Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11528g6.10ON64261426840.0
Kwal_56.223506.10ON65861321730.0
SAKL0E00880g6.10ON63659420080.0
Kpol_1045.776.10ON65060419340.0
ACR016W6.10ON64059419230.0
TBLA0G011106.10ON63861819110.0
TPHA0M002006.10ON63459019070.0
ZYRO0F00484g6.10ON64359818840.0
TDEL0G046106.10ON63359118610.0
KLLA0D00836g6.10ON64060418400.0
NCAS0D021906.10ON64559618080.0
KAFR0B065006.10ON63658916730.0
NDAI0I027506.10ON66361315970.0
CAGL0A01067g6.10ON64147615190.0
KNAG0E027806.10ON65062814850.0
Skud_16.146.10ON65260212931e-170
YPL263C (KEL3)6.10ON65160412871e-169
Suva_16.426.10ON65460512861e-169
Smik_6.4716.10ON65160412731e-167
Kpol_1050.695.88ON10842611621e-10
NDAI0D026005.88ON11672961484e-09
Suva_15.3575.88ON11722581477e-09
Skud_8.2225.88ON11692581468e-09
KNAG0K005605.88ON11042611441e-08
SAKL0H02618g5.88ON10852581441e-08
KLLA0E15511g5.88ON9052781432e-08
KAFR0B043205.88ON9862631432e-08
YHR158C (KEL1)5.88ON11642571413e-08
Smik_8.2425.88ON11682591404e-08
NCAS0F005205.88ON10862601371e-07
KLTH0C01474g5.88ON10562541333e-07
Kwal_14.10195.88ON9782631314e-07
TDEL0G011205.88ON10092551299e-07
CAGL0I02090g5.88ON11362571262e-06
TPHA0H010805.88ON8282621262e-06
TPHA0A051705.88ON10162421243e-06
ZYRO0B08228g5.88ON12932551218e-06
Kpol_1010.625.88ON9732581201e-05
TBLA0C065305.88ON11721671201e-05
Suva_7.5305.88ON8941541191e-05
YGR238C (KEL2)5.88ON8822591172e-05
Skud_7.5725.88ON8831911137e-05
Ecym_20615.88ON13622621129e-05
CAGL0F07997g5.88ON9362581111e-04
Smik_16.685.88ON8941811102e-04
ADL149W5.88ON12112591082e-04
TBLA0A043207.9ON838100860.11
ZYRO0C03344g3.15ON65894790.73
ZYRO0C00550g7.9ON84868761.4
CAGL0K02101g8.157ON163396761.5
KAFR0I029103.15ON691140761.6
NCAS0A076407.9ON91386761.7
Kpol_1014.253.15ON629146716.4
TPHA0P015303.15ON70088707.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11528g
         (642 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...  1038   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   841   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   778   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   749   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   745   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   740   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   739   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   730   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   721   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   713   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   701   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   649   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   619   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   589   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   576   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   502   e-170
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   500   e-169
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   499   e-169
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   494   e-167
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    67   1e-10
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    62   4e-09
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    61   7e-09
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    61   8e-09
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    60   1e-08
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    60   1e-08
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    60   2e-08
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    60   2e-08
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    59   3e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    59   4e-08
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    57   1e-07
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    56   3e-07
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    55   4e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    54   9e-07
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    53   2e-06
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    53   2e-06
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    52   3e-06
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    51   8e-06
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    51   1e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    51   1e-05
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    50   1e-05
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    50   2e-05
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    48   7e-05
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    48   9e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    47   1e-04
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    47   2e-04
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    46   2e-04
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    38   0.11 
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    35   0.73 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    34   1.4  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    34   1.5  
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    34   1.6  
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    34   1.7  
Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {O...    32   6.4  
TPHA0P01530 Chr16 complement(311917..314019) [2103 bp, 700 aa] {...    32   7.2  

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/614 (83%), Positives = 510/614 (83%)

Query: 29  VKDKKRSKKLNSXXXXXXXXXXXXXNFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHG 88
           VKDKKRSKKLNS             NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHG
Sbjct: 29  VKDKKRSKKLNSEDDDDLDIDEILENFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHG 88

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVV 148
           KRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVV
Sbjct: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVV 148

Query: 149 LIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG 208
           LIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG
Sbjct: 149 LIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG 208

Query: 209 FRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXX 268
           FRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYC  
Sbjct: 209 FRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKI 268

Query: 269 XXXXXXXXXXXXTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGV 328
                       TDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGV
Sbjct: 269 KAKKGLQKGKILTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGV 328

Query: 329 YDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQXXXXXXXXXXXXXXDDELVGILND 388
           YDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQ              DDELVGILND
Sbjct: 329 YDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQKKKIVAASKSAKSKDDELVGILND 388

Query: 389 ILQXXXXXXXXXXXXXXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVD 448
           ILQ                      HRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVD
Sbjct: 389 ILQKANLADEENEENESDSEIEKELHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVD 448

Query: 449 DTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXX 508
           DTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQG          
Sbjct: 449 DTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEE 508

Query: 509 XXXXXXXXXXXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETL 568
                            IAEMEDDK              AGPEIPDPRPWLPHPKAFETL
Sbjct: 509 EDDDDEDDEEETLDEELIAEMEDDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETL 568

Query: 569 RAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVE 628
           RAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVE
Sbjct: 569 RAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVE 628

