQENVLVSGSNKGEIFVWD 135

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 88/210 (41%), Gaps = 17/210 (8%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +G+    +V + H+  V  C WH     +  S S D+ + + D
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQE--RVLSGHHWDVKSCDWHPTMGLIV-SGSKDNLIKLWD 235

Query: 236 KRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            R  + +  IL          F     NL A    D   +++D+R+    + S     D 
Sbjct: 236 PRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDY 295

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQ-IGAEQQQEDADDGVPELLMMHAGHKSPVN 353
           + SL + P  + I   G  D  +  +DL Q  G+     D    +P        H   + 
Sbjct: 296 M-SLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD----IP------YAHDKCIT 344

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASKKL 383
             S +P +  ++AS  ++  ++ W  S+ +
Sbjct: 345 SLSYNP-VGHILASASKDRTIRFWTRSRPM 373

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 64/151 (42%), Gaps = 8/151 (5%)

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           G ++S S D  I +WD  SG+     +   H  I  + K+      L   V+ D +  I 
Sbjct: 220 GLIVSGSKDNLIKLWDPRSGQCISTILGFKHTII--KTKFQPTKGNLLAVVAKDKSCKIF 277

Query: 235 DKRIDKPVVKILQSEP-YNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMS---- 289
           D R +   +K  + E  Y +L +   + ++F     D  ++ +DL +     +S      
Sbjct: 278 DIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPY 337

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIW 320
            H   +TSL + P    IL S S DR +  W
Sbjct: 338 AHDKCITSLSYNP-VGHILASASKDRTIRFW 367

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 105/246 (42%), Gaps = 35/246 (14%)

Query: 154 TAEF-----SFHKENGY--GLNFSVISPGELLSCSDDGSIAIWDVCSGK---NTPVKVDT 203
           +AEF     +    NG+   L  S   P  LLS S D ++  W +         PV+   
Sbjct: 3   SAEFLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQ 62

Query: 204 SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKIL-QSEPYNTLAFSKHSSN 262
            HN+IV +C       +   S S D TL + D    +   + +       ++A  + +S 
Sbjct: 63  GHNHIVQDCSLTADGAYAL-SASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKASM 121

Query: 263 LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG-----ILCSGSSDRRV 317
           + + +  D  V+++ +R     + +M GH+D V+ +  AP +D       + S   D+ V
Sbjct: 122 IISGS-RDRTVKVWTIRGQ--CLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMV 178

Query: 318 LIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             W++ Q      Q +AD           GH + VN  + SP+   L+AS  ++  + +W
Sbjct: 179 KAWNVNQF-----QIEAD---------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLW 223

Query: 378 KASKKL 383
             + K+
Sbjct: 224 NLADKV 229

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 73/147 (49%), Gaps = 7/147 (4%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
            ++ S+D ++ +WD+ +GK         H   V +    ++ P+LF SVS+D T+   D 
Sbjct: 155 FVTGSNDTTMKVWDLATGKLKTTLA--GHVMTVRDIAVSDRHPYLF-SVSEDKTVKCWDL 211

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
             +  +++            S H + +L A AG DS V+L+D+R    P+ ++ GH   +
Sbjct: 212 EKNH-IIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVVKLWDIR-TRMPVITLVGHKGPI 269

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDL 322
             ++  P  D  + S S+D  V +WD+
Sbjct: 270 NQVQCTP-VDPQIVSSSTDATVRLWDI 295

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 66/152 (43%), Gaps = 12/152 (7%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++S S D ++ +WD+ +GK   +KV T H   V     H K   L  + +DD   I   
Sbjct: 280 QIVSSSTDATVRLWDIVAGK--AMKVLTHHKRSVRATALHPKEFSLASACTDD---IRSW 334

Query: 236 KRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEA----PIHSMSG 290
              D  ++   +SE    +   S +  ++  A G D  +  YD +            M G
Sbjct: 335 GIADGSLLTNFESEKTGIINTLSINQDDVLFAGGDDGTLSFYDYKSGHKYQSLATREMVG 394

Query: 291 HHDSVTSLEFAPH-KDGI-LCSGSSDRRVLIW 320
             +S  S+  +   K G+ L +G +D+ + IW
Sbjct: 395 SLESERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 49/119 (41%), Gaps = 24/119 (20%)

Query: 279 RKPE--AP---IHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQED 333
           +KPE  AP   +  ++GH   V      P  +    +GS+D  + +WDL           
Sbjct: 121 QKPEWHAPWKLLRVINGHLGWVRCAAIDPVDNEWFVTGSNDTTMKVWDL----------- 169

Query: 334 ADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY 392
                 +L    AGH   V D + S   P+L  SV E+  V+ W   K     +I RDY
Sbjct: 170 ---ATGKLKTTLAGHVMTVRDIAVSDRHPYLF-SVSEDKTVKCWDLEKN----HIIRDY 220

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 6/93 (6%)

Query: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D+ + +YD+RK + P+ S+   HHD VT L++ P+   IL SGS+D    ++DL    
Sbjct: 126 GVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDL---- 181

Query: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358
           +E ++ED+   V     +H+ G  SP   F+ S
Sbjct: 182 SEAEEEDSLHQVINFASIHSCGWLSPRRIFTLS 214

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 109/240 (45%), Gaps = 31/240 (12%)

Query: 159 FHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN-TPVKVDTSHNNIVNECKWHEK 217
           + +EN + L    +    L++   DGS+ + D  + K  + ++  T+  N +        
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFD 69

Query: 218 SPFLFGSVSDDSTLIIHDKRIDKPVVKIL--QSEPYNTLAFSKHSSNLFAAAGT-----D 270
           +  +F + ++D  + + D R    V  +   ++ P+    FS  S +   A GT     D
Sbjct: 70  TGAVFATAAEDG-VKVWDIRARNNVASLQNDKASPF----FSLDSRHNMLACGTELKDYD 124

Query: 271 SQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQ 329
           +++ +YD+R    P+ S +  HHD +T ++F P    +L SGS+D  V I+DL       
Sbjct: 125 AELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL------- 177

Query: 330 QQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKKLTSP 386
            Q+D +D + +++   + H       SC    P   W ++ +E   + ++   S ++  P
Sbjct: 178 TQDDEEDALHQVINFASIH-------SCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEP 230

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 16/87 (18%)

Query: 107 KIVRKF--EHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENG 164
           K VR F   H D++T  ++ P + NL+ + S  G V +YD ++D +     E + H+   
Sbjct: 137 KPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDE-----EDALHQ--- 188

Query: 165 YGLNFSVISPGELLSCSDDGSIAIWDV 191
                 VI+   + SC   G   IW +
Sbjct: 189 ------VINFASIHSCGWLGPKRIWSL 209

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 51/93 (54%), Gaps = 6/93 (6%)

Query: 268 GTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D+ V +YD+RK + P+ S+   HHD VT ++F P    IL SGS+D    I+DL Q  
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-- 180

Query: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358
              ++EDA   V     +H+ G  SP   ++ S
Sbjct: 181 --DEEEDALHQVINYASIHSCGWLSPKRIYTLS 211

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 104/249 (41%), Gaps = 41/249 (16%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYD-----RSKDSDSALTAEFSFHKENGYGLN 168
            +Y+PF  + IA +SG+       GK+ + +     + ++S S +T +  F       L 
Sbjct: 14  VQYSPFFDSKIAVVSGANYGLSGQGKLSILNLTGNRQMQESASVITNDCLFD------LA 67

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           +S I+P ++L    DG++ ++D+ + K   +++   H + V  C W+  +   F S S D
Sbjct: 68  WSEINPTQVLVAQGDGTLTLFDL-TNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWD 126

Query: 229 STLIIHDKRIDKPVV-----------------KILQSEPYNT-----LAFSKHSSNLFAA 266
             + I D    + V+                 K LQ    N        FS H  N+   
Sbjct: 127 GKVKIWDCARSESVLTLRNNRSLGHTGEHIETKALQRNSKNKDCIYQALFSPHDPNMAMC 186

Query: 267 AGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
              +S +  +DLR+P      ++       S ++  ++  I+ S   D+ + IWDL  I 
Sbjct: 187 CSGNSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIK 246

Query: 327 AEQQQEDAD 335
            +     AD
Sbjct: 247 NKPHNMFAD 255

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 6/105 (5%)

Query: 110 RKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLN 168
           R  +++D + +A ++P +PN+    SG+  +  +D R  +  +++ A            +
Sbjct: 163 RNSKNKDCIYQALFSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSILAHSGLET---LSCD 219

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTP--VKVDTSHNNIVNE 211
           ++      + S   D +I IWD+   KN P  +  D S  N  NE
Sbjct: 220 YNKYRSYIVASAGVDKAIRIWDLRMIKNKPHNMFADISSYNCTNE 264

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WDV   K  PV   +   + +   K+++    +  S   D++++++D R + P  
Sbjct: 199 AKIHLWDVNRLK--PVSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 257 KIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPT 316

Query: 304 KDGILCSGSSDRRVLIW 320
            D I+ +GS D+ + I+
Sbjct: 317 GDEIV-TGSYDKSIRIY 332

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 84/188 (44%), Gaps = 29/188 (15%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC----KWH 215
           H++  Y +  +  S  +L + S DG I  W++ S +   V     +  I   C    ++H
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNM-STREEFVSFKAHYGLITGLCVTQPRFH 124

Query: 216 EKSPFL-----FGSVSDDSTLIIHDKRID----------------KPVVKILQSEPYNTL 254
           +K P L       S SDD T+ +    +D                + +V+    E     
Sbjct: 125 DKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQG 184

Query: 255 AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSD 314
             S   ++ FA  G  +++ L+D+ + + P+ ++S   D++TS++F   +  IL S  SD
Sbjct: 185 IDSHRENSTFATGG--AKIHLWDVNRLK-PVSNLSWGADNITSVKFNQSETDILASTGSD 241

Query: 315 RRVLIWDL 322
             ++++DL
Sbjct: 242 NSIVLYDL 249

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 69/146 (47%), Gaps = 27/146 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L+S S D +I  WD+ SGK     +D S  N+ +     + S          STL+   +
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCMQA-IDLSFANVSSTATNVDLSK---------STLLT--Q 562

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           R ++P +  LQS       F        A    D  V+L+DLR  +  I ++ GH D++T
Sbjct: 563 RSERPSIGALQS-------FDAA----LATGTKDGVVRLWDLRSGKV-IRTLEGHTDAIT 610

Query: 297 SLEFAPHKDGILCSGSSDRRVLIWDL 322
           SL+F       L +GS DR V +WDL
Sbjct: 611 SLKF---DSACLVTGSYDRTVRVWDL 633

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 70/147 (47%), Gaps = 3/147 (2%)

Query: 178 LSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
           L  +    I +WD  + ++TP+   +   + +   K+++    +  S   D++++++D R
Sbjct: 193 LFVTGGAKIELWD--NNRSTPLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLR 250

Query: 238 IDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
            + P  KI+QS   N + ++      F  A  D     YD+R     ++    H  +V  
Sbjct: 251 TNSPTQKIVQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMD 310

Query: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQ 324
           ++F+P  D I+ +GS D+ + I+   Q
Sbjct: 311 VDFSPTGDEIV-TGSYDKTIRIFKTNQ 336

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 82/219 (37%), Gaps = 45/219 (20%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVIS 173
           HRD V        N N +AT SG G +  ++ S   +       SF    G      V  
Sbjct: 66  HRDGVYVVAKNYHNLNKLATASGDGVIKYWNMSTREEYV-----SFKGHYGLVTGLCVTP 120

Query: 174 PG----------ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
            G           +LSC DD +I +W + +     +K D       N       S  L  
Sbjct: 121 EGLSVGGLSNQNHMLSCGDDKTIKLWSINNDDFANIKSDEELITKTN------GSGALLK 174

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEA 283
           +   +      D   +KP                     LF   G  ++++L+D  +   
Sbjct: 175 TFYGEHAFQGIDHHREKP---------------------LFVTGG--AKIELWDNNRS-T 210

Query: 284 PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           P+ ++S   D++TSL+F   +  I+ S  SD  V+++DL
Sbjct: 211 PLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDL 249

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 9/146 (6%)

Query: 179 SCSDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
           + S+D +I IWD+ +GK   +K+  S H   V +    ++ P++F S S+D  +   D  
Sbjct: 147 TGSNDTTIKIWDLATGK---LKLTLSGHIMTVKDICISKRHPYMF-SASEDKLVKCWDLE 202

Query: 238 IDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
            ++ V++              H + NL A AG DS V+L+D+R  + P+ +M+GH   + 
Sbjct: 203 KNR-VIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIR-TKLPVMTMAGHKSPIN 260

Query: 297 SLEFAPHKDGILCSGSSDRRVLIWDL 322
            ++  P  D  + S S+D  V +WD+
Sbjct: 261 RVKCLP-VDPQVVSCSADATVRLWDI 285

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 71/159 (44%), Gaps = 23/159 (14%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNT---LAFSKHSSNLFAAAGTDSQVQLYDL 278
           F + S+D+T+ I D    K  +K+  S    T   +  SK    +F+A+  D  V+ +DL
Sbjct: 145 FATGSNDTTIKIWDLATGK--LKLTLSGHIMTVKDICISKRHPYMFSAS-EDKLVKCWDL 201

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
            K    I    GH   V +++  P  + I  +G  D  V +WD+               +
Sbjct: 202 EKNRV-IRDYHGHLSGVHTVDIHPTLNLIATAGR-DSVVRLWDI------------RTKL 247

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
           P + M  AGHKSP+N   C P  P  + S   +  V++W
Sbjct: 248 PVMTM--AGHKSPINRVKCLPVDP-QVVSCSADATVRLW 283

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 129 NLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIA 187
           NLIAT      V L+D R+K          + HK     +    + P +++SCS D ++ 
Sbjct: 227 NLIATAGRDSVVRLWDIRTK----LPVMTMAGHKSPINRVKCLPVDP-QVVSCSADATVR 281

Query: 188 IWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           +WD+ +GK   +KV T H   V +   H     +  + +DD
Sbjct: 282 LWDITAGKT--LKVLTHHKRSVRDIGIHPGEFSISSACTDD 320

>Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 81/173 (46%), Gaps = 13/173 (7%)

Query: 169 FSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSD 227
            S I  G  L+    +G + I+DV   K   ++  + H + V    W+     +  S S 
Sbjct: 308 LSWIGAGSHLAVGQGNGLVEIYDVI--KRKCIRTLSGHVDRVACLSWNN---HVLTSGSR 362

Query: 228 DSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLRKPEAPIH 286
           D  ++  D R+  P  + ++S          + + N  A+ G D+ V +Y+    ++PI 
Sbjct: 363 DHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNMVNVYE-GTSKSPIL 421

Query: 287 SMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
           +   H  +V ++ ++PHK GIL +  G++DR++ IW+   +    +  D D G
Sbjct: 422 TFDEHKAAVKAMAWSPHKRGILATGGGTADRKLKIWN---VNTSTKISDIDSG 471

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 73/158 (46%), Gaps = 12/158 (7%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G + I+DV   K   ++  + H + V+   W+     +  S S D  ++  D RI  P 
Sbjct: 346 NGLMEIYDVV--KKKCIRTLSGHTDRVSCLSWNNN---ILSSGSRDRRILHRDVRIADPF 400

Query: 243 VKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
              +++          +   N  A+ G D+ V +YD      P  +   H  +V ++ ++
Sbjct: 401 FAQIETHTQEVCGLKWNVEENKLASGGNDNIVCVYD-GTSVTPTLTFREHTAAVKAIGWS 459

Query: 302 PHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
           PHK GIL +  G++DRR+ IW+   +    +  DAD G
Sbjct: 460 PHKRGILATGGGTADRRLKIWN---VNTAMKLNDADTG 494

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 77/166 (46%), Gaps = 29/166 (17%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHE 216
           F  H +    L+F       L+S S D  I  WD+ +GK    ++D       N+ K   
Sbjct: 422 FELHSDEITALSFD---SEALISGSKDRKILHWDLVTGKCVQ-QLDLIVTPTYNDTKVSA 477

Query: 217 KSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLY 276
           +S       +++ST ++     + P++  LQ   YN+           A+   D  V+L+
Sbjct: 478 RS-------ANNSTSVLGS---EAPMIGALQC--YNSA---------LASGTKDGVVRLW 516

Query: 277 DLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           DLR  + P+ ++ GH D +TSL+F   K   L +GS D  V IWDL
Sbjct: 517 DLRIGK-PVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 558

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L S + DG + +WD+  GK  PV+    H + +   K+ +    + GS+  D+++ I D 
Sbjct: 504 LASGTKDGVVRLWDLRIGK--PVRALEGHTDGITSLKF-DSEKLVTGSM--DNSVRIWDL 558

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE-----APIHSMSGH 291
           R    +  I    P  +L F      L      ++ V ++++ + E      P +S+ G 
Sbjct: 559 RTSSIIDVIAYDLPITSLDFD---DKLITVGANETGVNVFNMERDEHWMTPEPPNSLKGD 615

Query: 292 HDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
             S   +    +KDG L +G ++  + +W +
Sbjct: 616 EAS-ERIAIVKYKDGFLINGHNNGDINVWSI 645

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
             I +WDV   K  PV   +   + +   K+++    +  S   D++++++D R + P  
Sbjct: 199 AKIHLWDVNRLK--PVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQ 256

Query: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303
           KI+Q+   N + ++   +  F  A  D     YD+R     ++    H  +V  ++F+P 
Sbjct: 257 KIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPT 316

Query: 304 KDGILCSGSSDRRVLIW 320
            D I+ +GS D+ + I+
Sbjct: 317 GDEIV-TGSYDKSIRIY 332

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 84/188 (44%), Gaps = 29/188 (15%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC----KWH 215
           H++  Y +  +  S  +L + S DG I  W++ S +   V     +  +   C    ++H
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNM-STREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 216 EKSPFL-----FGSVSDDSTLIIHDKRID----------------KPVVKILQSEPYNTL 254
           +K P L       S SDD T+ +    +D                + +++    E     
Sbjct: 125 DKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQG 184

Query: 255 AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSD 314
             S   ++ FA  G  +++ L+D+ + + P+  +S   D++TSL+F  ++  IL S  SD
Sbjct: 185 IDSHRENSTFATGG--AKIHLWDVNRLK-PVSDLSWGADNITSLKFNQNETDILASTGSD 241

Query: 315 RRVLIWDL 322
             ++++DL
Sbjct: 242 NSIVLYDL 249

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 94/218 (43%), Gaps = 21/218 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + +SCSDD  + IW+  +GK    +V + H+  V  C WH +   +  S S D+ + + D
Sbjct: 177 KFVSCSDDNILKIWNFSNGKLE--RVLSGHHWDVKSCDWHPEMGLII-SASKDNLIKLWD 233

Query: 236 KRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            R    V  IL+       + F     N+ AA   D   +++D+R     +  +    D 
Sbjct: 234 PRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELLCVRDEVDY 293

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVND 354
           +T L + P  + +   G+ D  +  +DL Q          D   P  ++ +A H   V  
Sbjct: 294 MT-LLWNPINESMFTVGNYDGSIKHFDLLQ----------DLTKPTHVIPYA-HDKCVTS 341

Query: 355 FSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDY 392
            S +P +  ++AS  ++  V+ W  +    SP  P  Y
Sbjct: 342 LSYNP-MGNILASASKDRTVRFWTRA----SPIDPNAY 374

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/275 (19%), Positives = 111/275 (40%), Gaps = 53/275 (19%)

Query: 103 QSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYD-RSKDSDSALTAEFSFHK 161
           Q ++   + F  +D +    +   + N +    G G + L+D +  D   A+  E   H+
Sbjct: 48  QGRMLETKSFVTQDGLFDVAWNELHENHVLVAQGDGSLRLFDIQLNDYPVAIFQE---HE 104

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIW--------------------DVCSGKNTPVKV 201
           +  +  N+++I+    +S S DG++ +W                       S K+ P+  
Sbjct: 105 KEVFSCNWNLINKQLFVSSSWDGTVKVWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSN 164

Query: 202 DTSHN------NIVNECKWHEKSPFLFGSVSDDSTLIIHDKR--IDKPVVKILQSEPYNT 253
              H       N + + ++    P +  S + +S + + D R   +      +      T
Sbjct: 165 QKRHTSLSKNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMET 224

Query: 254 LA--FSKHSSNLFAAAGTDSQVQLYDLR---------KPEAPIHSMSGHHDSVTSLEFAP 302
           L   F+K+ S++ A  G D+ V+++DLR         +    ++ + GH  ++  + ++P
Sbjct: 225 LTCDFNKYRSHIIATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSP 284