Query: 629 NIIERDSSHSTKRR 642
           NIIERDSSHSTKRR
Sbjct: 629 NIIERDSSHSTKRR 642

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/613 (67%), Positives = 465/613 (75%), Gaps = 10/613 (1%)

Query: 30  KDKKRSKKLNSXXXXXXXXXXXXXNFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGK 89
           KDKKRSKKL S             NF+KEQELFQEV+VTPV+RPS R N CMV NP HGK
Sbjct: 56  KDKKRSKKLGSEDDDDLDIDEVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGK 115

Query: 90  RELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVL 149
           RELLIFGGE+TN T+S T FYNELFTYSLD+DQW+KITSRN+PMPRSSAAAA H SGV L
Sbjct: 116 RELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVAL 175

Query: 150 IHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGF 209
           IHGGEFSSPKQNTFYHYSD+WLLDC++KEWTK++QKNGPSARSGHRMT+WKNFF++HGGF
Sbjct: 176 IHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGF 235

Query: 210 RDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXX 269
           RDLGTSTTYLND W+FDITTYKWKQVEFPPNHP+PDARSGHS+IPTQ+GA++WGGYC   
Sbjct: 236 RDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVK 295

Query: 270 XXXXXXXXXXXTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVY 329
                      TDCWYL+MKSD++ IRWERRKKQGFQPSPRVGCSM HHKGRG+LFGGVY
Sbjct: 296 AGKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVY 355

Query: 330 DYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQXXXXXXXXXXXXXXDDELVGILNDI 389
           D+EETEEGL+SEFFNDL SYQVEANRWYS+KMRPQ              D+EL  ILNDI
Sbjct: 356 DFEETEEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVAISRNNRNKDEELENILNDI 415

Query: 390 LQXXXXXXXXXXXXXXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDD 449
           LQ                       R+DEEE L + +KQY VV QLPH RFNA T VVDD
Sbjct: 416 LQ---QANLADDTDDDDNEIKRELQRIDEEEALENSRKQYEVVGQLPHPRFNATTAVVDD 472

Query: 450 TLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXX 509
            LFIFGG WE+GERDFSIDSFYSIDLN+ DGV+V+WE+L E+EKAK  G           
Sbjct: 473 FLFIFGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDE 532

Query: 510 XXXXXXXXXXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLR 569
                           +AE E+++                 EIPD RPWLPHPK FETLR
Sbjct: 533 DDDDDDEEEETADQKLVAEDEEEEEEEEEEEDEP-------EIPDLRPWLPHPKPFETLR 585

Query: 570 AFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVEN 629
           AFYIRTGAEFL+WAISNNR AKGKHLKKQSFDL QDRWWERREQ+RIEEDKLEE+GGVEN
Sbjct: 586 AFYIRTGAEFLKWAISNNRDAKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVEN 645

Query: 630 IIERDSSHSTKRR 642
           ++ERD + + KRR
Sbjct: 646 VVERDPAQTMKRR 658

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/594 (62%), Positives = 436/594 (73%), Gaps = 16/594 (2%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF++EQE F+EVVV+ V RP+ R N  MV NP HGKRELL+FGGE TN T+STT FYN+L
Sbjct: 54  NFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDL 113

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           FTYSLD DQW+KI+S+N+PMPRSSAA A HPSGVVLIHGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 FTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           C++KEWTKI+QKNGP+ARSGHR+TVWKN+F++HGGFRDLGT TTYL+DCWLFDITTYKWK
Sbjct: 174 CNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWK 233

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           QV+FPPNHP+PDARSGHSL+PT +GA++WGGYC              TDCWYL+MKSDI 
Sbjct: 234 QVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSDIG 293

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERRKKQGFQPSPRVGCSM HHKGRGILFGGV+D+EETEE L S F+NDL ++Q+E 
Sbjct: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIET 353

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXXXDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXXX 413
           NRWYS  +RPQ              D EL  ILN IL+                      
Sbjct: 354 NRWYSASLRPQRKAAKATSKNNRNKDKELEDILNQILE----KANLNDDENEKETIGDVL 409

Query: 414 HRLDEE-----ELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSID 468
             LDEE     E L  ++K+YP+  QLPH RFNA+T VVDDTLFIFGG WE GE+D+SID
Sbjct: 410 KELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSID 469

Query: 469 SFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAE 528
           SFY+IDLNR DG++++WEDL +IE AK+ G                           +  
Sbjct: 470 SFYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVA 529

Query: 529 MEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNR 588
            +                   PEIPDPRPWLPHPK FETLR FY+RTGA+FL+WAIS+NR
Sbjct: 530 ED-------DDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNR 582

Query: 589 SAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
            A+GKHLKK+SFDL QDRWWERR+QVRIEEDKLEE+GG+  ++E+D+S S KRR
Sbjct: 583 DARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/604 (59%), Positives = 432/604 (71%), Gaps = 22/604 (3%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+KEQELF+++ +  V+RPS R N CM+ NP+HGK EL++FGGE TN+ +STT F+N+L
Sbjct: 54  NFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDL 113

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           ++Y+ + DQW++ TS+N+PMPRSSAA A HPSGV LIHGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 114 YSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLD 173

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           CS+KEWTK++QKNGPSARSGHR+++WKN+F++HGGFRDLGTSTTYLNDCWLFDIT YKWK
Sbjct: 174 CSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYKWK 233

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           Q+EFPPNHP+PDARSGHS IPTQEGA++WGGYC              TDCWYL+MK+D T
Sbjct: 234 QIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPT 293

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERRKKQGFQPSPRVGCSM HHKGRGILFGGVYD+EETEE L S F+NDL SYQ+E 
Sbjct: 294 AIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEI 353

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXX-XDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRW+++++RPQ               + EL  +LN IL+                     
Sbjct: 354 NRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKAIE 413

Query: 413 XH--RLD--------EEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGE 462
               R D        ++     ++K+Y V+ QLPH RFNA  TVV+DTLFI+GG WE GE
Sbjct: 414 TELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGE 473

Query: 463 RDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXX 522
           +D++IDSFYSIDLNRTDGV V WEDL EIE AK+ G                        
Sbjct: 474 KDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGE--- 530

Query: 523 XXXIAEMEDDKXXXXXXXXXXXXXXAGP----EIPDPRPWLPHPKAFETLRAFYIRTGAE 578
                E+ D K                     EIPDP PWLPHPK FE+LR FY+RTGA 
Sbjct: 531 ----EEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGAT 586

Query: 579 FLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHS 638
           FL+WAISNNR A+GKHLKK+SFDL QDRWW+RR+QVRIEEDK+EE+GG+  +IE+D+S S
Sbjct: 587 FLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKS 646

Query: 639 TKRR 642
           TKRR
Sbjct: 647 TKRR 650

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/594 (59%), Positives = 421/594 (70%), Gaps = 12/594 (2%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+++Q  F+ V V  V+RP  RS+  +V NP H KREL++FGGEYTNQ++  T FYN+L
Sbjct: 54  NFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDL 113

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           F YSLDTDQWKK TS+N+PMPRSSAA A HPSGVVLIHGGEFSSPKQNTFYHYSD+WL D
Sbjct: 114 FIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFD 173

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           C++ EWTKI+QKNGPS+RSGHRMTVWKN+ ++HGGFRDLGTSTTYLNDCWLFDITTYKW+
Sbjct: 174 CATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           Q++FP NHP+PDARSGHSL+PT EGAI+WGGYC              TDCWYL+MKSD+T
Sbjct: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSDVT 293

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERRKKQGFQPS R GCSM HHKGRGILFGGVYDYEETEEGL S F+NDL +Y +E 
Sbjct: 294 AIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHIET 353

Query: 354 NRWYSIKMRPQXXXXXXXX-XXXXXXDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRWYS+ +R Q               D EL  +LN IL+                     
Sbjct: 354 NRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKTIEEELN 413

Query: 413 XHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYS 472
               D        +K YP+V +LPH RFNA+T +VDDTLFIFGG WE GE+D+ IDSFYS
Sbjct: 414 KLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDSFYS 473

Query: 473 IDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEMEDD 532
           ID+N+ DGV+V+WED+  +E+AK+ G                           +   E++
Sbjct: 474 IDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKLVAEEEE 533

Query: 533 KXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRS--- 589
           +                PEIPDPRPWLPHPKAFE+LRAFY+RTGA FL+WAI+N  +   
Sbjct: 534 EEEEEDNEIL-------PEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRS 586

Query: 590 -AKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
            AKGKHLKK SFDL Q+RWWERREQVRIEEDKLEE+GGV  +IE+D +  TKRR
Sbjct: 587 DAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/618 (57%), Positives = 429/618 (69%), Gaps = 14/618 (2%)

Query: 30  KDKKRSKKLN-SXXXXXXXXXXXXXNFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHG 88
           KDKK SKK                 NF+K+QE F+++ +  V +P+ R N CM+ NP HG
Sbjct: 30  KDKKLSKKNQLEEEDDDMAIEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHG 89

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVV 148
           K EL++FGGE    TS+TTTFYN+LFTY+ + DQWKK TS+N+PMPRSS+A   HP+G+ 
Sbjct: 90  KNELILFGGE---NTSTTTTFYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIA 146

Query: 149 LIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG 208
           L+HGGEFSSPKQNTFYHYSD+WLLDC++KEW+K++ KNGPSARSGHRMTVWKNF ++HGG
Sbjct: 147 LLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGG 206

Query: 209 FRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXX 268
           FRDLGTSTTYL D WLFD+T YKW QVEFPPNH +PDARSGHSLIPTQ+GA++WGGYC  
Sbjct: 207 FRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKV 266

Query: 269 XXXXXXXXXXXXTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGV 328
                       +DCWYL+MKSD++GIRWERRKKQGFQPSPRVGCSM HHKGRGILFGGV
Sbjct: 267 KAGKGLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGV 326

Query: 329 YDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQXXXXXXXX-XXXXXXDDELVGILN 387
           +D+EETEE L S F+NDL +YQ+E NRW+S+ MR Q               + EL  ILN
Sbjct: 327 FDFEETEESLDSLFYNDLFTYQIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILN 386

Query: 388 DILQXXXXXXXXX---XXXXXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAAT 444
            IL+                            ++E   G   KQY V+ QLPH RFNA T
Sbjct: 387 SILKKNNLTDDDSEDPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATT 446

Query: 445 TVVDDTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXX 504
            VV+DTL+IFGGSWE GE+D+SIDSFYSIDLN+ DGV V+WED+EEIE AK+ G      
Sbjct: 447 AVVNDTLYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDE 506

Query: 505 XXXXXXXXXXXXXXXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKA 564
                                +                        EIPDPRPWLPHPK 
Sbjct: 507 EDEDDEEEDEDDGEEEIVDQKLV------AEEDEEEEEIEADEDEMEIPDPRPWLPHPKP 560

Query: 565 FETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEM 624
           FETLRAFY+RTGA FL+WAISNNR +KGKHLKK+SF+L++DRWWERR+QVRIEEDK+EE+
Sbjct: 561 FETLRAFYVRTGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEEL 620

Query: 625 GGVENIIERDSSHSTKRR 642
           GG+ENI+ERD++   KRR
Sbjct: 621 GGIENIVERDTTQVNKRR 638

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/590 (59%), Positives = 432/590 (73%), Gaps = 11/590 (1%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+KEQE F+++ V  V +P+ R N CM+ NP+HGK+ELL+FGGE T+Q    T FYN+L
Sbjct: 55  NFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDL 114

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           +T++ D D WKKITS+N+PMPRSSAA A HPSG+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 115 YTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           C+++EWTK++QKNGPSARSGHR+TVWKN+F++HGGFRDLG++T+YLND WLFDIT+YKW+
Sbjct: 175 CTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWR 234

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           Q+EFPPNHPVPDARSGHSLIPTQEGA++WGGYC               DCWYL+MK+D +
Sbjct: 235 QIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPS 294

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            +RWERRKKQGFQPSPRVGCSM HHKGRGILFGGVYD+EETEE L S F+NDL SYQ+E+
Sbjct: 295 AVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIES 354

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXXXDD-ELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRWY++++R Q               + EL  ILN+IL+                     
Sbjct: 355 NRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANLKDDDEDANELSNGLGSD 414

Query: 413 XHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYS 472
               DE E +   +K+Y V  QLPH RFNA+TTVVDDTLFI+GG WE GE+D+SIDS YS
Sbjct: 415 SDSDDESEKVS--KKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYS 472

Query: 473 IDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEMEDD 532
           IDLN+ DGV V+WE+L +IEKAK+ G                           +AE E++
Sbjct: 473 IDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEETVDQKLVAEEEEE 532

Query: 533 KXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKG 592
           +                 EIPDPRPWLPHPKAFE+LR FY+RTGA FL+WAISNN+  +G
Sbjct: 533 EEEIEDADDM--------EIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRG 584

Query: 593 KHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
           KHLK +SF+L QDRWWERR+QVRIEEDKLEE+GGV  +IE+D++ STKRR
Sbjct: 585 KHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/598 (59%), Positives = 428/598 (71%), Gaps = 19/598 (3%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           +F+KEQE F++VVV  V +PS R N C+V NP+HGK+EL++FGGEYTNQ++STT FYNEL
Sbjct: 56  SFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNEL 115

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           FT++ D DQW+KI+S+NAPMPRSSAA A HPSG+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 116 FTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 175

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           C++KEWTK+DQKNGP++RSGHRMTVWKNFF+M+GGFRDLGTSTTYLNDCWLFDITT+KW 
Sbjct: 176 CTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWT 235

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           QVEFP NH +PDARSGHS IP QEGAI+WGGYC              TDCWYL+M S  +
Sbjct: 236 QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPS 295

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERRKKQGFQPSPRVGCSM  HKGRG+LFGGVYD+EETEE L S F+NDL ++Q++ 
Sbjct: 296 AIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKT 355

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXX-XDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRWYS+ +RPQ               + EL   LN ILQ                     
Sbjct: 356 NRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQF 415

Query: 413 XHR-----LDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSI 467
                    DEEE     +KQ+ +  QLPH RFN +  VV+DTLFI+GG WE G++D++I
Sbjct: 416 EDENQSGDEDEEE---STKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNI 472

Query: 468 DSFYSIDLNRTDGVRVFWEDLEEIEKAK---DQGXXXXXXXXXXXXXXXXXXXXXXXXXX 524
           DSFY IDLN+ DGV V+WE+L EIEKAK   +QG                          
Sbjct: 473 DSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQV 532

Query: 525 XIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAI 584
            +AE ED +                 EIPDPRPWLPHPKAFE+LRAFY+R G +FL+WAI
Sbjct: 533 LVAEEEDAEEDEEVEEEEM-------EIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAI 585

Query: 585 SNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
           SNNR A+GKHLK++SFDL QDRWWERR+QVRIEEDK+EE+GGV +I+ER+ +  TKRR
Sbjct: 586 SNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/591 (58%), Positives = 419/591 (70%), Gaps = 14/591 (2%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+KEQE F++VVV  ++RPS R N  M+ NP HGK EL++FGGE+T Q++STT F+N+L
Sbjct: 55  NFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDL 114

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
             +S D +QWK+I+S+N+PMPRSSAA  GHPSGV L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 115 VVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           C++KEWTKI+QKNGPSARSGHRM VWKNF ++HGGFRDLGTSTTYLNDCWLFDITTYKWK
Sbjct: 175 CATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWK 234

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           QVEFP NHPVPDARSGHSLI  QEGAI+WGGYC              TDCWYL+M S+ +
Sbjct: 235 QVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTS 294

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRW+R+K+QGFQPSPRVGCSM  HKGRG+LFGGVYD+EETEE L S F+ND+ +YQ+  
Sbjct: 295 AIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINM 354

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXX-XDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRWYS+ +RPQ               + EL  +LN IL+                     
Sbjct: 355 NRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDAAEESTA 414