Query: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
           H   +L S S D    +W          Q+ +DDG
Sbjct: 285 HHSNMLLSTSYDMTCRVW----------QDLSDDG 309

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 83/180 (46%), Gaps = 14/180 (7%)

Query: 162 ENGY-GLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  LN+ V S   L     +G + I+DV   K   ++    H++ V    W+    +
Sbjct: 303 ENEYTSLNW-VGSGSHLAVGQSNGIVEIFDV--NKKKCIRTMLGHSDRVACLSWNS---Y 356

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R   P  + ++S          +   N   + G D+ V +YD R
Sbjct: 357 ILTSGSRDHNILHRDVRSPDPFFEKIESHSQEVCGLKWNVDENKLVSGGNDNIVNVYD-R 415

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
               P  +M+ H  +V +L+++ HK GIL +  G++DR + IW++  +    +  D D G
Sbjct: 416 TSTKPFMTMTEHKAAVKALDWSSHKRGILATGGGTADRHLKIWNVNNM---TKLNDVDTG 472

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 97/225 (43%), Gaps = 14/225 (6%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H +   G++FS  +  + ++CSDD  + IW+  +G+       T H+  V  C WH  + 
Sbjct: 166 HTQCIRGISFSG-TDSKFVTCSDDNILKIWNFSNGQQESTL--TGHHWDVRSCDWHP-TM 221

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDL 278
            L  S S D+ + + D R  + +  IL  +    +  F     N+ A    D   +++D+
Sbjct: 222 GLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDI 281

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
           R+    +       D + SL + P  + I   G  D  +  +DL      Q+ +D+  G 
Sbjct: 282 RQNMKELAVYRDESDYM-SLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSGC 335

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
                +   H   +   + +P +  ++AS  ++  ++ W  S+ L
Sbjct: 336 --FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPL 377

>Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429W
           (REAL)
          Length = 642

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 77/190 (40%), Gaps = 26/190 (13%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN--------------TPVKVD 202
           F  H       +F   +   + S SDD  I IWDV                    PVK  
Sbjct: 77  FRGHTAQVLDTDFDPFNDRRIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFL 136

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
           T H   V    +H  +  +  S S D T+ + D    K V+ +   +   +++FS +  N
Sbjct: 137 TGHARKVGHVLYHPVAKNVLASSSGDYTVKLWDVETGKDVITLKHPDMVTSMSFS-YDGN 195

Query: 263 LFAAAGTDSQVQLYDLRK----PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGS---SDR 315
             A    D +++++++R      E P HS + +   V    +  + D +  +G    SDR
Sbjct: 196 HLATVARDKKLRVWNIRDEKIVSEGPAHSGAKNQRVV----WLGNSDRLATTGFSKLSDR 251

Query: 316 RVLIWDLFQI 325
           ++ IWD F +
Sbjct: 252 QIGIWDAFNL 261

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 18/124 (14%)

Query: 267 AGTDSQVQLYDLRKPEAPIHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           +G D+++ +YD+R  + P+  +   HHD VT ++F P    +L SGS+D    ++DL Q+
Sbjct: 124 SGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQV 183

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSC---SPNIPWLMASVEEENVVQIWKASKK 382
               ++EDA   V     +H          SC   SP   + ++ +E   + ++   S +
Sbjct: 184 ----EEEDALHQVINYESVH----------SCGWLSPKRIYTLSHMETFAIHELNNKSDE 229

Query: 383 LTSP 386
           LT P
Sbjct: 230 LTEP 233

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 45/198 (22%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P+ I + S   K  +++ +K S +A+      H      +NF+   P  L +CS D 
Sbjct: 80  PAKPHWIVSTSNQ-KAIIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDT 138

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S  + P    +S  +  ++ KW+ K          DS               
Sbjct: 139 YVHAWDMRS-PHRPFYTTSSWRSSASQVKWNFK----------DS--------------- 172

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N LA S H +++F          ++DLR    P+H ++GH+  V S++F+  +
Sbjct: 173 -------NILA-SSHGNDVF----------IWDLRHGSTPLHKLTGHNSGVNSIDFSRFE 214

Query: 305 DGILCSGSSDRRVLIWDL 322
           +  + S S+D  V  WDL
Sbjct: 215 ENKIMSSSNDGTVKFWDL 232

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 83/207 (40%), Gaps = 45/207 (21%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P  I + S   K  +++ +K S +A+      H      +NF+   P  L +CS D 
Sbjct: 78  PAKPYWIVSTSNQ-KAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDT 136

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S  + P    +S  +  ++ KW+ K P                         
Sbjct: 137 YVHAWDMRS-PHRPFYSTSSWRSAASQVKWNYKDP------------------------- 170

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N LA S H +++F          ++DLRK   P+ S+ GH  SV S++F   K
Sbjct: 171 -------NVLA-SSHGNDVF----------VWDLRKGSTPLCSLKGHVSSVNSIDFNRFK 212

Query: 305 DGILCSGSSDRRVLIWDLFQIGAEQQQ 331
              L S S+D  V  WD  +   E ++
Sbjct: 213 STELMSSSNDGTVKFWDYSKSTTESKR 239

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query: 267 AGTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           +G D+++ +YD+R  + PI S +  HHD +T ++F P+   +L SGS+D    I+DL   
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL--- 177

Query: 326 GAEQQQEDA 334
             E ++ED+
Sbjct: 178 -TETEEEDS 185

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 14/180 (7%)

Query: 162 ENGYGLNFSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S +  G  L+    +G + I+DV   K   ++  + H + V    W+    +
Sbjct: 296 ENEY-TSLSWVGAGSHLAVGQGNGLVEIYDVV--KKKCIRTLSGHMDRVACLSWNN---Y 349

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D RI     + +++          +   N  A+ G D+ + +YD  
Sbjct: 350 VLTSGSRDRRILHRDVRIPDSYFERIEAHTQEVCGLKWNVDDNKLASGGNDNMLFVYD-S 408

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
               P+ + + H  +V ++ ++PHK G+L S  G++DRR+ +W+   +   Q+  D D G
Sbjct: 409 TARNPVLTFNEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKVWN---VNTSQKISDVDTG 465

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 76/158 (48%), Gaps = 12/158 (7%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G + I+DV   K   ++  + H + V    W+     +  S S D T++  D R+  P 
Sbjct: 397 NGIVEIYDVT--KEKCIRTLSGHLDRVACLSWNN---HILSSGSRDRTILHRDVRMADPF 451

Query: 243 VKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
            + +++          +++ N  A+ G D+ V +YD      P  S++ H  +V ++ ++
Sbjct: 452 FEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYD-GTSRTPFLSINEHKAAVKAMAWS 510

Query: 302 PHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
           PHK GIL +  G++DR + +W+   +    +  D D G
Sbjct: 511 PHKQGILATGGGTADRTLKMWN---VNTSVKLNDVDTG 545

>TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON}
           Anc_7.338 YLR208W
          Length = 295

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 71/163 (43%), Gaps = 19/163 (11%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVSDDSTLII- 233
           L SCS DG + IW   +GK + + V ++H   VN  KW  HE    L    SD    II 
Sbjct: 70  LASCSYDGKVLIWKEENGKWSQIAVHSTHTASVNSVKWAPHEYGALLLAGSSDGKVSIIE 129

Query: 234 -HDKRIDKPVVKILQSEPYNTLAFS-----KHSSNL-----FAAAGTDSQVQLYDLR--- 279
             +     P+V    S   N++ ++     + + +L     F   G D+ V+++      
Sbjct: 130 FEENGSLTPIVIDAHSIGVNSVCWAPAVVEEQNKSLKQLRRFVTGGADNLVKVWKYESNS 189

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPH--KDGILCSGSSDRRVLIW 320
           K  +   S+ GH D V  + ++P       + S S DR  +IW
Sbjct: 190 KTYSLEESLEGHSDWVRDVAWSPSLLSQSYIASVSQDRTCVIW 232

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 86/221 (38%), Gaps = 30/221 (13%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW-HEKSPFLFGSVSDDSTLII- 233
            L +CS D +I I+D+  G    V     H   V   +W H K      S S D  ++I 
Sbjct: 23  RLATCSSDKTIKIFDIEGGNQRLVDTLFGHEGPVWRVEWAHPKFGNTLASCSYDGKVLIW 82

Query: 234 --HDKRIDKPVVKILQSEPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLRKPEA--PIHSM 288
              + +  +  V    +   N++ ++ H    L  A  +D +V + +  +  +  PI  +
Sbjct: 83  KEENGKWSQIAVHSTHTASVNSVKWAPHEYGALLLAGSSDGKVSIIEFEENGSLTPI-VI 141

Query: 289 SGHHDSVTSLEFAP----------HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
             H   V S+ +AP           +     +G +D  V +W          + +++   
Sbjct: 142 DAHSIGVNSVCWAPAVVEEQNKSLKQLRRFVTGGADNLVKVW----------KYESNSKT 191

Query: 339 PELLMMHAGHKSPVNDFSCSPNI--PWLMASVEEENVVQIW 377
             L     GH   V D + SP++     +ASV ++    IW
Sbjct: 192 YSLEESLEGHSDWVRDVAWSPSLLSQSYIASVSQDRTCVIW 232

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 88/212 (41%), Gaps = 22/212 (10%)

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
           +I +WD   G  T +     H+  V    +H   P +F S  DD+T+ I     +K +  
Sbjct: 34  TIQLWDYRMG--TLLHRFEGHDGPVRGIDFHPTQP-IFASTGDDATIRIWSLDTNKCLYT 90

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                 Y    F  H      +A  D  +++++ +     I  ++GH+  V   +F P +
Sbjct: 91  FTGHLDYVRTVFFHHELPWLISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTE 149

Query: 305 DGILCSGSSDRRVLIWDLF----------------QIGAEQQQEDADDGVPELLMMHAGH 348
           D ++ S S D  V +WD+                 Q+ A+Q   D   G   +  +  GH
Sbjct: 150 D-LVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMIAQQNLLDGGFGDCVVKFILEGH 208

Query: 349 KSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
              VN  S  P +P L+ S  ++  V++W+ S
Sbjct: 209 TRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 60/127 (47%), Gaps = 10/127 (7%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S  DD  + +W + S K   +     H N V+   +H +   +  
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHPQQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPV-VKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDL--R 279
           S  +D TL + D  +DK V VK  + E       + H + NLF AA  DS + ++ L   
Sbjct: 270 SAGEDKTLRVWD--LDKRVPVKQFKRENDRFWLVAAHPTINLFGAAH-DSGIMIFKLDRE 326

Query: 280 KPEAPIH 286
           +P + IH
Sbjct: 327 RPCSVIH 333

>KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly
           similar to uniprot|Q04491 Saccharomyces cerevisiae
           YLR208W SEC13 Component of both the Nup84 nuclear pore
           sub-complex and of the COPII complex (Sar1p Sec13p
           Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p) which is
           important for the formation of ER to Golgi transport
           vesicles
          Length = 294

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 72/171 (42%), Gaps = 24/171 (14%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L S S DG + IW   +G+ + + V   H+  VN  KW  HE  P L  + S
Sbjct: 66  FGVI----LASSSYDGKVLIWREENGRWSQIAVHAVHSASVNSVKWAPHEYGPLLLAASS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAFSK---------HSSNLFAAAGTDSQVQL 275
           D    ++  K      P++    +   NT +++               F   G D+ V++
Sbjct: 122 DGKVSVVEFKENGTTAPILIDAHAIGVNTASWASAALQDGAAPQQMRRFVTGGADNLVKV 181

Query: 276 YDLRKPEAPIH----SMSGHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
           +    P+A  +    ++ GH D V  + ++P       L S S DR  +IW
Sbjct: 182 WKF-NPDANTYLLEDTLEGHSDWVRDVAWSPSVLLRSYLASVSQDRTCIIW 231

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 14/99 (14%)

Query: 264 FAAAGTDSQVQLYDLR-KPEAPIHSMSGHHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWD 321
            A   +D  ++++++  +    + ++ GH   V  +++A  K G IL S S D +VLIW 
Sbjct: 24  LATCSSDKSIKIFEVEGETHRLVETLYGHEGPVWQVDWAHPKFGVILASSSYDGKVLIW- 82

Query: 322 LFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPN 360
                        ++G    + +HA H + VN    +P+
Sbjct: 83  -----------REENGRWSQIAVHAVHSASVNSVKWAPH 110

>TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON}
           Anc_4.309 YLR429W
          Length = 595

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 85/192 (44%), Gaps = 26/192 (13%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV-----------CSG------KN-TP 198
           F  H       +F   +   + S SDDG + IW++            SG      KN TP
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASASDDGKVGIWEIPKRYSFGRYRSISGGGFKLSKNITP 136

Query: 199 VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSK 258
           +K+   H+  V    +H  +  +  S S D+++ I      + ++ +L  +   ++ FS 
Sbjct: 137 LKMLVGHSKRVGHVLYHPLAKDVLASSSFDNSIKIWRVDTGEDLITLLHPDLVTSMCFSF 196

Query: 259 HSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA--PHKDGILCSGSS--- 313
             S L   A  D  ++++D+R  +   HS+   H+SV     A     + ++ +G S   
Sbjct: 197 DGSYLVTVA-RDRMIRIWDIRAQKIISHSLG--HESVKKQRVAWLGESNRLVTTGFSLIG 253

Query: 314 DRRVLIWDLFQI 325
           DR+V IWD FQ+
Sbjct: 254 DRQVAIWDGFQL 265

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 6/96 (6%)

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL------LM 343
           GH   V   +F P  D  + S S D +V IW++ +  +  +      G  +L      L 
Sbjct: 79  GHTAQVLDTDFDPFNDHRIASASDDGKVGIWEIPKRYSFGRYRSISGGGFKLSKNITPLK 138

Query: 344 MHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           M  GH   V      P    ++AS   +N ++IW+ 
Sbjct: 139 MLVGHSKRVGHVLYHPLAKDVLASSSFDNSIKIWRV 174

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 73/158 (46%), Gaps = 12/158 (7%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G + I+DV   K   ++    H +  +   W+     +  S S D T++  D R+ +P 
Sbjct: 328 NGIVEIYDVV--KRKCIRTLPGHVDRTSCLSWNNH---ILSSGSRDHTILHRDVRMAEPF 382

Query: 243 VKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
            + +++          +   N  A+ G D+ V +YD     +P+  ++ H  +V ++ ++
Sbjct: 383 FERIKTHSQEVCGLKWNVDENKLASGGNDNMVYVYD-GTSSSPVFKITEHKAAVKAMAWS 441

Query: 302 PHKDGILCSGSS--DRRVLIWDLFQIGAEQQQEDADDG 337
           PHK G L +G    DR++ IW+   I    +  D D G
Sbjct: 442 PHKRGTLATGGGTVDRKLKIWN---INTSTKTSDIDTG 476

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 110/263 (41%), Gaps = 58/263 (22%)

Query: 118 VTRARYAPFNPNLIATISGSGKVF-LYDRSKDSDSALTAEFS---FHKENGYGL------ 167
           V+R ++ P +   +AT S S +++ L D+ K+  +    ++        NG+ L      
Sbjct: 110 VSRIQWMPMSSEKLATCSDSLRIWSLGDQLKEQVNLSLVKYGKGVGDVANGHTLGKLPPV 169

Query: 168 ---NFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGS 224
              +++ I    +LS S D +  +WD+ +      ++  +H++ V + K+  +S  LF S
Sbjct: 170 TSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQL-IAHDSEVFDAKFLTQSSNLFAS 228

Query: 225 VSDDSTLIIHDKR-------IDKPVVKI-------------------------------- 245
              D ++ + D R       I +P  +I                                
Sbjct: 229 CGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAETSL 288

Query: 246 ----LQSEPYNTLAFSKHSSNLFAAAGTDSQVQL-YDLRKPEAPIHSMSGHHDSVTSLEF 300
               L+S+    L  S    N+ A    DS V +  D+R P +PI +++GH+ ++  L +
Sbjct: 289 AVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQLRW 348

Query: 301 APHKDGILCSGSSDRRVLIWDLF 323
            P K  +L +   D ++L WDL 
Sbjct: 349 HPSKPNVLATCGDDCQILYWDLL 371

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 83  SDVKCSAPSTDDS-KESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATIS-GSGKV 140
           S ++ SA   DD      +Q  ++  +         + R   +PF+PN++ATI   S  V
Sbjct: 262 SQIQLSAQGHDDGHARKNNQNAAETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVV 321

Query: 141 FLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN 196
            + D        LT    +   N   L +    P  L +C DD  I  WD+    N
Sbjct: 322 IILDMRYPGSPILTLNGHYCALNQ--LRWHPSKPNVLATCGDDCQILYWDLLDSLN 375

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 26/190 (13%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN--------------TPVKVD 202
           F  H       +F      +L S +DD  IAIW++                    PVK+ 
Sbjct: 77  FRGHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKIL 136

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
           + H   V    +H  +  +  S S D T+ I D   +K ++ +   +   +++FS ++ N
Sbjct: 137 SGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDIENEKDMLTLTHPDMVTSMSFS-YNGN 195

Query: 263 LFAAAGTDSQVQLYDLRK----PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGS---SDR 315
             A    D +++++D+R+     E P H+ + +   V    +  + D +  +G    SDR
Sbjct: 196 FLATVARDKKLRVWDVREGKIVSEGPAHTGAKNQRVV----WLGNSDRLATTGFSRLSDR 251

Query: 316 RVLIWDLFQI 325
           ++ +WD F +
Sbjct: 252 QLGVWDAFNL 261

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 4/91 (4%)

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELL---MMHA 346
           GH   V   +F P  D  L S + D ++ IW++ +    +   D +DG P+++    + +
Sbjct: 79  GHTAQVLDTDFDPFDDKKLASSADDSKIAIWEIPEDYTLKSYVD-EDGEPKVIKPVKILS 137

Query: 347 GHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
           GHK  V      P    ++AS   +  V+IW
Sbjct: 138 GHKRKVGHILYHPVAQNVLASSSLDYTVKIW 168

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 16/94 (17%)

Query: 284 PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLM 343
           P+  +SGH   V  + + P    +L S S D  V IWD+      + ++D         M
Sbjct: 132 PVKILSGHKRKVGHILYHPVAQNVLASSSLDYTVKIWDI------ENEKD---------M 176

Query: 344 MHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
           +   H   V   S S N  +L A+V  +  +++W
Sbjct: 177 LTLTHPDMVTSMSFSYNGNFL-ATVARDKKLRVW 209

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 90/208 (43%), Gaps = 19/208 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +GK    +V + H+  V  C WH +   L  S S D+ + + D
Sbjct: 193 KFVTCSDDNILKIWNFSNGKQE--RVLSGHHWDVKSCDWHPEMG-LIASASKDNLVKLWD 249

Query: 236 KRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            R    +  IL+ + +  L   F     NL  A   D   +++D+R     +  +    D
Sbjct: 250 PRSGNCISSILKFK-HTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETD 308

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            +T LE+ P  + +      D  +  +DL Q          D   P L + +A H   + 
Sbjct: 309 YMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLNEPILTIPYA-HDKCIT 356

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASK 381
             S +P +  + A+  ++  ++ W  ++
Sbjct: 357 SLSYNP-VGHIFATAAKDRTIRFWTRAR 383

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 82/182 (45%), Gaps = 28/182 (15%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           F + S+D+T+ I D    K  + ++        +A SK    +F+A+  D  V+ +DL +
Sbjct: 138 FATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSAS-EDKLVKCWDLER 196

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
             A I    GH   V +++  P  D I+ +   D  V +WD+       + E        
Sbjct: 197 NTA-IRDFHGHLSGVHTVDVHPSLD-IIATAGRDAVVRLWDI-----RSRSE-------- 241

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW-----KASKKLTSPYIPRDYNIR 395
            +M+  GHKSP+N   C P  P ++ S   +  V++W     KASK LT        NIR
Sbjct: 242 -IMVLPGHKSPINKVKCLPVDPQII-SCSGDATVRLWDIIAGKASKVLTH----HSRNIR 295

Query: 396 SL 397
            L
Sbjct: 296 DL 297

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 9/145 (6%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK 240
           S+D +I IWD+ +GK     +   H   V +    ++ P++F S S+D  +   D   + 
Sbjct: 142 SNDTTIKIWDLAAGKLKITLI--GHVMSVRDIAISKRHPYMF-SASEDKLVKCWDLERNT 198

Query: 241 PVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLE 299
             ++              H S ++ A AG D+ V+L+D+R   + I  + GH   +  ++
Sbjct: 199 -AIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRS-RSEIMVLPGHKSPINKVK 256