Query: 413 XHR-LDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFY 471
                DE E L    K++ ++ +LPH RFNAAT VVDDTLFIFGG WE+GE+D+SIDSFY
Sbjct: 415 VEEDSDESESL---DKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFY 471

Query: 472 SIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEMED 531
            IDLN+ DGV V+WEDL  +E AKD+                              +++ 
Sbjct: 472 GIDLNKADGVTVYWEDLTALENAKDE---------DDSDEDEGEEDDDDEEDSEEEQVDQ 522

Query: 532 DKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAK 591
                              EIPDPRPWLPHPKAFE+LR+FY+RTGA FL+WAISNNR  K
Sbjct: 523 KLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVK 582

Query: 592 GKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
           GKHLK +SF++ + RWWERR+QVR+EEDKLEE+GGV  IIERD++ + KRR
Sbjct: 583 GKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/604 (57%), Positives = 415/604 (68%), Gaps = 31/604 (5%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF++EQE F+++ V  V RP  R N CM  NP+HGKREL++FGGE T Q + TT FYN+L
Sbjct: 53  NFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDL 112

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           F YSLDTD WK+ TS+N+PMPRSSAA A HP+GV LIHGGEFSSPKQNTFYHYSDSWL D
Sbjct: 113 FVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFD 172

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
           CSSKEWTK++QKNGPSARSGHRM +WKNF ++HGGFRDLGTSTTYLND W+FDIT YKWK
Sbjct: 173 CSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWK 232

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           QVE P NHP+PDARSGHSLI T EGA+++GGY               +DCWYL+MKSD+ 
Sbjct: 233 QVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLG 292

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERRKKQG QPSPRVGCSM HHKGRG+LFGGVYD+EETEE L S F+N+L +YQ+E 
Sbjct: 293 SIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIEN 352

Query: 354 NRWYSIKMRPQXXXXX-XXXXXXXXXDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXX 412
           NRWY++ +RPQ               D EL  ILN IL                      
Sbjct: 353 NRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDES-------- 404

Query: 413 XHRLDEEEL--------------LGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSW 458
             ++ EE+L                   K Y  ++ LPH+RFNAAT VVDDTLFIFGG+ 
Sbjct: 405 --KVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTV 462

Query: 459 EYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXX 518
           E GE+D+ IDSFYSID+N+ DGV+V+WE+L+E+E+A+  G                    
Sbjct: 463 EIGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGE 522

Query: 519 XXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAE 578
                  +   +                    EIPD RPWLPHPKAFETLRAFY+RTG  
Sbjct: 523 EEIVDSKLEAED------EEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPT 576

Query: 579 FLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHS 638
           FL+ AIS+NR +KGKHLK +SF+L QDRWWERREQVRIEEDKLEE+GGVE++IE+D+S +
Sbjct: 577 FLELAISSNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKT 636

Query: 639 TKRR 642
            +RR
Sbjct: 637 QRRR 640

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/596 (56%), Positives = 412/596 (69%), Gaps = 13/596 (2%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+ +QE F+ V V  + +P+ R N CM+  P+H K+ELLIFGGE+TN  +S T FYNEL
Sbjct: 55  NFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNEL 114

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
            TYS D  QW+KITS+N+PMPRSSAA   HPSG+ L+HGGEFSSPKQNTFYHYSD+WLLD
Sbjct: 115 ITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLD 174

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
             +KEWTK+D   GP  RSGHR+T+WKN+F++ GGF+DLG ST+Y NDCW FDITTYKWK
Sbjct: 175 THTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWK 234

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           Q+EFPPNHP+PDARSGHS IPT+EG I+WGGYC               DCWYL+MKSD++
Sbjct: 235 QIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLS 294

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            +RWERRKKQGFQPSPRVGCSMA+HKGRGILFGGVYD+EETEE L S F+NDL SY VE+
Sbjct: 295 QVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVES 354

Query: 354 NRWYSIKMRP----QXXXXXXXXXXXXXXDDELVGILNDILQXXXXX---XXXXXXXXXX 406
           NRW+S+ +R     +              + EL  +LN IL+                  
Sbjct: 355 NRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEISTGTE 414

Query: 407 XXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFS 466
                  +  DE+     +  Q  V++QLPH RFNAATTVVDD+LFI+GG WE GE+D++
Sbjct: 415 TETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYA 474

Query: 467 IDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXI 526
           IDS YSIDLN+ DGV  +WEDL+EIEKAK+ G                           +
Sbjct: 475 IDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIEDKKLV 534

Query: 527 AEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISN 586
           AE +D++                 EIPD RPWLPHPK FE+LRAFYIR GA FL+WAISN
Sbjct: 535 AEEDDEEEEEEEEEFEEM------EIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN 588

Query: 587 NRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
           N+  +GKHLKK+SFDL +DRWWERR+QVRIEEDKLEE+G V N+IE+D+S  T +R
Sbjct: 589 NKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/589 (52%), Positives = 398/589 (67%), Gaps = 7/589 (1%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           NF+KEQE ++++ +  V++PS R+N  ++   S  K+ELL+FGGE+T++   TT FYN+L
Sbjct: 54  NFKKEQENYEKINIESVEKPSIRNNGSIIS--STTKKELLLFGGEHTSKELQTTKFYNDL 111

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           +T+S D +QWK+ITS+N+PMPRSSAA A HPSG+ L++GGEFSSPKQ+TFYHYSD+W+LD
Sbjct: 112 YTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILD 171