Query: 300 FAPHKDGIL-CSGSSDRRVLIWDLF 323
             P    I+ CSG  D  V +WD+ 
Sbjct: 257 CLPVDPQIISCSG--DATVRLWDII 279

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 90/209 (43%), Gaps = 36/209 (17%)

Query: 129 NLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIA 187
           ++IAT      V L+D RS+     L      HK     +    + P +++SCS D ++ 
Sbjct: 220 DIIATAGRDAVVRLWDIRSRSEIMVLPG----HKSPINKVKCLPVDP-QIISCSGDATVR 274

Query: 188 IWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ 247
           +WD+ +GK +  KV T H+  + +   H  + F F SVS +   +   K  +  ++   Q
Sbjct: 275 LWDIIAGKAS--KVLTHHSRNIRDLTLHP-AEFSFASVSTND--VRSWKLPEGQLLTNFQ 329

Query: 248 SEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGH-HDSVTSLEFA---P 302
           S+    L   S +  N+  A G D  +  YD +         +GH + S+ + E A    
Sbjct: 330 SQNTGILNTVSINHDNVLLAGGDDGTLCFYDYK---------TGHKYQSMMTTEVAGSLE 380

Query: 303 HKDGILCS-----------GSSDRRVLIW 320
            +  ILCS           G  D+ + IW
Sbjct: 381 SERSILCSTFDVTGTRLITGEGDKSIKIW 409

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 81/177 (45%), Gaps = 4/177 (2%)

Query: 145 RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS-IAIWDVCSGKNTPVKVDT 203
           RS D+DS    E      +G      + S  E  + +  G+ I +WDV   K  P+   +
Sbjct: 159 RSSDNDSVTNEEGLVRTFDGESAFQGIDSHRENSTFATGGAKIHLWDVNRLK--PISNLS 216

Query: 204 SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNL 263
              + +   ++++    +  S   D++++++D R + P  KI+Q+   N + ++   +  
Sbjct: 217 WGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFN 276

Query: 264 FAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIW 320
           F  A  D     YD+R     +     H  +V  ++F+P  D I+ +GS D+ + ++
Sbjct: 277 FVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFSPTGDEIV-TGSYDKSIRMY 332

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 83/189 (43%), Gaps = 31/189 (16%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC----KWH 215
           H++  Y +  +  S  +L + S DG I  W++ S +   V     +  I   C     +H
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNM-STREEFVSFKAHYGLITGLCVTQPHFH 124

Query: 216 EKSP------FLFGSVSDDSTLIIHDKRID----------------KPVVKILQSEPYNT 253
           +K        F+  S SDD T+ +    +D                + +V+    E    
Sbjct: 125 DKKSDWKNQNFML-SCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESAFQ 183

Query: 254 LAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
              S   ++ FA  G  +++ L+D+ + + PI ++S   D++TS+ F  ++  IL S  S
Sbjct: 184 GIDSHRENSTFATGG--AKIHLWDVNRLK-PISNLSWGADNITSVRFNQNETDILASTGS 240

Query: 314 DRRVLIWDL 322
           D  ++++DL
Sbjct: 241 DNSIVLYDL 249

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 89/210 (42%), Gaps = 19/210 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +GK    +V + H+  V  C WH +   L  S S D+ + + D
Sbjct: 191 KFVTCSDDNILKIWNFSNGKQE--RVLSGHHWDVKSCDWHPEMG-LIASASKDNLVKLWD 247

Query: 236 KRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            R    +  IL+ + +  L   F     NL  A   D   +++D+R     +  +    D
Sbjct: 248 PRSGNCISSILKFK-HTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCVRDETD 306

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            +T LE+ P  + +      D  +  +DL Q   E            +L +   H   + 
Sbjct: 307 YMT-LEWHPINESMFTLACYDGSLKHFDLLQNLNE-----------PILTIPYAHDKCIT 354

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASKKL 383
             S +P +  + A+  ++  ++ W  ++ +
Sbjct: 355 SLSYNP-VGHIFATAAKDRTIRFWTRARPI 383

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 117/279 (41%), Gaps = 40/279 (14%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   TRA+   F+P+    L+A  S + +++ Y         L   +  H+
Sbjct: 1   MKLLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRYEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               G++F    P   +S  DD +I +W + +  N  +     H + V    +H++ P++
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLET--NKCLYTLDGHLDYVRTVFFHKELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP 281
             S SDD T+ I + +  K +  I     +   A    + +L  +A  D  V+++D+ K 
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKL 169

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL 341
               HS  G     TS E                        +I A+Q   D   G   +
Sbjct: 170 REK-HSAPGRSAMPTSFEE-----------------------KIAAQQNLLDGGFGDCTV 205

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
             +  GH   VN  S  P +P L+ S  ++  V++WK S
Sbjct: 206 KFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKMS 243

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 4/122 (3%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S  DD  + +W + + K   +     H N V+   +H     +  
Sbjct: 215 GVNWASFHPTLPLIVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQNLIL- 273

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEA 283
           SV +D TL + D     PV +  +      L  +  + NLF AA  DS + ++ L +   
Sbjct: 274 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPNINLFGAA-HDSGIMIFKLDRERP 332

Query: 284 PI 285
           P 
Sbjct: 333 PF 334

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 83/207 (40%), Gaps = 45/207 (21%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P  I + S   K  +++ +K S +A+      H      +NF+   P  L +CS D 
Sbjct: 78  PAKPYWIVSTSNQ-KAIIWNLAKHSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDT 136

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S  + P    +S  +  ++ KW+ K P                         
Sbjct: 137 YVHAWDMRS-PHRPFYSTSSWRSAASQVKWNYKDP------------------------- 170

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N LA S H +++F          ++DLRK   P+ S+ GH  SV S++F   K
Sbjct: 171 -------NVLA-SSHGNDIF----------VWDLRKGSTPLCSLKGHVSSVNSIDFNRFK 212

Query: 305 DGILCSGSSDRRVLIWDLFQIGAEQQQ 331
              + S S+D  V  WD  +   E ++
Sbjct: 213 STEIMSSSNDGTVKFWDYSKSTTESKR 239

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 116/295 (39%), Gaps = 76/295 (25%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   TRA+   F+P+    L+A  S + +++ Y         L   F  H+
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRFEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               GL+F    P   +S  DD +I +W + +  N  +   T H + V    +H + P++
Sbjct: 54  GPVRGLDFHPTQPI-FVSAGDDYTIKVWSLDT--NKCLYTLTGHLDYVRTVFFHRELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP 281
             S SDD T+ I +                                        +  RK 
Sbjct: 111 I-SASDDQTIRIWN----------------------------------------WQNRKE 129

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF----------------QI 325
              I  ++GH+  V   +F P  D ++ S S D  + IWD+                 Q+
Sbjct: 130 ---IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQM 185

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
            A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++W+ S
Sbjct: 186 NAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 93/223 (41%), Gaps = 41/223 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V   ++H     +  S S D T+ I D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCAQFHPTDDLIV-SASLDETIRIWDI 166

Query: 236 ----KRIDKP-----------------------VVK-ILQSEPYNTLAFSKHSS-NLFAA 266
               KR   P                       VVK IL+         S H +  L  +
Sbjct: 167 SGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           A  D QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ + +WDL + 
Sbjct: 227 ASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTLRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFSCSPNIP 362
              +Q +  +D        P + +  A H S +  F      P
Sbjct: 286 TPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP 328

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S SDD  + +W + + K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL--RKP 281
           SV +D TL + D     PV +  +      L  +    NLF AA  DS + ++ L   +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKLDRERP 328

Query: 282 EAPIH 286
            + IH
Sbjct: 329 CSFIH 333

>Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]
           {ON} complement(171777..175607) [3831 nt, 1277 aa]
          Length = 1276

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 19/205 (9%)

Query: 132 ATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV 191
           A  +G  K F +D S +  S ++ EF+ H +    + F+ +    +LS   D  I IWD 
Sbjct: 74  AMKNGGLKFFKFDASNNVVSQVS-EFNSHSKEANVVKFNYVQSNVMLSGGSDSEIFIWDT 132

Query: 192 --CSGKN-----TPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
             C  +      TP  V  + N  ++   W+     +F S +D +   I D +  K V+ 
Sbjct: 133 KKCLSQLDYTPLTPGAVTGTSNPTISSLAWNHSLSHVFASAADTTHASIWDLKAKKEVMH 192

Query: 245 ILQSEPYNTLAFS--------KHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           +  S P   +           K+S+ +  A  + S + ++DLR    P+  +     +V 
Sbjct: 193 LAYSNPETGMKSQLSIVEWDPKNSTRV--ATSSTSSILIWDLRNSAKPLQILDSQA-TVK 249

Query: 297 SLEFAPHKDGILCSGSSDRRVLIWD 321
           SL++       L + S +  V++W+
Sbjct: 250 SLDWCAKDQDYLLASSDNNTVVLWN 274

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 90/208 (43%), Gaps = 19/208 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +GK    +  + H+  V  C WH +   +  S S D+ + + D
Sbjct: 184 KFVTCSDDNILKIWNFSNGKQE--RTLSGHHWDVKSCDWHPEMGLIV-SASKDNLIKLWD 240

Query: 236 KRIDKPVVKILQSEPYNTL--AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            R  + V  +L  + +  L   F     NL AA   D   +++D+R     +  +    D
Sbjct: 241 PRSGQCVSTLLNFK-HTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTVIRDEVD 299

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            +T L + P  + +    S D  +  +D+ Q   E QQ           ++   H   + 
Sbjct: 300 YMT-LLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQ-----------VIPYAHDKCIT 347

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASK 381
             S +P +  ++AS  ++  ++ W  ++
Sbjct: 348 SLSYNP-VGHILASAAKDRTIRFWTRAR 374

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 6/149 (4%)

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           G ++S S D  I +WD  SG+     ++  H   V + K+      L  ++S D +  + 
Sbjct: 225 GLIVSASKDNLIKLWDPRSGQCVSTLLNFKHT--VLKTKFQPTKGNLLAAISKDKSCRVF 282

Query: 235 DKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYD-LRKPEAPIHSMSGHH 292
           D R     + +++ E  Y TL +   + ++F  A  D  ++ +D L+  E P   +   H
Sbjct: 283 DIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEPQQVIPYAH 342

Query: 293 DS-VTSLEFAPHKDGILCSGSSDRRVLIW 320
           D  +TSL + P    IL S + DR +  W
Sbjct: 343 DKCITSLSYNP-VGHILASAAKDRTIRFW 370

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 72/143 (50%), Gaps = 7/143 (4%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           S+D +I +WD  SGK   +K+  S H   V +    ++ P++F S S+D  +   D   +
Sbjct: 128 SNDSTIKVWDFASGK---LKLTLSGHVMGVRDLVVSKRHPYMF-SASEDKLVKCWDLEKN 183

Query: 240 KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLE 299
            P+                 + +L A+AG DS V+L+D+R  +A I ++ GH   + S++
Sbjct: 184 APIRDYFGHLSGVHTVDIHPTLSLIASAGRDSVVKLWDIRSKKAVI-TLVGHKSPINSVK 242

Query: 300 FAPHKDGILCSGSSDRRVLIWDL 322
             P  D  + S S+D  V+ WDL
Sbjct: 243 CTP-ADPQIISCSNDTTVITWDL 264

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 69/156 (44%), Gaps = 22/156 (14%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSE---PYNTLAFSKHSSNLFAAAGTDSQVQLYDL 278
           F + S+DST+ + D    K  +K+  S        L  SK    +F+A+  D  V+ +DL
Sbjct: 124 FATGSNDSTIKVWDFASGK--LKLTLSGHVMGVRDLVVSKRHPYMFSAS-EDKLVKCWDL 180

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
            K  API    GH   V +++  P    ++ S   D  V +WD+    A           
Sbjct: 181 EK-NAPIRDYFGHLSGVHTVDIHPTL-SLIASAGRDSVVKLWDIRSKKA----------- 227

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVV 374
              ++   GHKSP+N   C+P  P +++   +  V+
Sbjct: 228 ---VITLVGHKSPINSVKCTPADPQIISCSNDTTVI 260

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 16/155 (10%)

Query: 129 NLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIA 187
           +LIA+      V L+D RSK +   L      HK     +  +   P +++SCS+D ++ 
Sbjct: 206 SLIASAGRDSVVKLWDIRSKKAVITLVG----HKSPINSVKCTPADP-QIISCSNDTTVI 260

Query: 188 IWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ 247
            WD+ + K  P+KV T H   V +   H   P  F   S  +  I   K  +  ++   +
Sbjct: 261 TWDLVAAK--PMKVITHHRKAVRDIAVH---PGEFSVASCSTNDIRSWKLPEGSLLTNFE 315

Query: 248 SEP---YNTLAFSKHSSNLFAAAGTDSQVQLYDLR 279
           S+     NTL  ++   ++  A   D  +  YD R
Sbjct: 316 SQNSGIINTLCVNQ--DDVLFAGADDGTLSFYDYR 348

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/302 (23%), Positives = 122/302 (40%), Gaps = 53/302 (17%)

Query: 122 RYAPFNPNLIATISGS-------GKVFLYD-----RSKDSDSALTAEFSFHKENGYGLNF 169
           +Y+P+  N +A  SGS       GK+F+ D     R  + +S LT +  F       + +
Sbjct: 15  QYSPYFDNRLAVASGSNFGLVGNGKLFILDIDPQGRILEFNSFLTQDCLFD------VAW 68

Query: 170 SVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD- 228
           +     ++L    DG++ ++D    K  P+ +   H   V  C W+      F S S D 
Sbjct: 69  NEAHENQVLVAQGDGTLRLFDT-KLKQYPIAIFNEHQKEVFSCNWNLVGKQNFVSSSWDG 127

Query: 229 -----------STLIIHDKRID-------KPVVKILQSEPYNTLA----------FSKHS 260
                      S L +  + +D        P V +   + +  +A          FS H 
Sbjct: 128 AVKIWSPQRKESLLTVVPRPMDVSTMACAGPQVPMSNQKGHADIAKNKNCIYQALFSPHD 187

Query: 261 SNLFAAAGTDSQVQLYDLRKPEAPIHSMSG-HHDSVTSL--EFAPHKDGILCSGSSDRRV 317
            NL      +S V L+D R+P  P +  S   H  + +L  +F  ++   L +G  D  +
Sbjct: 188 PNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLVTGGVDNCI 247

Query: 318 LIWDLFQIG-AEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQI 376
            IWDL  +G +   + +A   V    ++  GH+  V   S SP+   ++ S   +    I
Sbjct: 248 RIWDLRMVGPSAASRANASPAVCTNEIV-GGHELAVRKVSWSPHHSNILLSTSYDMTCCI 306

Query: 377 WK 378
           W+
Sbjct: 307 WQ 308

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 97/265 (36%), Gaps = 50/265 (18%)

Query: 102 PQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           PQ +I     F  +D +    +   + N +    G G + L+D          A F+ H+
Sbjct: 47  PQGRILEFNSFLTQDCLFDVAWNEAHENQVLVAQGDGTLRLFDTKLKQYP--IAIFNEHQ 104

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWD--------------------VCSGKNTPVKV 201
           +  +  N++++     +S S DG++ IW                      C+G   P+  
Sbjct: 105 KEVFSCNWNLVGKQNFVSSSWDGAVKIWSPQRKESLLTVVPRPMDVSTMACAGPQVPMSN 164

Query: 202 DTSH------NNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYN--- 252
              H       N + +  +    P L    S +S + + D R  +P     Q        
Sbjct: 165 QKGHADIAKNKNCIYQALFSPHDPNLVMCCSGNSYVTLFDSR--QPPTPANQKSFLAHSG 222

Query: 253 ----TLAFSKHSSNLFAAAGTDSQVQLYDLR--KPEAPIHS-----------MSGHHDSV 295
               T  F+K+  +     G D+ ++++DLR   P A   +           + GH  +V
Sbjct: 223 LEALTCDFNKYRPHSLVTGGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVGGHELAV 282

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIW 320
             + ++PH   IL S S D    IW
Sbjct: 283 RKVSWSPHHSNILLSTSYDMTCCIW 307

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 82  VSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVF 141
           VS + C+ P    S + GH   +K        +++ + +A ++P +PNL+   SG+  V 
Sbjct: 150 VSTMACAGPQVPMSNQKGHADIAK--------NKNCIYQALFSPHDPNLVMCCSGNSYVT 201

Query: 142 LYDRSKDSDSALTAEFSFHKE-NGYGLNFSVISPGELLSCSDDGSIAIWDV 191
           L+D  +    A    F  H        +F+   P  L++   D  I IWD+
Sbjct: 202 LFDSRQPPTPANQKSFLAHSGLEALTCDFNKYRPHSLVTGGVDNCIRIWDL 252

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 71/169 (42%), Gaps = 35/169 (20%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGK---NTPVKVDTSHNNIVNECK 213
           F  HK+    L+F       L+S S D  I  WD+ +GK      +    +H++I    +
Sbjct: 420 FELHKDEITALSFD---SEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 476

Query: 214 WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQV 273
                  L G+              + P++  LQ   YN+           A    D  V
Sbjct: 477 SLNNGACLLGT--------------EAPMIGALQC--YNSA---------LATGTKDGIV 511

Query: 274 QLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
           +L+DLR  + P+  + GH D +TSL+F   K   L +GS D  V IWDL
Sbjct: 512 RLWDLRVGK-PVRLLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDL 556

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + + DG + +WD+  GK  PV++   H + +   K+ +    + GS+  D+++ I D 
Sbjct: 502 LATGTKDGIVRLWDLRVGK--PVRLLEGHTDGITSLKF-DSEKLVTGSM--DNSVRIWDL 556

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE-----APIHSMSGH 291
           R    +  I    P ++L F      L      +  V ++++ + E      P HS+ G 
Sbjct: 557 RTSSILDVIAYDLPVSSLDFD---GKLITVGANEGGVNVFNMERDEHWMTPEPPHSLDGD 613

Query: 292 HDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
             S   +    +KDG L +G +D  + +W L
Sbjct: 614 ELS-RRIAIVKYKDGFLINGHNDGDINVWTL 643

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 9/144 (6%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           S+D +I +WD+ SGK   +K+  + H   V      ++ P +F S S+D  +   D   +
Sbjct: 145 SNDTTIKVWDLASGK---LKLTLAGHVMTVRSIAISQRHPLMF-SASEDKLVKCWDLEKN 200

Query: 240 KPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSL 298
             VV+              H + +L A+AG D+ V+L+D+R    P+ +++GH   +  +
Sbjct: 201 T-VVRDYHGHFSGVHTVDVHPTLDLIASAGRDAVVRLWDIRT-RVPVMTLAGHKGPINQV 258

Query: 299 EFAPHKDGILCSGSSDRRVLIWDL 322
           +  P  D  + SGS+D  V +WD+
Sbjct: 259 KCFP-VDPQIMSGSADSTVRLWDI 281

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 76/169 (44%), Gaps = 24/169 (14%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           F + S+D+T+ + D    K  + +        ++A S+    +F+A+  D  V+ +DL K
Sbjct: 141 FATGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQRHPLMFSAS-EDKLVKCWDLEK 199

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
               +    GH   V +++  P  D ++ S   D  V +WD+               VP 
Sbjct: 200 -NTVVRDYHGHFSGVHTVDVHPTLD-LIASAGRDAVVRLWDI------------RTRVP- 244

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW-----KASKKLT 384
            +M  AGHK P+N   C P  P +M+    ++ V++W     KA K LT
Sbjct: 245 -VMTLAGHKGPINQVKCFPVDPQIMSG-SADSTVRLWDIRAGKAMKILT 291

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 46/113 (40%), Gaps = 19/113 (16%)

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
           P   +  ++GH+  V  +   P  +    +GS+D  + +WDL                 +
Sbjct: 114 PWKLMRVINGHNGWVRCVCVDPVDNEWFATGSNDTTIKVWDL--------------ASGK 159

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
           L +  AGH   V   + S   P LM S  E+ +V+ W   K      + RDY+
Sbjct: 160 LKLTLAGHVMTVRSIAISQRHP-LMFSASEDKLVKCWDLEKNT----VVRDYH 207

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 74/164 (45%), Gaps = 17/164 (10%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +++S S D ++ +WD+ +GK   +K+ T H+  V     +        SV+  ST  I  
Sbjct: 266 QIMSGSADSTVRLWDIRAGK--AMKILTHHSKSVRAIAGNPSE----SSVATASTSDIRS 319

Query: 236 KRI-DKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRK----PEAPIHSMS 289
            R+ D  ++   +SE    +   S +   +  A G D  +  YD +      + P   + 
Sbjct: 320 WRLQDGQLLTNFRSEDTGIINCLSVNPDGVLFAGGDDGHLSFYDYKTGHKFQDLPTIKVP 379

Query: 290 GHHDSVTSLEFAPH-KDGI-LCSGSSDRRVLIWDLFQI-GAEQQ 330
           G  +S   +  A   + G+ L +G SD+ + +W   QI GA Q+
Sbjct: 380 GSLESERGILSASFDQTGLRLITGESDKSIKVWK--QIPGATQE 421

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 98/226 (43%), Gaps = 20/226 (8%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H E+   + FS  +  + ++CSDD  + IW+  +GK    ++ + H+  V  C WH +  
Sbjct: 176 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKQE--RILSGHHWDVKSCDWHPEMG 232

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYD 277
            L  S S D+ + + D R    +  IL+ + +  L   F     NL  A   D   +++D
Sbjct: 233 -LIASASKDNLVKLWDPRSGNCISSILKFK-HTVLKTRFQPTKGNLLMAISKDKSCRVFD 290

Query: 278 LRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
           +R     +  +    D +T LE+ P  + +      D  +  +DL Q          D  
Sbjct: 291 IRYSMRELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLN 339

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
            P L + +A H   +   S +P +  + A+  ++  ++ W  ++ +
Sbjct: 340 EPILTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRARPI 383

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 78/169 (46%), Gaps = 24/169 (14%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           F + S+D+T+ + D    K  + +        ++A S+    +F+A+  D  V+ +DL +
Sbjct: 137 FATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSAS-EDKMVKCWDLER 195

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
             A I    GH   V +++  P  D ++ S   D  V +WD+               +P 
Sbjct: 196 -NAAIRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVRLWDI------------RTRLP- 240

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW-----KASKKLT 384
            +M  AGHKSP+N   C P  P +M S   +  V++W     KA+K LT
Sbjct: 241 -VMTLAGHKSPINQVKCFPVDPQIM-SCSSDATVRLWDIRAGKATKILT 287

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 71/144 (49%), Gaps = 9/144 (6%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVD-TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           S+D +I +WD+ SGK   +K+  T H   V      ++ P +F S S+D  +   D   +
Sbjct: 141 SNDTTIKVWDMASGK---LKLTLTGHVMTVRSVAVSQRHPLMF-SASEDKMVKCWDLERN 196

Query: 240 KPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSL 298
              ++              H + +L A+AG D+ V+L+D+R    P+ +++GH   +  +
Sbjct: 197 -AAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRT-RLPVMTLAGHKSPINQV 254

Query: 299 EFAPHKDGILCSGSSDRRVLIWDL 322
           +  P  D  + S SSD  V +WD+
Sbjct: 255 KCFP-VDPQIMSCSSDATVRLWDI 277

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 68/153 (44%), Gaps = 14/153 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWH-EKSPFLFGSVSDDSTLIIH 234
           +++SCS D ++ +WD+ +GK T  K+ T H+  V     H  +S     S SD  +    
Sbjct: 262 QIMSCSSDATVRLWDIRAGKAT--KILTHHSKSVRAIAAHPAESSVATASTSDVRSW--- 316

Query: 235 DKRIDKPVVKILQSEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRK----PEAPIHSMS 289
            +  D  ++    SE    + + S ++  +    G D  +  +D +      E P   + 
Sbjct: 317 -RHSDGQLLTNYHSEGIGIINSLSVNADGVLFGGGDDGNLSFFDYKSGHKYQELPTTKIP 375

Query: 290 GHHDSVTSLEFAPH-KDGI-LCSGSSDRRVLIW 320
           G  DS   +  A   + G+ L +G SD+ + +W
Sbjct: 376 GSLDSERGILSASFDQTGLRLITGESDKSIKMW 408

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 81/197 (41%), Gaps = 20/197 (10%)

Query: 141 FLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWD---VCSGKNT 197
           F   R + S     A  + H      + F+       +S    G I +WD   + +   +
Sbjct: 87  FFCARERRS----VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYS 142

Query: 198 PVKVDTSHNNI--VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPY---- 251
           P    T+   I  V    W++    +F S        I D +  K V+ +  + P+    
Sbjct: 143 PFGPGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLK 202

Query: 252 NTLAFSK----HSSNLFAAAGTDSQ--VQLYDLRKPEAPIHSMS-GHHDSVTSLEFAPHK 304
           N LA  +    +S+ +  A G D++  + ++DLR    P+  MS GH   + SL++  H 
Sbjct: 203 NQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHD 262

Query: 305 DGILCSGSSDRRVLIWD 321
           + ++ S   D   ++W+
Sbjct: 263 EKLMLSSGRDNTCILWN 279

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 76/174 (43%), Gaps = 32/174 (18%)

Query: 149 SDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNI 208
           S++A    F  H +    L+F     G L+S S D ++  WD+ SGK     +D S    
Sbjct: 486 SETACVYTFDSHVDEITALSFD---SGHLVSGSQDRTVRQWDLTSGKCLQT-IDLSFAGR 541

Query: 209 VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAG 268
           +++   +  S  L    S D++          P++  LQ        F        A   
Sbjct: 542 LSQTSSNSGSGLL---TSTDTS----------PIIGALQ-------CFDA----ALATGT 577

Query: 269 TDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
            D  V+L+DLR  +  I ++ GH  +VTSL+F       L +GS DR V IWDL
Sbjct: 578 RDGAVRLWDLRSGKI-IRTLEGHTGAVTSLKFDSKN---LITGSLDRSVRIWDL 627

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 62/148 (41%), Gaps = 13/148 (8%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + + DG++ +WD+ SGK   ++    H   V   K+  K+  + GS+  D ++ I D 
Sbjct: 573 LATGTRDGAVRLWDLRSGK--IIRTLEGHTGAVTSLKFDSKN-LITGSL--DRSVRIWDL 627

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
           R            P  +L F   S      A  +  +Q+ D    +   H   G  +  T
Sbjct: 628 RTGTLADAFAYESPVLSLDFDFQS---IVVANNEQTIQVVD---RDDDKHWECGEENKYT 681

Query: 297 --SLEFAPHKDGILCSGSSDRRVLIWDL 322
             + +F  +KDG +  G S   V+ W L
Sbjct: 682 DSTAQFVRYKDGYMVEGRSSGDVVAWAL 709

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 83/207 (40%), Gaps = 45/207 (21%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P  I + S   K  +++ +K S +A+      H      +NF+   P  L +CS D 
Sbjct: 79  PAKPYWIVSTSNQ-KAIIWNLAKSSSNAIEFVLHGHSRAITDINFNPQHPDVLATCSVDT 137

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S  + P    +S  +  ++ KW+ K P                         
Sbjct: 138 YVHAWDMRS-PHRPFYSTSSWRSAASQVKWNYKDP------------------------- 171

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N LA S H +++F          ++DLRK   P+ S+ GH  SV S++F   K
Sbjct: 172 -------NVLA-SSHGNDIF----------VWDLRKGSTPLCSLKGHVSSVNSIDFNRFK 213

Query: 305 DGILCSGSSDRRVLIWDLFQIGAEQQQ 331
              + S S+D  V  WD  +   E ++
Sbjct: 214 YSEIMSSSNDGTVKFWDYSKSTTESKR 240

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 67/149 (44%), Gaps = 6/149 (4%)

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           G + S S D  + +WD  SG+     +   H   V + K+      L  ++S D +  + 
Sbjct: 220 GLIASASKDNLVKLWDPRSGQCVSTLLKFKHT--VLKTKFQPTQGNLMAAISKDKSCRVF 277

Query: 235 DKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYD-LRKPEAPIHSMSGHH 292
           D R     + + + E  Y TL +   +  +F  A  D  ++ +D L+  E P H++   H
Sbjct: 278 DLRQSMKELMVTRDEVDYMTLLWHPINETMFTVACYDGSLKNFDILQDTEGPTHTIPYAH 337

Query: 293 DS-VTSLEFAPHKDGILCSGSSDRRVLIW 320
           D  +TSL + P    IL S S DR +  W
Sbjct: 338 DKCITSLSYNP-VGHILASASKDRTIRFW 365

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 93/219 (42%), Gaps = 21/219 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +G+    +V + H+  V  C WH +   L  S S D+ + + D
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQE--RVLSGHHWDVKSCDWHPQMG-LIASASKDNLVKLWD 235

Query: 236 KRIDKPVVKILQ-SEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDS 294
            R  + V  +L+         F     NL AA   D   +++DLR+    +       D 
Sbjct: 236 PRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMVTRDEVDY 295

Query: 295 VTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVND 354
           +T L + P  + +      D  +  +D+ Q          D   P   + +A H   +  
Sbjct: 296 MT-LLWHPINETMFTVACYDGSLKNFDILQ----------DTEGPTHTIPYA-HDKCITS 343

Query: 355 FSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
            S +P +  ++AS  ++  ++ W  ++    PY P  ++
Sbjct: 344 LSYNP-VGHILASASKDRTIRFWTRAR----PYDPNAFD 377

>KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON}
           Anc_4.122 YGL003C
          Length = 617

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 70/143 (48%), Gaps = 9/143 (6%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G + I+D   GK   ++  + H + V    W+     +  S S D  ++  D R+  P 
Sbjct: 374 NGLVEIYDAVKGKC--IRTLSGHVDRVACLSWNN---HILSSGSRDHRILHRDVRMPDPF 428

Query: 243 VKILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
            + ++S          +   N  A+ G D+ V +YD      P+ +++ H  +V ++ ++
Sbjct: 429 FERIESHTQEVCGLKWNVDENKLASGGNDNIVHVYD-GTSRTPMLTLNEHKAAVKAIAWS 487

Query: 302 PHKDGILCS--GSSDRRVLIWDL 322
           PHK GIL +  G++DR + IW++
Sbjct: 488 PHKRGILATGGGTADRCLKIWNI 510

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 97/224 (43%), Gaps = 20/224 (8%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H E+   + FS  +  + ++CSDD  + IW+  +GK    +V + H+  V  C WH +  
Sbjct: 176 HTESIRDMAFSS-NDSKFVTCSDDNILKIWNFSNGKEE--RVLSGHHWDVKSCDWHPEMG 232

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYD 277
            L  S S D+ + + D R    +  IL+ + +  L   F     NL  A   D   +++D
Sbjct: 233 -LIASASKDNLVKLWDPRSGNCISSILKFK-HTVLKTRFQPVKGNLLMAISKDKSCRVFD 290

Query: 278 LRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
           +R     +  +    D +T LE+ P  + +      D  +  +DL Q          D  
Sbjct: 291 IRYSMKELMCVRDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ----------DLN 339

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASK 381
            P L + +A H   +   S +P +  + A+  ++  ++ W  ++
Sbjct: 340 EPVLTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFWTRAR 381

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 84/194 (43%), Gaps = 41/194 (21%)

Query: 199 VKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSE---PYNTLA 255
           V+VDT  N      KW       F + S D+T+ I D  ++   +KI  S    P   +A
Sbjct: 108 VEVDTVEN------KW-------FATGSSDTTIKIWD--LESGKLKITLSGHVMPVRDIA 152

Query: 256 FSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDR 315
            SK S  LF+A+  D  ++ +DL K  A I    GH   V +++  P  D I  +G  D 
Sbjct: 153 ISKRSPYLFSAS-EDKLIKCWDLEKNMA-IREYFGHLSGVNTVDVHPTLDLIATAGR-DS 209

Query: 316 RVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQ 375
            + +WD+    A              +M   GHK+PV    C P  P  + S   +  V+
Sbjct: 210 TIRLWDIRSRTA--------------VMTLIGHKAPVTTVKCIPVDP-QVVSASNDATVK 254

Query: 376 IW-----KASKKLT 384
           +W     KA K LT
Sbjct: 255 LWDIVAGKAIKTLT 268

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 21/180 (11%)

Query: 181 SDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID 239
           S D +I IWD+ SGK   +K+  S H   V +    ++SP+LF S S+D  +   D   +
Sbjct: 122 SSDTTIKIWDLESGK---LKITLSGHVMPVRDIAISKRSPYLF-SASEDKLIKCWDLEKN 177

Query: 240 KPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLE 299
             + +               + +L A AG DS ++L+D+R   A + ++ GH   VT+++
Sbjct: 178 MAIREYFGHLSGVNTVDVHPTLDLIATAGRDSTIRLWDIRSRTA-VMTLIGHKAPVTTVK 236

Query: 300 FAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSP 359
             P  D  + S S+D  V +WD+           A   +  L      HK  V D + +P
Sbjct: 237 CIP-VDPQVVSASNDATVKLWDIV----------AGKAIKTL----THHKRTVRDIAVNP 281

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 44/96 (45%), Gaps = 15/96 (15%)

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAG 347
           ++GH   V  +E    ++    +GSSD  + IWDL            + G  +L +  +G
Sbjct: 98  INGHLGWVRCVEVDTVENKWFATGSSDTTIKIWDL------------ESG--KLKITLSG 143

Query: 348 HKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383
           H  PV D + S   P+L  S  E+ +++ W   K +
Sbjct: 144 HVMPVRDIAISKRSPYLF-SASEDKLIKCWDLEKNM 178

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 89/204 (43%), Gaps = 26/204 (12%)

Query: 129 NLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIA 187
           +LIAT      + L+D RS+ +   L      HK     +    + P +++S S+D ++ 
Sbjct: 200 DLIATAGRDSTIRLWDIRSRTAVMTLIG----HKAPVTTVKCIPVDP-QVVSASNDATVK 254

Query: 188 IWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ 247
           +WD+ +GK   +K  T H   V +   +     +  + +DD    I   R+  P   +L 
Sbjct: 255 LWDIVAGK--AIKTLTHHKRTVRDIAVNPTEFSIASACTDD----IRSWRL--PEGSLLT 306

Query: 248 SEPYNTL----AFSKHSSNLFAAAGTDSQVQLYDLRK----PEAPIHSMSGHHDS---VT 296
           +   +TL    + S +  N+ AA G +  +  +D +      +    +MSG  +S   + 
Sbjct: 307 NFESDTLGIVNSISINQDNIMAACGDNGVLSFFDYKSGHKYQKIATTAMSGSLESEKGIL 366

Query: 297 SLEFAPHKDGILCSGSSDRRVLIW 320
           S  F      I  +G +D+ + +W
Sbjct: 367 SGTFDA-TGQIFITGETDKSIKMW 389

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 130/318 (40%), Gaps = 52/318 (16%)

Query: 25  LMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLP----DE 80
           L ++ V+E  + +P   IQW+P+          L      T  + L++ S+       +E
Sbjct: 155 LNWNRVAEYNVTYPVSNIQWIPAQ---------LQPRKFATCSDSLRLWSLREDTSSIEE 205

Query: 81  VVSDVKC---------SAPSTDDSKES-GHQPQSKIKIVRKFEHRDEVTRARYAPFNPNL 130
           +++   C         +   T+DS+ S G  P     ++ +F     +T   + P + N 
Sbjct: 206 ILNLSYCKYNKLRQNTTTNGTNDSRTSVGVDP----SVLGQFP---PITSFHWNPIDTNF 258

Query: 131 IATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWD 190
           + + S      ++D    S++ +  +   H    + + F   S     SC  DGS+ ++D
Sbjct: 259 LISSSIDTTCIVWDL--QSNNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFD 316

Query: 191 VCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK-----I 245
           + S  ++ +  +++ N           S    G + D    +    R+    +      +
Sbjct: 317 LRSLAHSTIIYESAANT--------SMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNAL 368

Query: 246 LQSEPYNTLAFSKHSSNLFAAAGTDSQ-VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
           L+ EP      S    N+ A  G DS  V + D+R P  P+ ++ GH   +  +++ P K
Sbjct: 369 LRLEP------SPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTK 422

Query: 305 DGILCSGSSDRRVLIWDL 322
              + S S D +VL W+L
Sbjct: 423 KNTILSSSDDCQVLYWNL 440

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 86/212 (40%), Gaps = 29/212 (13%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L+S S D +  +WD+ S      ++  +H++ V + ++  +S  LF S   D ++ + D 
Sbjct: 259 LISSSIDTTCIVWDLQSNNYVKTQL-IAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDL 317

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAG---TDSQVQLYDLRKPEAPIHSMSGHHD 293
           R       I +S   NT   +  S  +    G   T S+V   DL          S   +
Sbjct: 318 RSLAHSTIIYESAA-NTSMSNLSSGGMVDHPGSLNTSSRVGSVDL----------SSKSN 366

Query: 294 SVTSLEFAPHKDGILCS-GSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPV 352
           ++  LE +P    ++ + G+    VLI D+            + G P L +   GH +P+
Sbjct: 367 ALLRLEPSPTDPNVIATFGADSNSVLILDM-----------RNPGTPVLTL--DGHSAPI 413

Query: 353 NDFSCSPNIPWLMASVEEENVVQIWKASKKLT 384
           N     P     + S  ++  V  W  +  LT
Sbjct: 414 NQIKWHPTKKNTILSSSDDCQVLYWNLNDPLT 445

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 11/160 (6%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
            +++ +DDG I +WDV SG    +   T H + V + ++ +K   LF S S D T+   D
Sbjct: 355 RVVTAADDGKIKVWDVVSG--FCLATFTEHTSSVTQVQFAKKGQVLFSS-SLDGTVRAWD 411

Query: 236 KRIDKPVVKILQSE--PYNTLAFSKHSSNLFAAAGTDS-QVQLYDLRKPEAPIHSMSGHH 292
               +       +E   +N LA    S  +  A   DS  + ++ ++  +  + ++SGH 
Sbjct: 412 LIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSIDSFDIHVWSVQTGQL-LDTLSGHE 469

Query: 293 DSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQE 332
             V+ L F+  ++ +L S S D+ V IW +F  G  QQ E
Sbjct: 470 GPVSCLSFS-QENSVLASASWDKTVRIWSIF--GRSQQVE 506

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 85/210 (40%), Gaps = 30/210 (14%)

Query: 190 DVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK---IL 246
           DV SG      ++  H+  +    W+  +  L  S +DD  + IH    D  ++K    L
Sbjct: 219 DVISG------IENGHDGKIGGLAWNSTNTHLV-SGADDCLVKIHSFDPDVKIIKELTAL 271

Query: 247 QSEPYNTLAFSKHSSNLF-AAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKD 305
           Q      +    H S  F A+A  D   +L+D+ + E  +    GH   V SL F    D
Sbjct: 272 QGHTGRVVNVDFHPSGRFVASASFDMTWRLWDI-ESETELQFQEGHGKEVYSLSF--QND 328

Query: 306 G-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWL 364
           G +LCSG  D   ++WD+                 + +M   GH  P+     SP+  + 
Sbjct: 329 GALLCSGGLDNAAIVWDVR--------------TGKSIMNLQGHAKPIYSVDWSPD-GYH 373

Query: 365 MASVEEENVVQIWKASKKLTSPYIPRDYNI 394
           +A+   + V+ IW   K   +  +    NI
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNI 403

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 79/197 (40%), Gaps = 45/197 (22%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P  I + S   K  +++ +K S +A+      H      +NF+   P  L +CS D 
Sbjct: 79  PAKPYWIVSTSNQ-KAIIWNLAKSSANAIEFVLHGHSRAITDINFNPQHPDVLATCSVDT 137

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S  + P    +S  +  ++ KW+ K P                         
Sbjct: 138 YVHAWDMRS-PHRPFYSTSSWRSAASQVKWNYKDP------------------------- 171

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N LA S H +++F          ++DLRK   P+ S+ GH  SV S++F   K
Sbjct: 172 -------NVLA-SSHGNDIF----------VWDLRKGSTPLCSLKGHVSSVNSIDFNRFK 213

Query: 305 DGILCSGSSDRRVLIWD 321
              + S S+D  V  WD
Sbjct: 214 STEIMSSSNDGTVKFWD 230

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 101/235 (42%), Gaps = 18/235 (7%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H +   G++FS  +  + ++CSDD  + IW+  +G+       + H+  V  C WH  + 
Sbjct: 166 HTQCIRGISFSG-TDSKFVTCSDDNILKIWNFSNGQQESTL--SGHHWDVRSCDWHP-TM 221

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDL 278
            L  S S D+ + + D R  + +  IL  +    +  F     N+ A    D   +++D+
Sbjct: 222 GLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDI 281

Query: 279 RKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGV 338
           R+    +       D + SL + P  + +   G  D  +  +DL      Q+ +D+  G 
Sbjct: 282 RQNMKELAVYRDESDYM-SLTWHPINESMFTVGCYDGSMKHFDLL-----QEPQDSSSGC 335