Query: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
            ++KEWTKI+ K  P  RSGHR+T WKN+F++ GGF+DLG STTY ND WLFDITTYKWK
Sbjct: 172 LTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWK 231

Query: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDIT 293
           QVEFP NH +PDARSGHSLIPT EG IV+GGYC              + CW L+MK+D+ 
Sbjct: 232 QVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKADVE 291

Query: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353
            IRWERR+KQGFQPSPRVGCSMA+HKGRGILFGGVYD++ETEE L S F+NDL +Y +E+
Sbjct: 292 AIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIES 351

Query: 354 NRWYSIKMRPQXXXXXXXXXXXXXXDDELVGILNDILQXXXXXXXXXXXXXXXXXXXXXX 413
           NRW+++ ++ +                E    L D+L                       
Sbjct: 352 NRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESSDIF 411

Query: 414 HRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSI 473
              DE++     +     V QLPH RFNA TTV+DD L+I+GG+WE+GE D+SIDSFYSI
Sbjct: 412 GSDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSIDSFYSI 471

Query: 474 DLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEMEDDK 533
           DLN+ DGV V+WEDL EIE AK+ G                           +   +   
Sbjct: 472 DLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEEVEDTKLIAED--- 528

Query: 534 XXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGK 593
                            EIPDPRPWLPHPKAFE+LRAFY+R G  FL+WAISNNR  +GK
Sbjct: 529 --VEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTRGK 586

Query: 594 HLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
            LK++SF+L QDRWWERR+Q+ IEEDKLEE+G V +++ERD+S +  +R
Sbjct: 587 LLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/613 (51%), Positives = 392/613 (63%), Gaps = 30/613 (4%)

Query: 54  NFRKEQELFQEVVVTPVKRP-----SPRSNVCMVPNPS-HGKR--ELLIFGGEYTNQTSS 105
           NF+ EQE F+++ V  + +      SPRSN  M+   S H K+  ELL+FGGEYT+  + 
Sbjct: 56  NFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSPETG 115

Query: 106 TTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYH 165
            T FYN+L +Y+ DT QW+KITS+N+PMPRSSAA   HPSG+ ++HGGEFSSPKQNTFYH
Sbjct: 116 MTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYH 175

Query: 166 YSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWL 224
           YSD+W+LD S+KEWTK+D K  P ARSGHR+  WKN+FV+ GGF+D+G + T Y ND W 
Sbjct: 176 YSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWC 235

Query: 225 FDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXX--TD 282
           FDI  YKW QVEFP NHP+PD RSGHS IP +EG I+WGGY                  D
Sbjct: 236 FDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILND 295

Query: 283 CWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
           CWYL+MKSD++ IRWERRKK GFQPSPRVGCSMA+HKGRGILFGGVYD++ETEE L S F
Sbjct: 296 CWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESLF 355

Query: 343 FNDLLSYQVEANRWYSIKMRP----QXXXXXXXXXXXXXXDDELVGILNDILQXXXXXXX 398
           +NDL SY VE NRW+++ +R                    + EL  +LN IL+       
Sbjct: 356 YNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDE 415

Query: 399 XXXXXXXXXXXXXXXHRL--------DEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDT 450
                                     ++ E    + +   ++ QLPH R+N A TVVDD 
Sbjct: 416 DDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDL 475

Query: 451 LFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXX 510
           LFI+GGSWE GE+D+ I+SFYSIDLNR DGV  +WEDL+EIEKAK+ G            
Sbjct: 476 LFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDD 535

Query: 511 XXXXXXXXXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGP-EIPDPRPWLPHPKAFETLR 569
                            E++D K                  EIPD RPWLPHPK FE+LR
Sbjct: 536 EEDDDEDDDE------EEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLR 589

Query: 570 AFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVEN 629
           AFYIR G  FL+WAISNN+  +GKHLKK+SF+L +DRWWERR+Q+RIEEDKLEE+G V +
Sbjct: 590 AFYIREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGD 649

Query: 630 IIERDSSHSTKRR 642
           +IE+D+S    +R
Sbjct: 650 VIEKDTSKGASKR 662

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/476 (59%), Positives = 344/476 (72%), Gaps = 8/476 (1%)

Query: 30  KDKKRSKKLNSXXXXXXXXXXXXXNFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPS--H 87
           KDKKR+KKL+              NF+KEQE F++V V  V + + R N CMV NPS   
Sbjct: 29  KDKKRAKKLDEDDDDMDIEEVLA-NFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASS 87

Query: 88  GKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGV 147
            K+EL++FGGE+TN  +STTTFYN+L T++ + +QWK+ TS+NAPMPRSSAA A HPSG+
Sbjct: 88  SKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGI 147

Query: 148 VLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHG 207
            L+HGGEFSSPKQNTFYHYSD+W+LDC++KEW K+D K GPSARSGHR+TVWKNFF++HG
Sbjct: 148 ALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHG 207

Query: 208 GFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCX 267
           GFRDLGTSTTYL+DCWLFDITTYKWKQVEFP NH VPDARSGHS IPT EGAI+WGGYC 
Sbjct: 208 GFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCK 267

Query: 268 XXXXXX-XXXXXXXTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFG 326
                         +DCWYL+MKSDI+GIRWERR+KQGFQPSPRVGCSMA+HKGRGILFG
Sbjct: 268 VKANKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFG 327