Query: 339 PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
                +   H   +   + +P +  ++AS  ++  ++ W  ++    PY P  ++
Sbjct: 336 --FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRAR----PYDPNSFD 383

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 106/281 (37%), Gaps = 33/281 (11%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGY 165
           +K    F  +D +  + +    PN +    G G + L+D +        A F  H +  Y
Sbjct: 51  VKEKNSFLTKDCLFDSAWNELKPNQVVVAQGDGSLRLFDTTLQKFP--IAMFHEHSKEVY 108

Query: 166 GLNFSVISPGELLSCSDDGSIAIWD------VCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
             N++++S    +S S DG + IW       + +    P+ V  + +N+    +  + SP
Sbjct: 109 SCNWNLVSKSNFVSSSWDGQVKIWSPNRKASLITFSPHPIDVSRALDNLPEVSQRDKLSP 168

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLR 279
                V+ +   I                       FS H  NL      +S V L+DLR
Sbjct: 169 ---NQVAQNRNCIYQ-------------------ATFSPHDDNLILCCAGNSYVTLFDLR 206

Query: 280 K-PEAPIHSMSGHHD-SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
           + P     +   H      S +F  ++  I+ +   D  + IWD+  +     Q+    G
Sbjct: 207 QNPGNNQKNFIAHRGKGALSCDFNKYRPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTG 266

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
                +++A H   V     SP+   ++ S   +   +IWK
Sbjct: 267 TLVNEIVNA-HDLAVKKVCWSPHHSDILLSTSYDMSCKIWK 306

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 113/270 (41%), Gaps = 47/270 (17%)

Query: 121 ARYAPFNPNLIATISGS-------GKVFLYDRS-----KDSDSALTAEFSFHKENGYGLN 168
            +Y+P+  N++A  +GS       GK+F+ +       K+ +S LT +  F         
Sbjct: 14  VQYSPYYDNILAVNTGSNFGLVGNGKLFILEIDNNGVVKEKNSFLTKDCLFDSA------ 67

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           ++ + P +++    DGS+ ++D    K  P+ +   H+  V  C W+  S   F S S D
Sbjct: 68  WNELKPNQVVVAQGDGSLRLFDTTLQK-FPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWD 126

Query: 229 STLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSM 288
             +     +I  P  K       + + FS H  ++  A     +V   D   P    + +
Sbjct: 127 GQV-----KIWSPNRKA------SLITFSPHPIDVSRALDNLPEVSQRDKLSP----NQV 171

Query: 289 SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGH 348
           + + + +    F+PH D ++   + +  V ++DL Q     Q+           + H G 
Sbjct: 172 AQNRNCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKN---------FIAHRGK 222

Query: 349 KSPVNDFS-CSPNIPWLMASVEEENVVQIW 377
            +   DF+   PNI   +A+   +N + IW
Sbjct: 223 GALSCDFNKYRPNI---IATSGVDNSIGIW 249

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/275 (19%), Positives = 113/275 (41%), Gaps = 53/275 (19%)

Query: 103 QSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKE 162
           Q  +   + F  +D +    +   + N +    G G + L+D ++ +D  + A F  H++
Sbjct: 48  QGIMTEAKSFLTQDGLFDVAWNELHENQVLVAQGDGSLRLFD-TQLTDYPI-AIFHEHEK 105

Query: 163 NGYGLNFSVISPGELLSCSDDGSIAIWD--------------------VCSGKNTPVKVD 202
             +  N+++I+    +S S DG++ +W                     +   K+ P+   
Sbjct: 106 EVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSLATLTPKPMAAQNPLMPSKDIPMSNQ 165

Query: 203 TSHN------NIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYN---- 252
            +H       N + + ++    P +  S + +S + + D R   P         +N    
Sbjct: 166 QNHTSLSKNKNCIYQSQFSPHDPNVIMSCAGNSYVTMFDLR-QPPGANQYSFLAHNGMET 224

Query: 253 -TLAFSKHSSNLFAAAGTDSQVQLYDLR---------KPEAPIHSMSGHHDSVTSLEFAP 302
            T  F+K+ S++ A  G D+ ++++DLR         +    ++ + GH  ++  + ++P
Sbjct: 225 LTCDFNKYRSHIVATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSP 284

Query: 303 HKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
           H   +L S S D    +W          Q+ +DDG
Sbjct: 285 HHSNMLLSTSYDMTCRVW----------QDLSDDG 309

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 97/219 (44%), Gaps = 24/219 (10%)

Query: 126 FNPNLIA-TISGSGKVFLYDRSKDSDSALT----AEFSFHKENGYGLNFSVISPGELLSC 180
           F+   IA  +  +GK+ L+ + +++D+ ++     +F  H      L F+      L S 
Sbjct: 74  FDNKFIAGALDDNGKIELFSK-EENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASA 132

Query: 181 SDDGSIAIWDV----CSGKNTPVK--VDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI-I 233
            ++G I IWD+     S   +P    +  S  + +    W++    +F S  D +T   I
Sbjct: 133 GNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTYASI 192

Query: 234 HDKRIDKPVVKILQSEPYNTLA--------FSKHSSNLFAAAGTDSQ--VQLYDLRKPEA 283
            D +  K V+ +  + P   L           K ++ +  A+G+DS   + ++DLR    
Sbjct: 193 WDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDPVILIWDLRNSNM 252

Query: 284 PIHSMSG-HHDSVTSLEFAPHKDGILCSGSSDRRVLIWD 321
           P+ ++ G H   + SL++    + +L S   D  V +WD
Sbjct: 253 PMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 69/161 (42%), Gaps = 21/161 (13%)

Query: 181 SDDGSIAIWDVCSGKN---TPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
           S+D ++ +W + S      TPV   T+      +  W   + F+ G++ D+  + +  K 
Sbjct: 37  SNDSTLELWSLLSDPKKDPTPVASITTDARF-KDLDWSFDNKFIAGALDDNGKIELFSKE 95

Query: 238 IDKPVVKIL-------QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK--------PE 282
            +   + +         +   NTL F+    N+ A+AG + ++ ++D+ K        P 
Sbjct: 96  ENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPS 155

Query: 283 APIHSMSGHHDSVTSLEFAPHKDGILCS-GSSDRRVLIWDL 322
           AP  +MS   D + S+ +      +  S G +     IWDL
Sbjct: 156 APGIAMS-TQDEIKSVSWNKSLAHVFASAGDTTTYASIWDL 195

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 6/149 (4%)

Query: 175 GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIH 234
           G ++S S D  + +WD  SG+     +   H   V + ++      L  ++S D +  + 
Sbjct: 229 GLIVSASKDNLVKLWDPRSGQCISTIIKFKHT--VLKTRFQPTRGNLLAAISKDKSCRVF 286

Query: 235 DKRIDKPVVKILQSE-PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP-EAPIHSMSGHH 292
           D R     +  ++ E  Y TL ++  + ++F     D  ++ +DL +  E P H +   H
Sbjct: 287 DIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAH 346

Query: 293 D-SVTSLEFAPHKDGILCSGSSDRRVLIW 320
           D  VTS+ + P  + IL S S DR +  W
Sbjct: 347 DKCVTSMAYNPAGN-ILASASKDRTIRFW 374

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 93/210 (44%), Gaps = 23/210 (10%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +G+    +  + H+  +  C WH +   +  S S D+ + + D
Sbjct: 188 KFVTCSDDNVLKIWNFSNGQVE--RTLSGHHWDIKSCDWHPEMGLIV-SASKDNLVKLWD 244

Query: 236 KRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            R  + +  I++ + +  L   F     NL AA   D   +++D+R     +  +    D
Sbjct: 245 PRSGQCISTIIKFK-HTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVD 303

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            +T L + P  + +   G+ D  +  +DL Q          D   P  ++ +A H   V 
Sbjct: 304 YMT-LTWNPINESMFTVGNYDGAMKYFDLLQ----------DLEGPSHVIPYA-HDKCVT 351

Query: 354 DFSCSP--NIPWLMASVEEENVVQIWKASK 381
             + +P  NI   +AS  ++  ++ W  +K
Sbjct: 352 SMAYNPAGNI---LASASKDRTIRFWTRAK 378

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 72/144 (50%), Gaps = 13/144 (9%)

Query: 184 GSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVV 243
           G + I+DV   KN  ++  + H + V    W+     +  S S D  ++  D R  +P  
Sbjct: 340 GIVEIYDVL--KNKCIRTLSGHVDRVACLSWNNH---VLSSGSRDRKILHRDVRAPEPFF 394

Query: 244 KILQSEPYNTLAFSKH-SSNLFAAAGTDSQVQLYD--LRKPEAPIHSMSGHHDSVTSLEF 300
           + + +          + + N  A+ G D+ V +YD  LR+P   + SM  H  +V ++ +
Sbjct: 395 EQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYDGTLRQP---MLSMEEHTAAVKAMAW 451

Query: 301 APHKDGILCS--GSSDRRVLIWDL 322
           +PH  G+L +  G++D+++ IW++
Sbjct: 452 SPHTRGVLATGGGTADKKLKIWNI 475

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 11/165 (6%)

Query: 162 ENGYGLNFSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S +  G  L+    +G + I+DV   K   ++  + H + V    W+     
Sbjct: 292 ENEY-TSLSWVGAGSHLAIGQANGLVEIYDVV--KRKCIRTLSGHKDRVACLSWNNH--- 345

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFS-KHSSNLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R+     + +++             SN  A+ G D+ V +YD  
Sbjct: 346 ILTSGSRDRRILHRDVRVPDSFFERIETHSQEVCGLKWNPESNKLASGGNDNMVYVYD-G 404

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCS--GSSDRRVLIWDL 322
              +P+     H  +V +L ++PHK GIL S  G++DR++  W++
Sbjct: 405 TSRSPVLKFEEHTAAVKALAWSPHKRGILASGGGTADRKLKTWNV 449

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 77/157 (49%), Gaps = 9/157 (5%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
            +++ ++DG I +WDV SG    +     H   V + ++ +K   LF S S D T+   D
Sbjct: 355 RVVTAAEDGKIKVWDVVSG--FCLATLDEHTAAVTQVQFAKKGQVLF-SASLDGTVKAWD 411

Query: 236 --KRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
             +  +  V    +   +N+LA       + A +  +  + ++ ++  +  + S+SGH  
Sbjct: 412 LIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQTGQL-LDSLSGHEG 470

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ 330
            V+ L F+  ++G+L S S D+ + IW +F  G  QQ
Sbjct: 471 PVSCLAFS-QENGVLASASWDKTIRIWYIF--GRSQQ 504

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 79/197 (40%), Gaps = 45/197 (22%)

Query: 125 PFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDG 184
           P  P+ + + S   K  +++ S+ S +A+      H      +NF   +P  L +CS D 
Sbjct: 79  PSKPSWVVSTSNQ-KALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDA 137

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
            +  WD+ S +               + KW+ K+P                         
Sbjct: 138 YVHAWDMRSSRRAFYSASVWSAGAA-QVKWNFKNP------------------------- 171

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
                  N +A S HS+++F          ++DLRK   P+H + GH +SV S++F+   
Sbjct: 172 -------NVMA-SAHSNDIF----------IWDLRKGCMPLHILKGHANSVNSIDFSRFN 213

Query: 305 DGILCSGSSDRRVLIWD 321
           +  + S S+D  V  WD
Sbjct: 214 ETEIMSSSNDGTVKFWD 230

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 127 NPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSI 186
           NPN++A+ + S  +F++D  K            H  +   ++FS  +  E++S S+DG++
Sbjct: 170 NPNVMAS-AHSNDIFIWDLRKGCMPLHI--LKGHANSVNSIDFSRFNETEIMSSSNDGTV 226

Query: 187 AIWDVCSGKNTPVKV 201
             WD       P++ 
Sbjct: 227 KFWDYSVNDKEPLRT 241

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 76/197 (38%), Gaps = 16/197 (8%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVIS 173
           H   +T   + P NP ++AT S    V  +D      +  +A  S        + ++  +
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSA--SVWSAGAAQVKWNFKN 170

Query: 174 PGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLII 233
           P  +++ +    I IWD+  G   P+ +   H N VN   +   +     S S+D T+  
Sbjct: 171 PN-VMASAHSNDIFIWDLRKG-CMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKF 228

Query: 234 HDKRID--KPVVKILQSEPYNT---LAFSKHSSNLFAAAGTDSQVQLYDLRKPEA----- 283
            D  ++  +P+  ++   P +    L F +    +    G +S          ++     
Sbjct: 229 WDYSVNDKEPLRTVVTDFPVSKGRYLPFGRGFCVMPMTGGNNSVYLSSSTTSNDSGPISK 288

Query: 284 --PIHSMSGHHDSVTSL 298
             PI+   GH D V+  
Sbjct: 289 FQPIYVFKGHADRVSDF 305

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 78/190 (41%), Gaps = 26/190 (13%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN--------------TPVKVD 202
           F  H       +F   +   + S SDD  I IWD+                    PVK  
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFL 136

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
           T H   V    +H  +  +  S S D T+ + +    K ++ +   +   +++FS +  N
Sbjct: 137 TGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDGN 195

Query: 263 LFAAAGTDSQVQLYDLRKP----EAPIHSMSGHHDSVTSLEFAPHKDGILCSGS---SDR 315
             A    D +++++++R+     E P H+ + +   V    +  + D +  +G    SDR
Sbjct: 196 YLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVV----WLGNSDRLATTGFSKLSDR 251

Query: 316 RVLIWDLFQI 325
           ++ IWD F I
Sbjct: 252 QIGIWDAFNI 261

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 4/93 (4%)

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVP---ELLMM 344
             GH   V   +F P  D  + SGS D ++ IWD+ +        D +DG P   + +  
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVD-EDGEPIDIKPVKF 135

Query: 345 HAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             GH   V      P    ++AS   +  V++W
Sbjct: 136 LTGHARKVGHVLYHPVAENVLASSSGDYTVKLW 168

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 23/184 (12%)

Query: 179 SCSDDGSIAIWDVCSGKNTPVKVDTS-HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKR 237
           + S+D ++ IWD+ SGK   +K+  + H   V +    ++ P+LF S S+D  +   D  
Sbjct: 133 TGSNDTTVKIWDLASGK---LKLTLAGHVMTVRDVAISQRHPYLF-SASEDKMVKCWDLE 188

Query: 238 IDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVT 296
            ++ +++              H + +L A+AG D  V+L+D+R   A + ++ GH   +T
Sbjct: 189 KNQ-IIRDYHGHLSGVHTVDIHPTLDLIASAGRDGVVKLWDIRSRTA-VMTLIGHKSPIT 246

Query: 297 SLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFS 356
            +   P    ++ S S+D  V +WD+              G    ++ H  HK  V DFS
Sbjct: 247 KVHCLPVNPQVVSS-STDATVRLWDVTA------------GKSYKILTH--HKRSVRDFS 291

Query: 357 CSPN 360
             P+
Sbjct: 292 LHPS 295

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 70/160 (43%), Gaps = 19/160 (11%)

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           F + S+D+T+ I D    K  + +         +A S+    LF+A+  D  V+ +DL K
Sbjct: 131 FATGSNDTTVKIWDLASGKLKLTLAGHVMTVRDVAISQRHPYLFSAS-EDKMVKCWDLEK 189

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
            +  I    GH   V +++  P  D ++ S   D  V +WD+    A             
Sbjct: 190 NQI-IRDYHGHLSGVHTVDIHPTLD-LIASAGRDGVVKLWDIRSRTA------------- 234

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
            +M   GHKSP+    C P  P +++S   +  V++W  +
Sbjct: 235 -VMTLIGHKSPITKVHCLPVNPQVVSS-STDATVRLWDVT 272

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 19/113 (16%)

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPE 340
           P   I  ++GH   V  L+  P  +    +GS+D  V IWDL                 +
Sbjct: 104 PWKLIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDL--------------ASGK 149

Query: 341 LLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSPYIPRDYN 393
           L +  AGH   V D + S   P+L  S  E+ +V+ W   K      I RDY+
Sbjct: 150 LKLTLAGHVMTVRDVAISQRHPYLF-SASEDKMVKCWDLEKN----QIIRDYH 197

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 95/237 (40%), Gaps = 33/237 (13%)

Query: 129 NLIATISGSGKVFLYD-RSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIA 187
           +LIA+    G V L+D RS+ +   L      HK     ++   ++P +++S S D ++ 
Sbjct: 213 DLIASAGRDGVVKLWDIRSRTAVMTLIG----HKSPITKVHCLPVNP-QVVSSSTDATVR 267

Query: 188 IWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ 247
           +WDV +GK+   K+ T H   V +   H     +  + +DD   I   K  +  ++    
Sbjct: 268 LWDVTAGKS--YKILTHHKRSVRDFSLHPSEFSMVSACTDD---IRSWKLPEGALLTNFA 322

Query: 248 SEPYNTL-AFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG 306
           SE    +   S +  ++  A G D  +  YD +         SGH     + +  P    
Sbjct: 323 SESTGIINTLSVNQDDVLFAGGDDGMLSFYDYK---------SGHKYQTMATQEVP---- 369

Query: 307 ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363
              S  S+R +L     + G      +AD  +   +     H +P       P +PW
Sbjct: 370 --GSLESERAILTSAFDRTGLRLITGEADKSIK--VWKQIPHSTP----ETHPGLPW 418

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 33/151 (21%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD----STLI 232
           L+S S D +I  WD+ +GK     + T   N  N       +   F  +S +    S L+
Sbjct: 515 LVSGSQDRTIRQWDLTTGKC----LQTIDINFANRG-----TSGGFSKISSNNPRSSILL 565

Query: 233 IHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHH 292
            H+   D PV+  LQ   Y+            A    D  V+L+DLR  +  I ++ GH 
Sbjct: 566 THN---DPPVIGALQC--YDAA---------MATGTKDGLVRLWDLRSGQV-IRTLEGHT 610

Query: 293 DSVTSLEFAPHKDGI-LCSGSSDRRVLIWDL 322
           D+VT L+F    D + L +GS DR + IWDL
Sbjct: 611 DAVTGLQF----DSVNLVTGSLDRSIRIWDL 637

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 16/69 (23%)

Query: 267 AGTDSQVQLYDLRKPEA-------------PIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
            G D+ ++L+D+ K E               +H+   H D +T+L F  +    L SGS 
Sbjct: 464 GGRDALLKLWDIEKAEELYNDGATEGEEELCVHTFDAHVDEITALHFEGNS---LVSGSQ 520

Query: 314 DRRVLIWDL 322
           DR +  WDL
Sbjct: 521 DRTIRQWDL 529

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 77/166 (46%), Gaps = 28/166 (16%)

Query: 214 WHEKSPFLFGSVSDDSTLIIHDKRID-KPV-VKILQSEPYNTLAFSKHSSNLFAAAGTDS 271
           W  K+  L   + D  T    D +++ KP  V  LQ  P          S+L A    D 
Sbjct: 51  WDIKTGELIAQLQDGITPGSADSKVNTKPAEVTFLQYHP---------DSSLLAVGYRDG 101

Query: 272 QVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQ 331
            ++++DL      I+ ++GH  S+T L+F  +    L SGSSD  ++IWDL         
Sbjct: 102 NIKVWDLVSKTVLIN-LNGHKSSITVLKFDVNCTR-LVSGSSDSNIIIWDLV-------- 151

Query: 332 EDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             ++ G+ +L      HK  ++D     +  WL+ SV ++ ++++W
Sbjct: 152 --SEVGICKL----RSHKDRISDLYVDDDFNWLL-SVSKDGLIKVW 190

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 89/213 (41%), Gaps = 24/213 (11%)

Query: 131 IATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELL-SCSDDGSIAIW 189
           +AT S    + +Y+   DS   LT   + H+   + ++++    G +L SCS DG + IW
Sbjct: 24  LATCSSDKTIKIYEIDGDSHKLLTT-LTGHEGPVWRIDWAHPKFGTILASCSYDGKVIIW 82

Query: 190 DVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVSDDSTLIIHDKR--IDKPVVKI 245
              +G  + + V + H+  VN  KW  HE    L  + SD    ++  K      P+V  
Sbjct: 83  KEENGTWSQIAVHSVHSASVNSVKWAPHEYGAVLLAASSDGKISVVEFKENGTQNPMVLD 142

Query: 246 LQSEPYNTLAFSKHSSN-------------LFAAAGTDSQVQLYDLRKPEAPI---HSMS 289
             +   N+ A++  +                F   G D+ V+++   +         ++ 
Sbjct: 143 AHAVGVNSAAWAPATIQSPKNPTEKPLPLRRFVTGGADNLVKIWKFDQAANTYILEDTLE 202