Query: 327 GVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQXXXXXXXXXX----XXXXDDEL 382
           GVYD+EETEE L S FFNDL SY +E+NRWYS+ +R +                  + EL
Sbjct: 328 GVYDFEETEESLESNFFNDLFSYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKEL 387

Query: 383 VGILNDILQXXXXXXXXXXXXXXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNA 442
             +L+ IL+                          E+E       Q+ ++ QLPH RFNA
Sbjct: 388 KMLLDSILEKANLQDKSDDDEDDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNA 447

Query: 443 ATTVVDDTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQG 498
            TTV+DDTLFIFGG WE G+++F IDS YSIDLN+ DGV ++WEDL+EIE+AK+ G
Sbjct: 448 TTTVIDDTLFIFGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG 503

 Score =  160 bits (406), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%)

Query: 553 PDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERRE 612
           PDPRPWLPHPK FETLRAFYIR GA FL+WAISNN++AKGKHLKK SFDL Q+RWWERR+
Sbjct: 552 PDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRD 611

Query: 613 QVRIEEDKLEEMGGVENIIERDSSHSTKRR 642
           Q+RIEEDKLEE+GGV +IIERD S S+KRR
Sbjct: 612 QLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/628 (48%), Positives = 387/628 (61%), Gaps = 23/628 (3%)

Query: 30  KDKKRSKKLNSXXXXXXXXXXXX--XNFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSH 87
           KD+KR KK                  NF+ EQE F++VVV  V  P+PR+N C+V N S 
Sbjct: 30  KDQKRVKKFGLDSDDEEDLDIDTILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNAS- 88

Query: 88  GKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGV 147
            K ELL+FGGE TN  ++ T FYN+L  Y+   +QWKK TS+N+PMPRSSAA   H SGV
Sbjct: 89  -KPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGV 147

Query: 148 VLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHG 207
            ++ GGEFSSPKQNTFYHY+D+WLLD +++EW+K+D KNGPSARSGHR+T WKN+F++ G
Sbjct: 148 TILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFG 207

Query: 208 GFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCX 267
           GF+DL   T+Y ND WLF++  +KW + E   N   PD RSGHS I + EG IV+GGYC 
Sbjct: 208 GFKDLNQGTSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCK 266

Query: 268 XXXXXXXX--XXXXXTDCWYLRMKSDITGIRWERRKKQGFQPSPRVGCSMA-HHKGRGIL 324
                          TDCW L+M  ++  I+WERR K+G QPSPRVGCSMA H   RGIL
Sbjct: 267 VKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGIL 326

Query: 325 FGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRP------QXXXXXXXXXXXXXX 378
           FGGVYD EETEE LSS ++NDL SY +E+NRWY +K+R                      
Sbjct: 327 FGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQ 386

Query: 379 DDELVGILNDILQXXXXXXXXXXXXXXXXX---XXXXXHRLDEEELLGHQQKQYPVVAQL 435
           + EL  +LN IL+                            D+ E     +   P + QL
Sbjct: 387 EKELQDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQL 446

Query: 436 PHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAK 495
           PH RFNA TTV++DT +I+GG WE+ + D++IDSFYSIDLN+ DG+  ++E+L+EIE+ K
Sbjct: 447 PHERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVK 506

Query: 496 DQGXXXXXXXXXXXXXXXXXXXXXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDP 555
             G                           +   +DD+                 EIPDP
Sbjct: 507 RLGDVQSEDDFEYEDDDDEDDGEAEPTNERLEAEDDDEEENEEDEGIDEM-----EIPDP 561

Query: 556 RPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVR 615
           RPWLPHPKAFE+LR FYIR G +FL+WAISNN+ AKGKHLK++SF+L QDRWWERR+Q++
Sbjct: 562 RPWLPHPKAFESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQ 621

Query: 616 IEEDKLEEMGGVENIIERDS-SHSTKRR 642
           IEEDKL+E+G   +IIERD+ S  T RR
Sbjct: 622 IEEDKLQELGVGGDIIERDAQSPPTARR 649

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  502 bits (1293), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 266/602 (44%), Positives = 351/602 (58%), Gaps = 22/602 (3%)

Query: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114
           F K+Q   + V +T V+R S R++  M  NP H KREL IFGGE+T+  +  T FYN+L+
Sbjct: 58  FTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLY 117

Query: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174
           +YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 118 SYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGT-STTYLNDCWLFDITTY 230
           + +++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+ Y
Sbjct: 178 AERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCX--XXXXXXXXXXXXXTDCWYLRM 288
           KW ++E    +  P+ARSGH  IPT   AI+ GGYC                 D W L +
Sbjct: 238 KWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNL 294

Query: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354

Query: 348 SYQVEANRWYSIKMRPQXXXXXXXX------XXXXXXDDELVGILNDILQXXXXXXXXXX 401
            + +E N+W  ++++PQ                    + EL  +LN IL           
Sbjct: 355 MFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDDD 414

Query: 402 XXXXXXXXXXXXHRLDEEELLGHQQKQYPVVA-QLPHSRFNAATTVVDDTLFIFGGSWEY 460
                           E++       +   ++ QLPH RFNAAT VVDD+LFI+ G WE 
Sbjct: 415 DNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWEL 474

Query: 461 GERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXXX 520
           GE+D+ I+SFYSIDLN+ DGV V+WEDL  IE+AK  G                      
Sbjct: 475 GEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDGEDN 534