Query: 290 GHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
           GH D V  + ++P       + S S DR  +IW
Sbjct: 203 GHSDWVRDVTWSPSVLLGSCIASVSQDRTCIIW 235

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 122/323 (37%), Gaps = 71/323 (21%)

Query: 114 HRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDS---DSALTAEFSFHKENGYGLNFS 170
           H + V    Y P N  +IAT S    + L+D SKD      AL     +     +     
Sbjct: 185 HFNWVLCVSYCP-NGEVIATGSMDNTIRLWD-SKDGKPLGDALRGHLKWITSLAWE-PIH 241

Query: 171 VISPGE---LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSD 227
           ++ PGE   L S S DG+I IWD+   +   +   + H N V+  KW  +     GS   
Sbjct: 242 LVKPGESPRLASASKDGTIRIWDIT--RRVCLYTMSGHTNSVSCIKWSGQGIIYSGS--H 297

Query: 228 DSTLIIHDKRIDKPVVKILQSEPY--NTLAFS-------------------------KHS 260
           D T+ + D   D   + IL+S  +  N L+ S                         K  
Sbjct: 298 DKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKAL 357

Query: 261 SN-------------LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG- 306
           +N             L   A  D  + L++  K   PI  M+GH   V  + F+P  DG 
Sbjct: 358 ANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP--DGR 415

Query: 307 ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMA 366
            + S S D  + +W            D  DG  + +    GH + V   + S +   L+ 
Sbjct: 416 YIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLV 460

Query: 367 SVEEENVVQIWKASKKLTSPYIP 389
           S  ++  +++W    +  S  +P
Sbjct: 461 SCSKDTTLKVWDVRTRKLSVDLP 483

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 81/162 (50%), Gaps = 14/162 (8%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           F+  +   +++ + D +  IWD      TP    T H N V  C  +  +  +  + S D
Sbjct: 151 FAPNTSSRMVTGAGDNTARIWDC--DTQTPKATLTGHFNWV-LCVSYCPNGEVIATGSMD 207

Query: 229 STLIIHDKRIDKPV-------VKILQSEPYNTLAFSK-HSSNLFAAAGTDSQVQLYDLRK 280
           +T+ + D +  KP+       +K + S  +  +   K   S   A+A  D  ++++D+ +
Sbjct: 208 NTIRLWDSKDGKPLGDALRGHLKWITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITR 267

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
               +++MSGH +SV+ ++++    GI+ SGS D+ V +WD+
Sbjct: 268 -RVCLYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDM 306

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 71/146 (48%), Gaps = 8/146 (5%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           +++ SDD ++ +W+     N P+   T H  +VN   +     ++  S S D+++ + D 
Sbjct: 374 MVTASDDFTMFLWNPLK-SNKPIARMTGHQKLVNHVAFSPDGRYIV-SASFDNSIKLWDG 431

Query: 237 RIDKPVVKILQSEPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
           R D   +   +    +    +  +   L  +   D+ ++++D+R  +  +  + GH D V
Sbjct: 432 R-DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHKDEV 489

Query: 296 TSLEFAPHKDG-ILCSGSSDRRVLIW 320
            +++++   DG  +CSG  D+ V IW
Sbjct: 490 YTVDWS--VDGKRVCSGGKDKMVRIW 513

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 69/295 (23%), Positives = 116/295 (39%), Gaps = 76/295 (25%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   TRA+   F+P+    L+A  S + +++ Y         L   F  H+
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRFEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               GL+F    P   +S  DD +I +W + +  N  +   T H + V    +H + P++
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSLDT--NKCLYTLTGHLDYVRTVFFHRELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP 281
             S SDD T+ I +                                        +  RK 
Sbjct: 111 I-SASDDQTIRIWN----------------------------------------WQNRKE 129

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF----------------QI 325
              I  ++GH+  V   +F P  D ++ S S D  + IWD+                 Q+
Sbjct: 130 ---IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQM 185

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
            A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++W+ S
Sbjct: 186 SAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 93/223 (41%), Gaps = 41/223 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V   ++H     +  S S D T+ I D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCAQFHPTDDLIV-SASLDETIRIWDI 166

Query: 236 ----KRIDKP-----------------------VVK-ILQSEPYNTLAFSKHSSNLFAAA 267
               KR   P                       VVK IL+         S H +     +
Sbjct: 167 SGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 268 GTD-SQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           G+D  QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ + +WDL + 
Sbjct: 227 GSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTLRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFSCSPNIP 362
              +Q +  +D        P + +  A H S +  F      P
Sbjct: 286 TPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP 328

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S SDD  + +W + + K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL--RKP 281
           SV +D TL + D     PV +  +      L  +    NLF AA  DS + ++ L   +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAA-HDSGIMVFKLDRERP 328

Query: 282 EAPIH 286
            + IH
Sbjct: 329 CSFIH 333

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 93/208 (44%), Gaps = 19/208 (9%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           + ++CSDD  + IW+  +G+    +V + H+  V  C WH +   L  S S D+ + + D
Sbjct: 179 KFVTCSDDNILKIWNFSNGQQE--RVLSGHHWDVKSCDWHPEMG-LIASASKDNLVKLWD 235

Query: 236 KRIDKPVVKILQSEPYNTLA--FSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHD 293
            R+ + +  IL+ + +  L   F     NL AA   D   +++D+R     +  +    D
Sbjct: 236 PRVGQCISTILKFK-HTVLKTRFQPTGGNLLAAISKDKSCRVFDIRHSLKELMVVRDEVD 294

Query: 294 SVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVN 353
            +T L + P  + +L     D  +  +D+ Q          D   P   + +A H   + 
Sbjct: 295 YMT-LLWNPINESMLTVACYDGSLKDFDVVQ----------DLKKPVHTIPYA-HDKCIT 342

Query: 354 DFSCSPNIPWLMASVEEENVVQIWKASK 381
             S +P +  ++AS  ++  ++ W  ++
Sbjct: 343 SLSYNP-VGHILASASKDRTIRFWTRAR 369

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 79/361 (21%), Positives = 137/361 (37%), Gaps = 54/361 (14%)

Query: 27  YDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNYLKIASVHLPDEVVSDVK 86
           +D V++  +++P   IQW+P            GT    T  + L+I SV   +++   + 
Sbjct: 96  WDSVAQASVIYPLSKIQWMPK-----------GTGKLATCSDSLRIRSVE--EQLHEQLN 142

Query: 87  CSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRS 146
            S      S         ++   R       VT   +   + NLI   S      ++D  
Sbjct: 143 LSLVKYGKSL-------GEVSNGRMLGQLPPVTSFDWNALDTNLILFSSIDTTCTVWDL- 194

Query: 147 KDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV-CSGKNT-------P 198
             + + +  +   H    +   F   S     SC  DGS+ ++D+ C   +T        
Sbjct: 195 -QASNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQ 253

Query: 199 VKVDTSHNNIVNECKWHEKSPFL---FGSVSDDSTLIIHDKRIDKPVVKILQSEPY--NT 253
           V+  T     V+    HE+   L     S +  S+       +D   +  L+  P+  N 
Sbjct: 254 VQGQTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNI 313

Query: 254 LAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
           LA  +  SN+         V + D+R P +P+  + GH   V  L++ P K  +L +   
Sbjct: 314 LATIQQDSNV---------VIILDMRYPGSPMLLLEGHAAPVNQLKWHPSKPNVLATCGD 364

Query: 314 DRRVLIWDLFQI--------GAEQQQEDADDGVPELL--MMHAGHKSPVNDFSCSPNIPW 363
           D ++L WDL ++        G  QQ+      V  L    M    +  VN+F   P+  W
Sbjct: 365 DCQILYWDLLELLSASQVWTGLTQQRWSTTSTVRTLETPQMSYTAQYEVNNFVWRPSGDW 424

Query: 364 L 364
           +
Sbjct: 425 I 425

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 75/351 (21%), Positives = 131/351 (37%), Gaps = 91/351 (25%)

Query: 87  CSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRS 146
           C   +    KE      + ++      H D V +A        +     G+GK+      
Sbjct: 68  CDRVAIGSYKEDAFNKLTVLQATPDLSHWDSVAQASVIYPLSKIQWMPKGTGKL---ATC 124

Query: 147 KDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHN 206
            DS    + E   H++    LN S++  G+ L    +G +       G+  PV   TS +
Sbjct: 125 SDSLRIRSVEEQLHEQ----LNLSLVKYGKSLGEVSNGRML------GQLPPV---TSFD 171

Query: 207 NIVNECKWH--EKSPFLFGSVSDDSTLIIHDKRIDKPVVKIL---QSEPYNTLAFSKHSS 261
                  W+  + +  LF S+  D+T  + D +    V   L    SE ++   F   SS
Sbjct: 172 -------WNALDTNLILFSSI--DTTCTVWDLQASNYVKTQLIAHDSEVFDA-KFLTQSS 221

Query: 262 NLFAAAGTDSQVQLYDLR---------------KPEAP----IHSMSGHHD--------- 293
           NLFA+ G D  V+++DLR               + + P    +H+++ H           
Sbjct: 222 NLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQ 281

Query: 294 ------------------SVTSLEFAPHKDGILCSGSSDRRV-LIWDLFQIGAEQQQEDA 334
                             ++  LE +P    IL +   D  V +I D+   G+       
Sbjct: 282 SSALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGS------- 334

Query: 335 DDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTS 385
               P LL+   GH +PVN     P+ P ++A+  ++  +  W   + L++
Sbjct: 335 ----PMLLL--EGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSA 379

>Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {ON}
           complement(187786..188673) [888 nt, 296 aa]
          Length = 295

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 175 GELL-SCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVSDDSTL 231
           GE+L SCS DG I IW+   GK T +   + H+  VN  +W  HE    +  + SD +  
Sbjct: 67  GEILASCSFDGKIIIWEEVRGKWTMIDSLSVHSGSVNSIEWSPHEFGAIILATSSDGTVS 126

Query: 232 I--IHDKRIDKPVVKILQSEPYNTLAFS-----------KHSSNLFAAAGTDSQVQLY-- 276
           +  + D+++ KP++    +    + ++S           KH   +    G D  V+++  
Sbjct: 127 VTELKDRKLGKPIIINAHTLGVTSASWSPFVAVEEDGTTKHQQRI-VTGGIDKLVKIWKY 185

Query: 277 -DLRKPEAPIHSMSGHHDSVTSLEFAPH--KDGILCSGSSDRRVLIW 320
            D  K     H++  H   +  + ++P   +   + S S D+  ++W
Sbjct: 186 DDENKKYILEHTLEEHTGPIKDVSWSPTLLRKSYIASTSEDKNCIVW 232

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 97/228 (42%), Gaps = 58/228 (25%)

Query: 157 FSFHKENGYGLNFSVISPGE-LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWH 215
           F  H +    L+F     GE L+S S D ++  +D+ SGK       T   N        
Sbjct: 449 FDSHSDEITALSFD----GEYLISASRDKTVRQYDIISGKC----FQTLATN-------- 492

Query: 216 EKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQL 275
                 FGS+S  +  ++  +  + PVV  LQ   YNT   +           +D   +L
Sbjct: 493 ------FGSISKTNGDMLMSR--NSPVVGALQY--YNTALIT---------GSSDGIARL 533

Query: 276 YDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDAD 335
           +DLR  +  + SM GH+ ++TSL+F P K   L + S+D  + +WDL   G         
Sbjct: 534 WDLRIGKV-VRSMEGHNGAITSLQFDPIK---LTTSSTDGDIRVWDLRTAG--------- 580

Query: 336 DGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEE-ENVVQIWKASKK 382
                 L +H     PV  F  SP  P L+A + E E  ++I    KK
Sbjct: 581 -----WLELHPCGL-PVTSFDSSP--PGLLAVISEGEERIRIIDQQKK 620

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 16/94 (17%)

Query: 285 IHSM-SGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLM 343
           IHS  S H DS+T L+FA   + +  + + D  V IWDL                 E L 
Sbjct: 343 IHSFKSAHTDSITCLDFAKSWNTLCTAANYDNTVKIWDL--------------STTEQLG 388

Query: 344 MHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             +GHK+ +N    S N   LM    ++  V++W
Sbjct: 389 SFSGHKATINCLQMSNNNSLLMTG-SKDATVKVW 421

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 2/69 (2%)

Query: 254 LAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
           L F+K  + L  AA  D+ V+++DL   E  + S SGH  ++  L+ + + + +L +GS 
Sbjct: 357 LDFAKSWNTLCTAANYDNTVKIWDLSTTE-QLGSFSGHKATINCLQMS-NNNSLLMTGSK 414

Query: 314 DRRVLIWDL 322
           D  V +W++
Sbjct: 415 DATVKVWNI 423

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 116/295 (39%), Gaps = 76/295 (25%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   TRA+   F+P+    L+A  S + +++ Y         L   F  H+
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRFEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               GL+F    P   +S  DD +I +W + +  N  +   + H + V    +H + P++
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSLDT--NKCLYTLSGHLDYVRTVFFHRELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP 281
             S SDD T+ I +                                        +  RK 
Sbjct: 111 I-SASDDQTIRIWN----------------------------------------WQNRKE 129

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF----------------QI 325
              I  ++GH+  V   +F P  D ++ S S D  + IWD+                 Q+
Sbjct: 130 ---IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPSNNSFEEQL 185

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
            A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++W+ S
Sbjct: 186 NAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 103/246 (41%), Gaps = 44/246 (17%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V   ++H     +  S S D T+ I D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCAQFHPTDDLIV-SASLDETIRIWDI 166

Query: 236 ----KRIDKP-----------------------VVK-ILQSEPYNTLAFSKHSS-NLFAA 266
               KR   P                       VVK IL+         S H +  L  +
Sbjct: 167 SGLRKRHSAPSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           A  D QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ + +WDL + 
Sbjct: 227 ASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTLRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
              +Q +  +D        P + +  A H S +  F      P    SV  +N +    A
Sbjct: 286 TPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP---CSVIHQNQLFFVNA 342

Query: 380 SKKLTS 385
            K++ S
Sbjct: 343 EKQIQS 348

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S SDD  + +W + + K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL--RKP 281
           SV +D TL + D     PV +  +      L  +    NLF AA  DS + ++ L   +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKLDRERP 328

Query: 282 EAPIH 286
            + IH
Sbjct: 329 CSVIH 333

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 116/295 (39%), Gaps = 76/295 (25%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   TRA+   F+P+    L+A  S + +++ Y         L   F  H+
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRFEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               GL+F    P   +S  DD +I +W + +  N  +   + H + V    +H + P++
Sbjct: 54  GPVRGLDFHPTQPI-FVSAGDDYTIKVWSLDT--NKCLYTLSGHLDYVRTVFFHRELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKP 281
             S SDD T+ I +                                        +  RK 
Sbjct: 111 I-SASDDQTIRIWN----------------------------------------WQNRKE 129

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF----------------QI 325
              I  ++GH+  V   +F P  D ++ S S D  + IWD+                 Q+
Sbjct: 130 ---IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFEEQM 185

Query: 326 GAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
            A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++W+ S
Sbjct: 186 NAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 105/255 (41%), Gaps = 48/255 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V   ++H     +  S S D T+ I D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCAQFHPTDDLIV-SASLDETIRIWDI 166

Query: 236 ----KRIDKP-----------------------VVK-ILQSEPYNTLAFSKHSS-NLFAA 266
               KR   P                       VVK IL+         S H +  L  +
Sbjct: 167 SGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
           A  D QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ + +WDL + 
Sbjct: 227 ASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTLRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFSCSPNIPW------LMASVEEENV 373
              +Q +  +D        P + +  A H S +  F      P        +  V  E  
Sbjct: 286 TPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSFIHQNQLFFVNAEKQ 345

Query: 374 VQIWKASKKLTS-PY 387
           +Q +   K++ S PY
Sbjct: 346 IQSFNYQKRVASLPY 360

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S SDD  + +W + + K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL--RKP 281
           SV +D TL + D     PV +  +      L  +    NLF AA  DS + ++ L   +P
Sbjct: 270 SVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKLDRERP 328

Query: 282 EAPIH 286
            + IH
Sbjct: 329 CSFIH 333

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 132/320 (41%), Gaps = 56/320 (17%)

Query: 106 IKIVRKFEHRDEVTRARYAPFNPN----LIATISGSGKVFLYDRSKDSDSALTAEFSFHK 161
           +K++ KFE +   +RA+   F+P+    L+A  S + +++ Y         L   F  H+
Sbjct: 1   MKMLTKFESKS--SRAKGIAFHPSRPWVLVALFSSTIQLWDYRMG-----TLLHRFEDHE 53

Query: 162 ENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFL 221
               GL+F    P   +S  DD +I +W + +  N  +     H + V    +H + P++
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSLET--NKCLYTLQGHLDYVRTVFFHHELPWI 110

Query: 222 FGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDL--- 278
             S SDD T+ I + +  K +  +     +   A    + +L  +A  D  V+++D+   
Sbjct: 111 I-SASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPNEDLVVSASLDESVRVWDISGL 169

Query: 279 -RKPEAP-IHSM------------SGHHDSVTSLEFAPHKDGI-----------LCSGSS 313
            +K  AP   SM             G  D V       H  G+           + SGS 
Sbjct: 170 RKKHSAPGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSD 229

Query: 314 DRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENV 373
           DR+V +W + Q  A +            +    GH + V+     P+   L+ SV E+  
Sbjct: 230 DRQVKLWRMSQTKAWE------------VDTCRGHTNNVDCVIFHPHQN-LIISVGEDKT 276

Query: 374 VQIWKASKKLTSPYIPRDYN 393
           ++IW   K++      R+++
Sbjct: 277 LRIWDLDKRVPVKQFKREHD 296

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 69/158 (43%), Gaps = 23/158 (14%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S SDD  + +W +   K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSGSDDRQVKLWRMSQTKAWEVDTCRGHTNNVDCVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPV-VKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDL--R 279
           SV +D TL I D  +DK V VK  + E       + H + NLF AA  D+ + ++ L   
Sbjct: 270 SVGEDKTLRIWD--LDKRVPVKQFKREHDRFWLIAAHPNINLFGAAH-DTGIMVFKLDRE 326

Query: 280 KPEAPIH-------------SMSGHHDSVTSLEFAPHK 304
           +P + IH              +  +H  VTSL +   K
Sbjct: 327 RPCSFIHQNQLIFINKEKQLQIFDYHKRVTSLPYVSLK 364

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 71/151 (47%), Gaps = 33/151 (21%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD----STLI 232
           L+S S D +I  WD+ +GK     +D +  N          +   F ++S +    S L+
Sbjct: 517 LVSGSQDRTIRQWDLRTGKCLQT-IDINFTN--------RGTSDGFSTISSNNPRSSVLL 567

Query: 233 IHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHH 292
            H+   D PV+  LQ   Y+            A    D  V+L+DLR  +  + ++ GH 
Sbjct: 568 THN---DPPVIGALQC--YDAA---------MATGTKDGIVRLWDLRMGQV-VRTLEGHT 612

Query: 293 DSVTSLEFAPHKDGI-LCSGSSDRRVLIWDL 322
           D+VT L+F    D + L +GS DR + IWDL
Sbjct: 613 DAVTGLQF----DAVNLVTGSLDRSIRIWDL 639

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 16/75 (21%)

Query: 261 SNLFAAAGTDSQVQLYDLRKPEAP-------------IHSMSGHHDSVTSLEFAPHKDGI 307
           S+     G D+ ++L+DL K E               +H+   H D +T+L F  +    
Sbjct: 460 SSSLITGGRDALLKLWDLDKAEEQYFEGVPEEDEELCLHTFDAHVDEITALHFEGNS--- 516

Query: 308 LCSGSSDRRVLIWDL 322
           L SGS DR +  WDL
Sbjct: 517 LVSGSQDRTIRQWDL 531

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (47%), Gaps = 11/173 (6%)

Query: 167 LNFSVISP--GELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGS 224
           LN    SP    +++ S+DG I IWDV SG    +     H + V+  ++ ++   LF S
Sbjct: 344 LNGLTYSPDGSRVVTASEDGKIKIWDVVSG--FCLATFEEHTSAVSAVQFSKRGQVLF-S 400

Query: 225 VSDDSTLIIHDKRIDKPVVKILQSE--PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPE 282
            S D T+   D    +       +E   +N+LA       + A +  + ++Q++ ++  +
Sbjct: 401 ASLDGTVRAWDLIRYRNFRTFTAAERIQFNSLAVDPSGEVVCAGSIDNYEIQVWSVQTGQ 460

Query: 283 APIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDAD 335
             +  ++GH   V+ L F+  ++ +L S S D+ + +W +F  G  QQ E  D
Sbjct: 461 L-LDCLAGHEGPVSCLAFS-QENNVLASASWDKTIRVWSIF--GRSQQVEPID 509

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 83/196 (42%), Gaps = 23/196 (11%)

Query: 205 HNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDK-PVVKILQSEPYNTLAFSKHSSNL 263
           H+  +    W+  S  L  S ++D+ + +H  +  +     +LQ      +    H SN 
Sbjct: 228 HDGKIGGLDWN-TSYDLIVSGAEDALVKLHTYKEGRLETAAVLQGHEGRVVNVKFHPSNK 286

Query: 264 F-AAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWD 321
           F A+A  D   +L+D+ +  A I    GH   V +L F   +DG +LCSG  D   +IWD
Sbjct: 287 FIASASFDQTWRLWDV-ETGAEIQLQEGHAKEVYALGF--QQDGALLCSGGLDNTAIIWD 343

Query: 322 LFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASK 381
           L                 + +M   GH  P+     SPN    +A+   + ++ IW   K
Sbjct: 344 LRS--------------GKSIMTLNGHAKPIYCLDWSPN-GHEVATGGGDGLINIWDLRK 388

Query: 382 KLTSPYI-PRDYNIRS 396
             T P I P   NI S
Sbjct: 389 AQTPPNILPAHSNIVS 404

>Ecym_4644 Chr4 (1256560..1257447) [888 bp, 295 aa] {ON} similar to
           Ashbya gossypii ACR199C
          Length = 295

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 70/171 (40%), Gaps = 23/171 (13%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L SCS DG + IW   +G+ + +     H+  VN  KW  HE  P L  + S
Sbjct: 66  FGVI----LASCSYDGKVLIWKEENGRWSQIATSEVHSASVNSIKWAPHEYGPLLLCASS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAFS--------KHSSNL--FAAAGTDSQVQ 274
           D    ++  K      P++    +   N   ++        +H   L   A  G D+ V+
Sbjct: 122 DGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIEEDGQHPQQLRRIATGGADNLVK 181

Query: 275 LYDLRKPEAPI---HSMSGHHDSVTSLEFAPH--KDGILCSGSSDRRVLIW 320
           ++             ++SGH D V  + ++P       L + S DR  +IW
Sbjct: 182 IWKFNSESNTYLLEDTLSGHSDWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 195 KNTPVKVDT--SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQ---SE 249
           KN    +DT   H   V++ K H    +L GS S D+T  + D  I+K    +LQ   S+
Sbjct: 262 KNDLTSIDTLKGHQGRVSDVKLHPLGKYL-GSSSFDNTWRLWD--IEKKKEILLQEGHSK 318

Query: 250 PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILC 309
              +LAF    S L A AG DS   ++DLR  +  I ++ GH   + SL++AP+    L 
Sbjct: 319 EIFSLAFHTDGS-LTATAGFDSIGMIWDLRSGK-NIMNLIGHAKPIYSLDWAPNGYQ-LA 375

Query: 310 SGSSDRRVLIWDL 322
           +GS D  + IWDL
Sbjct: 376 TGSGDGTIKIWDL 388

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 86/202 (42%), Gaps = 20/202 (9%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L S S D +  +WD+   K   + +   H+  +    +H     L  +   DS  +I D 
Sbjct: 290 LGSSSFDNTWRLWDIE--KKKEILLQEGHSKEIFSLAFHTDGS-LTATAGFDSIGMIWDL 346

Query: 237 RIDKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
           R  K ++ ++  ++P  +L ++ +   L   +G D  ++++DLR  E+   S+  H + V
Sbjct: 347 RSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSG-DGTIKIWDLRNKESNCASIFAHKNLV 405

Query: 296 TSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDF 355
           TS+++  +  G + S   D+ + I               D    E +    GH   +   
Sbjct: 406 TSVQYEKNNGGFVFSAGYDKLIKI--------------HDSKTYESVATLEGHTEKILTL 451

Query: 356 SCSPNIPWLMASVEEENVVQIW 377
             SP I  L+ S   +  V+IW
Sbjct: 452 DTSP-ISNLIVSSGWDRTVKIW 472

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 52/103 (50%), Gaps = 3/103 (2%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
           +L + S DG+I IWD+ + ++    +  +H N+V   ++ + +     S   D  + IHD
Sbjct: 373 QLATGSGDGTIKIWDLRNKESNCASI-FAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHD 431

Query: 236 KRIDKPVVKI-LQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD 277
            +  + V  +   +E   TL  S   SNL  ++G D  V+++D
Sbjct: 432 SKTYESVATLEGHTEKILTLDTSP-ISNLIVSSGWDRTVKIWD 473

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 86/212 (40%), Gaps = 22/212 (10%)

Query: 185 SIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK 244
           +I +WD   G  T +     H   V    +H   P LF S  DD T+ +      K +  
Sbjct: 34  TIQLWDYRMG--TLLHRFEDHEGPVRGIDFHPTQP-LFVSAGDDYTIKVWSLETKKCLFT 90

Query: 245 ILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHK 304
           +     Y    F  H      +   D  +++++ +     I  ++GH+  V   +F P +
Sbjct: 91  LNGHLDYVRTVFFHHELPWIISCSDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPSE 149

Query: 305 DGILCSGSSDRRVLIWDL--------------FQIGAEQQQEDADDGVPELLM--MHAGH 348
           D ++ S S D  V +WD+              F+     QQ   D G  E ++  +  GH
Sbjct: 150 D-LVVSASLDETVRVWDISGLRKKHSAPGASSFEEQMIAQQNLLDGGFGECVVKFILEGH 208

Query: 349 KSPVNDFSCSPNIPWLMASVEEENVVQIWKAS 380
              VN  S  P +P L+ S  ++  V+IW+ S
Sbjct: 209 TRGVNWASFHPTLP-LIVSGGDDRQVKIWRMS 239

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 105/255 (41%), Gaps = 46/255 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI---- 232
           ++SCSDD +I IW+  + K   +   T HN+ V   ++H     +  +  D++  +    
Sbjct: 110 IISCSDDQTIRIWNWQNRKE--IACLTGHNHFVMCAQFHPSEDLVVSASLDETVRVWDIS 167

Query: 233 -----------------------IHDKRIDKPVVK-ILQSEPYNTLAFSKHSS-NLFAAA 267
                                  + D    + VVK IL+         S H +  L  + 
Sbjct: 168 GLRKKHSAPGASSFEEQMIAQQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLPLIVSG 227

Query: 268 GTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D QV+++ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ +  WDL +  
Sbjct: 228 GDDRQVKIWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTIRTWDLDKRT 286

Query: 327 AEQQQEDADDGV------PELLMMHAGHKSPVNDFS------CSPNIPWLMASVEEENVV 374
             +Q +  +D        P + +  A H S V  F       CS      +  V  E  V
Sbjct: 287 PVKQFKRENDRFWLIRAHPNINLFGAAHDSGVMVFKLDRERPCSVINQNQLIFVNNEKQV 346

Query: 375 QIWKASKKLTS-PYI 388
           Q +   KK+ S PY+
Sbjct: 347 QTFDYHKKIASLPYV 361

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 4/117 (3%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S  DD  + IW + + K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKIWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           SV +D T+   D     PV +  +      L  +  + NLF AA  DS V ++ L +
Sbjct: 270 SVGEDKTIRTWDLDKRTPVKQFKRENDRFWLIRAHPNINLFGAA-HDSGVMVFKLDR 325

>Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 21/165 (12%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVSDDSTLIIH 234
           L SCS DG + IW   +G+ + + V   H+  VN  +W  HE  P L  + SD    ++ 
Sbjct: 70  LASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVE 129

Query: 235 DKR--IDKPVVKILQSEPYNTLAFS--------KHS----SNLFAAAGTDSQVQLYDLRK 280
            K      P++    +   N+ +++        +HS    S  F   G D+ V+++    
Sbjct: 130 FKENGTTSPIIIDAHAIGVNSASWAPATVEEDGEHSGAKESRKFVTGGADNLVKVWKYNS 189

Query: 281 PEAPI---HSMSGHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
                    ++ GH D V  + ++P       L S S DR  +IW
Sbjct: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 90/222 (40%), Gaps = 32/222 (14%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW-HEKSPFLFGSVSDDSTLII-- 233
           L +CS D +I I++V    +  V   T H   V    W H K   +  S S D  ++I  
Sbjct: 24  LATCSSDKTIKIFEVEGETHKLVDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83

Query: 234 -HDKRIDKPVVKILQSEPYNTLAFSKHSSN-LFAAAGTDSQVQLYDLRK--PEAPIHSMS 289
             + R  +  V  + S   N++ ++ H    L   A +D +V + + ++    +PI  + 
Sbjct: 84  EENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI-IID 142

Query: 290 GHHDSVTSLEFAP---HKDG---------ILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
            H   V S  +AP    +DG            +G +D  V +W        +   DA   
Sbjct: 143 AHAIGVNSASWAPATVEEDGEHSGAKESRKFVTGGADNLVKVW--------KYNSDAQTY 194

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPW--LMASVEEENVVQIW 377
           V E  +   GH   V D + SP +     +ASV ++    IW
Sbjct: 195 VLESTL--EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234

>ACR199C Chr3 complement(698881..699768) [888 bp, 295 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR208W
           (SEC13)
          Length = 295

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 74/172 (43%), Gaps = 25/172 (14%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVS 226
           F VI    L SCS DG + IW   +G+ + +     H+  VN  KW  HE  P L  S S
Sbjct: 66  FGVI----LASCSYDGKVLIWKEENGRWSQIAAYEVHSASVNSVKWAPHEYGPLLLCSSS 121

Query: 227 DDSTLIIHDKR--IDKPVVKILQSEPYNTLAFS--------KHSSNL--FAAAGTDSQVQ 274
           D    ++  K      P++    +   N   ++        + S +L   A  G D+ V+
Sbjct: 122 DGKFSVVEFKENGTTSPIIIDAHAIGVNAACWAPATIEDDGQQSQHLRRIATGGADNLVK 181

Query: 275 LYDLRKPEAPIH----SMSGHHDSVTSLEFAPH--KDGILCSGSSDRRVLIW 320
           ++    PEA  +    +++ H D V  + ++P       L + S DR  +IW
Sbjct: 182 IWKYN-PEANTYLLEDTLAAHADWVRDVAWSPSVLPRAYLATVSQDRTCIIW 232

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/158 (22%), Positives = 75/158 (47%), Gaps = 12/158 (7%)

Query: 183 DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPV 242
           +G + I+D+   K   ++  + H + V    W+     +  S S D  ++  D R+ +P 
Sbjct: 312 NGLVEIYDIV--KRKCIRTLSGHMDRVACLSWNN---HILTSGSRDRKILHRDVRMPEPY 366

Query: 243 VKILQSEPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFA 301
            + +++          ++  N  A+ G D+ V +YD      P   ++ H  +V ++ ++
Sbjct: 367 FEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYD-GTSRKPTLKLAEHTAAVKAIAWS 425

Query: 302 PHKDGILCS--GSSDRRVLIWDLFQIGAEQQQEDADDG 337
           PHK GIL +  G++D+++ IW+   +    +  D D G
Sbjct: 426 PHKRGILATGGGTADKKMKIWN---VNTSTKLRDIDTG 460

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 76/162 (46%), Gaps = 14/162 (8%)

Query: 169 FSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDD 228
           F+  S   +++ + D +  IWD C    TP    T H N V    W      +  + S D
Sbjct: 151 FAPNSSSRMVTGAGDNTARIWD-CD-TQTPKATLTGHTNWVLCVSWCPNGEVI-ATGSMD 207

Query: 229 STLIIHDKRIDKPV-------VKILQSEPYNTLAFSKHSSN-LFAAAGTDSQVQLYDLRK 280
           +T+ + + +  KPV       +K + S  +  +   K       A+A  D  ++++D  +
Sbjct: 208 NTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASASKDGTIKIWDTSR 267

Query: 281 PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDL 322
               ++++SGH +SV+ +++     GIL SGS D+ V  WD+
Sbjct: 268 -RVCLYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDM 306

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 93/255 (36%), Gaps = 62/255 (24%)

Query: 176 ELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD 235
            L S S DG+I IWD  + +   +   + H N V+  KW  +     GS   D T+   D
Sbjct: 250 RLASASKDGTIKIWD--TSRRVCLYTLSGHTNSVSCIKWGGQGILYSGS--HDKTVRAWD 305

Query: 236 KRIDKPVVKILQSEPY--NTLAFSK----------HSS---------------------- 261
              +   + +L+S  +  N L+ S           H+                       
Sbjct: 306 MNSEGRCINVLKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVK 365

Query: 262 ------NLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDG-ILCSGSSD 314
                  L   A  D  + L++  K   P+  M+GH   V  + F+P  DG  + S S D
Sbjct: 366 KNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP--DGRYIVSASFD 423

Query: 315 RRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVV 374
             + +W            D  DG  + +    GH + V   + S +   L+ S  ++  +
Sbjct: 424 NSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTL 468

Query: 375 QIWKASKKLTSPYIP 389
           ++W    +  S  +P
Sbjct: 469 KVWDVRTRKLSVDLP 483

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 70/146 (47%), Gaps = 8/146 (5%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           +++ SDD ++ +W+       P+   T H  +VN   +     ++  S S D+++ + D 
Sbjct: 374 MVTASDDFTMFLWNPLK-STKPLGRMTGHQKLVNHVAFSPDGRYIV-SASFDNSIKLWDG 431

Query: 237 RIDKPVVKILQSEPYNTLAFSKHS-SNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSV 295
           R D   +   +    +    +  +   L  +   D+ ++++D+R  +  +  + GH D V
Sbjct: 432 R-DGKFISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSV-DLPGHKDEV 489

Query: 296 TSLEFAPHKDG-ILCSGSSDRRVLIW 320
            +++++   DG  +CSG  D+ V IW
Sbjct: 490 FTVDWS--VDGKRVCSGGKDKMVRIW 513

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 45/105 (42%), Gaps = 15/105 (14%)

Query: 275 LYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDA 334
           ++ +R       +++GH  ++    FAP+    + +G+ D    IW            D 
Sbjct: 126 IFKVRPVTRSSSAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIW------------DC 173

Query: 335 DDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKA 379
           D   P+  +   GH + V   S  PN   ++A+   +N +++W+ 
Sbjct: 174 DTQTPKATL--TGHTNWVLCVSWCPNGE-VIATGSMDNTIRLWEG 215

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (54%), Gaps = 6/93 (6%)

Query: 268 GTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIG 326
           G D+++ +YD+R   +P+ S +  HHD +T ++F P     L SGS+D    ++DL Q  
Sbjct: 122 GVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ-- 179

Query: 327 AEQQQEDADDGVPELLMMHA-GHKSPVNDFSCS 358
             Q+++DA   V     +H+ G  SP   ++ S
Sbjct: 180 --QEEDDALYQVINYASIHSCGWLSPRRIYTLS 210

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 68/143 (47%), Gaps = 5/143 (3%)

Query: 179 SCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238
           S S D +  +WDV + +   +++   H+  V    +      L  S   DS  ++ D R 
Sbjct: 283 SASFDTTWRLWDVETAQE--LQLQEGHSKEVYSLSFQPDGA-LICSGGLDSLAMVWDLRS 339

Query: 239 DKPVVKIL-QSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297
            K +V +   ++P   + +S +S  L A  G D  V ++DLRK E P   +  H   V+S
Sbjct: 340 GKNIVTLQGHAKPVYCVDWSSNSHQL-ATGGGDGVVNVWDLRKLEQPATKLLAHKSIVSS 398

Query: 298 LEFAPHKDGILCSGSSDRRVLIW 320
           L F  ++  +L SG  DR + ++
Sbjct: 399 LRFERNRGDVLVSGGYDRALNVY 421

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 88/221 (39%), Gaps = 27/221 (12%)

Query: 172 ISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDS 229
           ISP +    S S DG I+++D C    +   +  +H   V    W+ +   L     D+ 
Sbjct: 186 ISPNQSRFASASWDGGISVFD-CESLESLASL-PAHAGKVGGLDWNSEGSLLVTGADDNY 243

Query: 230 TLIIHDKRIDKPVVKI--LQSEPYNTLAFSKHSSNLF-AAAGTDSQVQLYDLRKPEAPIH 286
             +         +V +  L       +    H S+ + A+A  D+  +L+D+   +  + 
Sbjct: 244 VRLTRYNGESNGLVNVATLGGHENRVVNTVFHPSDKYVASASFDTTWRLWDVETAQ-ELQ 302

Query: 287 SMSGHHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMH 345
              GH   V SL F P  DG ++CSG  D   ++WDL                 + ++  
Sbjct: 303 LQEGHSKEVYSLSFQP--DGALICSGGLDSLAMVWDLRS--------------GKNIVTL 346

Query: 346 AGHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKLTSP 386
            GH  PV     S N   L A+   + VV +W   +KL  P
Sbjct: 347 QGHAKPVYCVDWSSNSHQL-ATGGGDGVVNVWDL-RKLEQP 385

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + ++D  I IWD+ + K   V +   H   +    +      L  S S D T+ I D 
Sbjct: 458 LATGAEDRLIRIWDIENRK--IVMILQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDL 514

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKPEAPIHSMSG 290
           R  +  + +   +   T+A S       AA   D  V+++D      + + ++   S +G
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 291 HHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHK 349
           H DSV S+ F   +DG  + SGS DR V +W+L     +   +  + G  E  + + GHK
Sbjct: 575 HKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHK 630

Query: 350 SPVNDFSCSPNIPWLMASVEEENVV 374
             V   + + N  ++++  ++  V+
Sbjct: 631 DFVLSVATTQNDEYILSGSKDRGVL 655

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 290 GHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHK 349
           GH D V S+    + + IL SGS DR VL W            D   G P  L+M  GH+
Sbjct: 628 GHKDFVLSVATTQNDEYIL-SGSKDRGVLFW------------DKKSGNP--LLMLQGHR 672

Query: 350 SPVNDFSCSPNIPW-----LMASVEEENVVQIWKASK 381
           + V   + +   P      + A+   +   +IWK  K
Sbjct: 673 NSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKK 709

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 91/205 (44%), Gaps = 14/205 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + ++D  I IWD+   K   V +   H   +    +      L  S S D T+ I D 
Sbjct: 454 LATGAEDRLIRIWDI--EKRKIVMILQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDL 510

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKPEAPIHSMSG 290
           R  +  + +   +   T+A S       AA   D  V+++D      + + ++   S +G
Sbjct: 511 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 570

Query: 291 HHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHK 349
           H DSV S+ F   +DG  + SGS DR V +W+L     +   +  + G  E  + + GHK
Sbjct: 571 HKDSVYSVVFT--RDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCE--VTYIGHK 626

Query: 350 SPVNDFSCSPNIPWLMASVEEENVV 374
             V   + + N  ++++  ++  V+
Sbjct: 627 DFVLSVATTQNDEYILSGSKDRGVL 651

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 111/290 (38%), Gaps = 38/290 (13%)

Query: 103 QSKIKIVRKFEHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKE 162
           + KIK    F  +D +    +   + N +    G G + L+D +          F  HK+
Sbjct: 49  RGKIKENNIFITQDCLFDLSWNELHENQVLVAQGDGSLRLFDTTLQKYP--IGIFKEHKK 106

Query: 163 NGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLF 222
                N+++I+ G  +S S DG++ +W       +P++               E+S    
Sbjct: 107 EVLSCNWNLITKGTFVSSSWDGAVKMW-------SPLR---------------EQSLLTL 144

Query: 223 GSVSDDSTLIIHDKRIDK--PVVKILQSEP-------YNTLAFSKHSSNLFAAAGTDSQV 273
              S + +  I+  +I K  P V   QS P            FS H +NL A    +S +
Sbjct: 145 LPKSSEQSSKINHNQIAKIPPHVNNNQSTPILQNKDCVYQAQFSPHDNNLIACCSGNSYI 204

Query: 274 QLYDLRKPEAPI--HSMSGHHDSVT-SLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQ 330
            L+D R+       +S   H    T +L+F  ++  +L S  +D  + IWD+  I     
Sbjct: 205 TLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMIRNNNS 264

Query: 331 QEDADDGVPELLM--MHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIWK 378
                     + M  +   H   V     SP+   L+ S   +   ++WK
Sbjct: 265 NNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTSKVWK 314

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 19/134 (14%)

Query: 254 LAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS 313
           + FS   +NLFA A +D+  +++   +   P+  ++GH   V  + F P+   +  +GSS
Sbjct: 808 VNFSPTGNNLFATASSDNTARVWSCDRV-YPVRILAGHLSDVDCVSFHPNGQYVF-TGSS 865

Query: 314 DRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENV 373
           D+   +WDL           + D V     +  GH S V   + SP+  WL ++  E+  
Sbjct: 866 DKTSRMWDL----------SSGDSV----RLFIGHSSAVTATAVSPDGRWL-STANEDGT 910

Query: 374 VQIWK--ASKKLTS 385
           + +W   + KKL S
Sbjct: 911 ITVWDIGSGKKLKS 924

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 15/91 (16%)

Query: 287 SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHA 346
           ++ GH D+V S+ F+P  +  L SGS D+   +W            D   G    L+ + 
Sbjct: 755 TLVGHSDAVYSVNFSPC-NRFLLSGSGDKTARLWST----------DTYKG----LVSYK 799

Query: 347 GHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
           GH+ P+ D + SP    L A+   +N  ++W
Sbjct: 800 GHEKPIWDVNFSPTGNNLFATASSDNTARVW 830

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 96/244 (39%), Gaps = 23/244 (9%)

Query: 153 LTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC 212
           +  +F        GL F    P  L++     SI +WD   G  T +     H   V   
Sbjct: 3   MLTKFESKSTRAKGLAFHPSRPWVLVALFS-SSIQLWDYRMG--TLLHKFEDHEGPVRGI 59

Query: 213 KWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQ 272
            +H   P LF S  DD T+ +      K +  +     Y    F         +A  D  
Sbjct: 60  DFHPTQP-LFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQT 118

Query: 273 VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF--------- 323
           +++++ +  +  I  ++GH+  V   +F P +D ++ S S D  V +WD+          
Sbjct: 119 IRIWNWQNRK-EIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAP 176

Query: 324 -------QIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQI 376
                  QI A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++
Sbjct: 177 STYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP-LIVSGGDDRQVKL 235

Query: 377 WKAS 380
           W+ S
Sbjct: 236 WRMS 239

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 108/256 (42%), Gaps = 48/256 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V    +H     +  S S D T+ + D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCADFHPTEDLVV-SASLDETVRVWDI 166

Query: 236 ----KRIDKP-----------------------VVK-ILQSEPYNTLAFSKHSS-NLFAA 266
               KR   P                       VVK IL+         S H +  L  +
Sbjct: 167 SGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLPLIVS 226

Query: 267 AGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
            G D QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ + +WDL + 
Sbjct: 227 GGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTIRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFS------CSPNIPWLMASVEEENV 373
              +Q +  +D        P + +  A H S +  F       CS      +  V +E  
Sbjct: 286 TPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSAINQNQLIFVNKEKQ 345

Query: 374 VQIWKASKKLTS-PYI 388
           VQ +  +KK+ S PY+
Sbjct: 346 VQTFDYNKKVVSLPYV 361

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 4/117 (3%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S  DD  + +W + S K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           SV +D T+ + D     PV +  +      L  +  + NLF AA  DS + ++ L +
Sbjct: 270 SVGEDKTIRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAA-HDSGIMVFKLDR 325

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 100/260 (38%), Gaps = 73/260 (28%)

Query: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189
           L+A   GS ++F  +  K       A F  HK+     N+++I+    LS S DG + +W
Sbjct: 77  LVAQGDGSLRLFDINLQKYP----IAIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVW 132

Query: 190 ----------------DVCSGKNTPVKVDTSHNNI------------------------- 208
                           D  +  NT   ++ S NN+                         
Sbjct: 133 STARQASLITLSPIHTDPTAIVNTKSNINPSLNNVSQPILHPRSTAIRQPVTSASMQGND 192

Query: 209 ----VNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVK--ILQSEPYNTLA--FSKHS 260
               + + ++    P +    S  S L + D R   P V+  IL    Y TL   F+K+ 
Sbjct: 193 NKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYETLTLDFNKYR 252

Query: 261 SNLFAAAGTDSQVQLYDL-------------------RKPEAPIHSMSGHHD-SVTSLEF 300
           S++ A +G D  ++++D+                   R+ + PI+ +   HD +V ++++
Sbjct: 253 SHIIATSGVDKAIKMWDMRFIPSTFSPQSTSTTPILSRRQQEPINEIINAHDLAVKTIKW 312

Query: 301 APHKDGILCSGSSDRRVLIW 320
           +PH   ++ S S D     W
Sbjct: 313 SPHHSNLMVSTSYDMTCKTW 332

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/166 (18%), Positives = 69/166 (41%), Gaps = 27/166 (16%)

Query: 113 EHRDEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVI 172
           ++++ + +A+++P +PN++A  SG+  + L+D  + + +      +        L+F+  
Sbjct: 192 DNKNCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYETLTLDFNKY 251

Query: 173 SPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLI 232
               + +   D +I +WD+                           P  F   S  +T I
Sbjct: 252 RSHIIATSGVDKAIKMWDM------------------------RFIPSTFSPQSTSTTPI 287

Query: 233 IHDKRIDKPVVKILQSE--PYNTLAFSKHSSNLFAAAGTDSQVQLY 276
           +  +R  +P+ +I+ +      T+ +S H SNL  +   D   + +
Sbjct: 288 L-SRRQQEPINEIINAHDLAVKTIKWSPHHSNLMVSTSYDMTCKTW 332

>Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W
           (REAL)
          Length = 297

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 67/165 (40%), Gaps = 21/165 (12%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW--HEKSPFLFGSVSDDSTLIIH 234
           L SCS DG + IW   +G+ + + V   H+  VN  +W  HE  P L  + SD    ++ 
Sbjct: 70  LASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVE 129

Query: 235 DKR--IDKPVVKILQSEPYNTLAFS------------KHSSNLFAAAGTDSQVQLYDLRK 280
            K      P++    +   N+ +++               S  F   G D+ V+++    
Sbjct: 130 FKENGTTSPIIIDAHAIGVNSASWAPATVEEDGEHNGAKESRKFVTGGADNLVKIWKYNS 189

Query: 281 PEAPI---HSMSGHHDSVTSLEFAPHK--DGILCSGSSDRRVLIW 320
                    ++ GH D V  + ++P       L S S DR  +IW
Sbjct: 190 DAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 90/222 (40%), Gaps = 32/222 (14%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKW-HEKSPFLFGSVSDDSTLII-- 233
           L +CS D +I +++V    +  +   T H   V    W H K   +  S S D  ++I  
Sbjct: 24  LATCSSDKTIKVFEVEGETHKLIDTLTGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWK 83

Query: 234 -HDKRIDKPVVKILQSEPYNTLAFSKHSSN-LFAAAGTDSQVQLYDLRK--PEAPIHSMS 289
             + R  +  V  + S   N++ ++ H    L   A +D +V + + ++    +PI  + 
Sbjct: 84  EENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVASSDGKVSVVEFKENGTTSPI-IID 142

Query: 290 GHHDSVTSLEFAP---HKDG---------ILCSGSSDRRVLIWDLFQIGAEQQQEDADDG 337
            H   V S  +AP    +DG            +G +D  V IW        +   DA   
Sbjct: 143 AHAIGVNSASWAPATVEEDGEHNGAKESRKFVTGGADNLVKIW--------KYNSDAQTY 194

Query: 338 VPELLMMHAGHKSPVNDFSCSPNIPW--LMASVEEENVVQIW 377
           V E  +   GH   V D + SP +     +ASV ++    IW
Sbjct: 195 VLESTL--EGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIW 234

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 91/213 (42%), Gaps = 29/213 (13%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG---------SVSD 227
           L + ++D  I IWD+ + +            IV   + HE+  +            S S 
Sbjct: 393 LATGAEDKLIRIWDLSTKR------------IVMTLQGHEQDIYSLDYFPSGDKLVSGSG 440

Query: 228 DSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKP 281
           D T+ I D R  +  + +   +   T+A S       AA   D  ++++D      + + 
Sbjct: 441 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERL 500

Query: 282 EAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL 341
           ++     +GH DSV S+ F     G++ SGS DR V +W+L   G+   + D+       
Sbjct: 501 DSENELGTGHKDSVYSVVFTRDGQGVV-SGSLDRSVKLWNLHNTGSS-SKNDSKPTAATC 558

Query: 342 LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVV 374
            + + GHK  V   + + N  ++++  ++  V+
Sbjct: 559 EVTYTGHKDFVLSVATTQNDKYILSGSKDRGVL 591

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 47/248 (18%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSP 219
           H+++ Y L++   S  +L+S S D ++ IWD+ +G+     +  S  + V          
Sbjct: 419 HEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRTGQ---CSLTLSIEDGVTTVAVSPGEG 474

Query: 220 FLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNT--------LAFSKHSSNLFAAAGTDS 271
               + S D TL + D      V ++       T        + F++    + + +  D 
Sbjct: 475 KFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGS-LDR 533

Query: 272 QVQLYDLR----------KPEAPIH--SMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLI 319
            V+L++L           KP A     + +GH D V S+      D  + SGS DR VL 
Sbjct: 534 SVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATT-QNDKYILSGSKDRGVLF 592

Query: 320 WDLFQIGAEQQQEDADDGVPELLMMHAGHKSPV------NDFSCSPNIPWLMASVEEENV 373
           W            D   G P  L+M  GH++ V      N F   P+   + A+   +  
Sbjct: 593 W------------DTQSGNP--LLMLQGHRNSVISVAVANGFPLGPDY-GVFATGSGDCK 637

Query: 374 VQIWKASK 381
            +IWK SK
Sbjct: 638 ARIWKYSK 645

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 96/244 (39%), Gaps = 23/244 (9%)

Query: 153 LTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC 212
           +  +F        GL F    P  L++     SI +WD   G  T +     H   V   
Sbjct: 3   MLTKFESKSTRAKGLAFHPSRPWVLVALFS-SSIQLWDYRMG--TLLHKFEDHEGPVRGI 59

Query: 213 KWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQ 272
            +H   P LF S  DD T+ +      K +  +     Y    F         +A  D  
Sbjct: 60  DFHPTQP-LFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQT 118

Query: 273 VQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLF--------- 323
           +++++ +  +  I  ++GH+  V   +F P +D ++ S S D  V +WD+          
Sbjct: 119 IRIWNWQNRK-EIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHSAP 176

Query: 324 -------QIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQI 376
                  QI A+Q   D   G   +  +  GH   VN  S  P +P L+ S  ++  V++
Sbjct: 177 STYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGDDRQVKL 235

Query: 377 WKAS 380
           W+ S
Sbjct: 236 WRMS 239

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 106/256 (41%), Gaps = 48/256 (18%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHD- 235
           ++S SDD +I IW+  + K   +   T HN+ V    +H     +  S S D T+ + D 
Sbjct: 110 IISASDDQTIRIWNWQNRKE--IACLTGHNHFVMCADFHPTEDLVV-SASLDETVRVWDI 166

Query: 236 ----KRIDKPVVKILQSE---PYNTL-----------AFSKHSSN-----------LFAA 266
               KR   P    L+ +     N L               HS             L  +
Sbjct: 167 SGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVS 226

Query: 267 AGTDSQVQLYDLRKPEA-PIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325
            G D QV+L+ +   +A  + +  GH ++V S+ F PH++ I+  G  D+ V +WDL + 
Sbjct: 227 GGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG-EDKTVRVWDLDKR 285

Query: 326 GAEQQQEDADDGV------PELLMMHAGHKSPVNDFS------CSPNIPWLMASVEEENV 373
              +Q +  +D        P + +  A H S +  F       CS      +  V +E  
Sbjct: 286 TPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSVINQNQLIFVNKEKQ 345

Query: 374 VQIWKASKKLTS-PYI 388
           VQ +  +KK+ S PY+
Sbjct: 346 VQSFDYNKKIASLPYV 361

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 4/117 (3%)

Query: 166 GLNFSVISPGE--LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFG 223
           G+N++   P    ++S  DD  + +W + S K   V     H N V+   +H     +  
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLII- 269

Query: 224 SVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRK 280
           SV +D T+ + D     PV +  +      L  +  + NLF AA  DS + ++ L +
Sbjct: 270 SVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAH-DSGIMVFKLDR 325

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + ++D  I IWD+ + K   V +   H   +    +      L  S S D T+ I D 
Sbjct: 458 LATGAEDRLIRIWDIENRK--IVMILQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDL 514

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKPEAPIHSMSG 290
           R  +  + +   +   T+A S       AA   D  V+++D      + + ++   S +G
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 574

Query: 291 HHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHK 349
           H DSV S+ F   +DG  + SGS DR V +W+L     +   +  + G  E  + + GHK
Sbjct: 575 HKDSVYSVVFT--RDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHK 630

Query: 350 SPVNDFSCSPNIPWLMASVEEENVV 374
             V   + + N  ++++  ++  V+
Sbjct: 631 DFVLSVATTQNDEYILSGSKDRGVL 655

>NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 78/180 (43%), Gaps = 14/180 (7%)

Query: 162 ENGYGLNFSVISPGELLSCSD-DGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPF 220
           EN Y  + S +  G  L+    +G + I+DV   K   V+  + H + V    W+     
Sbjct: 331 ENEY-TSLSWVGAGSHLAVGQGNGLVEIYDVV--KRKCVRTLSGHVDRVACLSWNGH--- 384

Query: 221 LFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSS-NLFAAAGTDSQVQLYDLR 279
           +  S S D  ++  D R+  P  + L +          ++  N  A+ G D+ V +YD  
Sbjct: 385 ILTSGSRDHNILHRDVRMPDPFFERLNTHSQEVCGLQWNTEENKLASGGNDNVVCVYD-G 443

Query: 280 KPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSS--DRRVLIWDLFQIGAEQQQEDADDG 337
               P+     H  +V +L ++PHK GIL +G    DRR+  W+   +    +  D D G
Sbjct: 444 TSRNPMIKFIEHKAAVKALAWSPHKRGILATGGGTVDRRLKTWN---VNTSMKLSDVDTG 500

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 92/205 (44%), Gaps = 14/205 (6%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + ++D  I IWD+ + K   V +   H   +    +      L  S S D T+ I D 
Sbjct: 462 LATGAEDRLIRIWDIENRK--IVMILQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDL 518

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKPEAPIHSMSG 290
           R  +  + +   +   T+A S       AA   D  V+++D      + + ++   S +G
Sbjct: 519 RTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENESGTG 578

Query: 291 HHDSVTSLEFAPHKDG-ILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHK 349
           H DSV S+ F   +DG  + SGS DR V +W+L     +   +  + G  E  + + GHK
Sbjct: 579 HKDSVYSVVFT--RDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE--VTYIGHK 634

Query: 350 SPVNDFSCSPNIPWLMASVEEENVV 374
             V   + + N  ++++  ++  V+
Sbjct: 635 DFVLSVATTQNDEYILSGSKDRGVL 659

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 81/187 (43%), Gaps = 20/187 (10%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDV---------CSGKN-----TPVKVD 202
           F  H       +F   +   + SCSDD  IAIW++             N      PVK  
Sbjct: 77  FRGHTAQVLDTDFDPFNDRRIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVKWL 136

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
             H   V    +H  +  +  S S D T+ I +    + V  +   +   +++FS + ++
Sbjct: 137 AGHGRKVGHVLFHPVAENILASSSLDYTVKIWNVETGEVVYTLKHPDMVTSMSFSYNGAH 196

Query: 263 LFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS-LEFAPHKDGILCSGS---SDRRVL 318
           L A  G D +++++D+R  E  +   + H  + T  + +  + D +  +G    SDR++ 
Sbjct: 197 L-ATVGRDKKLRVWDIR-AEKIVSEGAAHAGAKTQRVIWLGNSDRLATTGFSRLSDRQIG 254

Query: 319 IWDLFQI 325
           IWD F +
Sbjct: 255 IWDAFNL 261

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 265 AAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQ 324
           +  G  + + + ++ K    +    GH   V   +F P  D  + S S D ++ IW++ +
Sbjct: 54  SGGGAFAVIPVEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDRRIASCSDDSKIAIWEIPE 113

Query: 325 IGAEQQQEDADDGVPEL--LMMHAGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
             +  +  DAD+   ++  +   AGH   V      P    ++AS   +  V+IW
Sbjct: 114 DYSFHKYVDADNEPKDVKPVKWLAGHGRKVGHVLFHPVAENILASSSLDYTVKIW 168

>Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {ON}
           complement(63130..64962) [1833 nt, 611 aa]
          Length = 610

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 75/187 (40%), Gaps = 20/187 (10%)

Query: 157 FSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN--------------TPVKVD 202
           F  H        F   +   ++SC+DD  IA+WD+    +              +PVK+ 
Sbjct: 77  FRGHTAQVLDTEFDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKIL 136

Query: 203 TSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
           T H   V    +   +  +  S S D T+ I +    K  + +   +   +++FS +  N
Sbjct: 137 TGHKKKVGHVLYSPVAQNILASSSLDYTVKIWNVETGKDEITLKHPDMVTSMSFS-YDGN 195

Query: 263 LFAAAGTDSQVQLYDLRK----PEAPIHSMSGHHDSVTSLEFAPHKDGILCSGSSDRRVL 318
             A    D +++++D+RK     E   H+    +  V  L           S  SDR++ 
Sbjct: 196 HLATVSRDKKLRVWDVRKGTVVSEGAAHT-GAKNQRVVWLGNCNRLATTGFSRLSDRQIG 254

Query: 319 IWDLFQI 325
           IWD F +
Sbjct: 255 IWDAFNL 261

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPEL--LMMH 345
             GH   V   EF P  +  + S + D ++ +WD+ +  +     D D+   ++  + + 
Sbjct: 77  FRGHTAQVLDTEFDPFNERRIVSCADDSKIAVWDIPENYSFHHYLDEDNQPKDISPVKIL 136

Query: 346 AGHKSPVNDFSCSPNIPWLMASVEEENVVQIW 377
            GHK  V     SP    ++AS   +  V+IW
Sbjct: 137 TGHKKKVGHVLYSPVAQNILASSSLDYTVKIW 168

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 18/207 (8%)

Query: 177 LLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDK 236
           L + ++D  I IWD+   K   V V   H   +    +      L  S S D T+ I D 
Sbjct: 390 LATGAEDRLIRIWDIA--KKQIVMVLQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDL 446

Query: 237 RIDKPVVKILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYD------LRKPEAPIHSMSG 290
           R  +  + +   +   T+A S       AA   D  V+++D      + + ++     +G
Sbjct: 447 RTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTG 506

Query: 291 HHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVP---ELLMMHAG 347
           H DSV S+ F    +G++ SGS DR V +W+L        + ++  G P      + + G
Sbjct: 507 HKDSVYSVVFTRDGNGVV-SGSLDRSVKLWNL-----RGDKNNSSSGKPTPGTCEVTYTG 560

Query: 348 HKSPVNDFSCSPNIPWLMASVEEENVV 374
           HK  V   + + N  ++++  ++  V+
Sbjct: 561 HKDFVLSVATTQNDQYILSGSKDRGVL 587

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 99/256 (38%), Gaps = 64/256 (25%)

Query: 160 HKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKN----------TPVKVDTSHNNIV 209
           H+++ Y L++   S  +L+S S D ++ IWD+ +G+           T V V       +
Sbjct: 416 HEQDIYSLDY-FPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFI 474

Query: 210 NECK-------WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAFSKHSSN 262
                      W  ++ FL   +  ++ L    K            +   ++ F++  + 
Sbjct: 475 AAGSLDRAVRVWDSETGFLVERLDSENELGTGHK------------DSVYSVVFTRDGNG 522

Query: 263 LFAAAGTDSQVQLYDLR-----------KPEAPIHSMSGHHDSVTSLEFAPHKDGILCSG 311
           + + +  D  V+L++LR            P     + +GH D V S+      D  + SG
Sbjct: 523 VVSGS-LDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVA-TTQNDQYILSG 580

Query: 312 SSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPV------NDFSCSPNIPWLM 365
           S DR VL W            D   G P  L+M  GH++ V      N F   P    + 
Sbjct: 581 SKDRGVLFW------------DTQSGNP--LLMLQGHRNSVISVAVANGFPLGPQY-GVF 625

Query: 366 ASVEEENVVQIWKASK 381
           A+   +   +IWK +K
Sbjct: 626 ATGSGDCKARIWKYTK 641

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,182,531
Number of extensions: 2175460
Number of successful extensions: 9152
Number of sequences better than 10.0: 1050
Number of HSP's gapped: 7912
Number of HSP's successfully gapped: 1873
Length of query: 398
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 286
Effective length of database: 40,638,807
Effective search space: 11622698802
Effective search space used: 11622698802
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)