Query: 521 XXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFL 580
                   +   +              A  EIPD R WLPHPK FETLRAFY+R GA FL
Sbjct: 535 DEEEQDVALL--EGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFL 592

Query: 581 QWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTK 640
            W+ISNN+  KGKHLK +SF++ +DRWWERR+QV +EE++LE+ GG   IIERD++    
Sbjct: 593 TWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKIS 649

Query: 641 RR 642
           +R
Sbjct: 650 KR 651

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 268/604 (44%), Positives = 351/604 (58%), Gaps = 25/604 (4%)

Query: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113
           +F K+Q   + V +T V++PS R++  M  NP H K EL IFGGE+T+  +  T FYN+L
Sbjct: 57  SFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDL 116

Query: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173
           ++YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL D
Sbjct: 117 YSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFD 176

Query: 174 CSSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGT-STTYLNDCWLFDITT 229
           C  +++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+T
Sbjct: 177 CVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDIST 236

Query: 230 YKWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCX--XXXXXXXXXXXXXTDCWYLR 287
           YKW ++E    +  PDARSGH  IPT   AI+ GGYC                 D W L 
Sbjct: 237 YKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLN 293

Query: 288 MKSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDL 346
           +  D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL
Sbjct: 294 LTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDL 353

Query: 347 LSYQVEANRWYSIKMRPQXXXXXXXX------XXXXXXDDELVGILNDILQXXXXXXXXX 400
             + +E N+W  ++++PQ                    + EL  +LN IL          
Sbjct: 354 YMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDD 413

Query: 401 XXXXXXXX--XXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSW 458
                             +E++     Q+   +  QLPH RFNAAT VV D+LFI+ G W
Sbjct: 414 DNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVW 473

Query: 459 EYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXX 518
           E GE+D+ I+SFYSIDLN+ DGV+V+WEDL  IE+AK  G                    
Sbjct: 474 ELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDD 533

Query: 519 XXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAE 578
                                        A  EIPD R WLPHPK FETLRAFY+R GA 
Sbjct: 534 GEEEQDAGPLEG----DEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGAN 589

Query: 579 FLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSHS 638
           FL W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD++  
Sbjct: 590 FLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTK 646

Query: 639 TKRR 642
             +R
Sbjct: 647 PSKR 650

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  499 bits (1286), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 270/605 (44%), Positives = 352/605 (58%), Gaps = 26/605 (4%)

Query: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114
           F K+Q   + V +T V+RPS R +  M  NP H K EL IFGGE+T+  +  T FYN+L+
Sbjct: 58  FTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLY 117

Query: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174
           +YS+  + WKK  S+NAP+PRSS A A H SG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTY 230
             K++TK++   + + PSARSGHR+  WKN+F++ GGFRDLG+  T+YLND W FDI+ Y
Sbjct: 178 HEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNY 237

Query: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXX--XXXTDCWYLRM 288
           KW ++E    +  PDARSGH  +PT   AI+ GGYC                 D W L +
Sbjct: 238 KWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTL 294

Query: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLY 354

Query: 348 SYQVEANRWYSIKMRPQXXX------XXXXXXXXXXXDDELVGILNDILQXXX----XXX 397
            + +E N+W  ++++PQ                    + EL  +LN IL           
Sbjct: 355 MFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDD 414

Query: 398 XXXXXXXXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGS 457
                              DE++     Q+   +  QLPH RFNAAT VVDD+LFI+ G 
Sbjct: 415 NDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGV 474

Query: 458 WEYGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXX 517
           WE GE+D+ I+SFYSIDLN+ DGV+V+WEDL  +E+AK  G                   
Sbjct: 475 WELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDED 534

Query: 518 XXXXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGA 577
                      +EDD               A  EIPD R WLPHPK FETLRAFY+R GA
Sbjct: 535 DDEEEPQDTRLLEDDD---DEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGA 591

Query: 578 EFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERDSSH 637
            FL W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD++ 
Sbjct: 592 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATA 648

Query: 638 STKRR 642
              +R
Sbjct: 649 KPSKR 653

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  494 bits (1273), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 268/604 (44%), Positives = 351/604 (58%), Gaps = 26/604 (4%)

Query: 55  FRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELF 114
           F K+Q   + V +T V+RPS R++  M  NP H K EL IFGGE+T+  +  T FYN+L+
Sbjct: 58  FTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLY 117

Query: 115 TYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDC 174
           +YS+  + WKK  S+NAP+PRSSAA A HPSG+ L+HGGEFSSPKQ+ FYHYSD+WL DC
Sbjct: 118 SYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDC 177

Query: 175 SSKEWTKID---QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTS-TTYLNDCWLFDITTY 230
             +++ K++   + + PSARSGHR+  WKN+F++ GGFRDLG   T+YLND W FDI+ Y
Sbjct: 178 VERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNY 237

Query: 231 KWKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXX--XXXTDCWYLRM 288
           KW ++E    +  PDARSGH  IPT   AI+ GGYC                 D W L +
Sbjct: 238 KWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNL 294

Query: 289 KSDITGIRWERRKKQGFQPSPRVGCSMAHHK-GRGILFGGVYDYEETEEGLSSEFFNDLL 347
             D    +WE+ K    QPSPRVG S    K  + + FGGVYD +ETEE L S F+NDL 
Sbjct: 295 TPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLY 354

Query: 348 SYQVEANRWYSIKMRPQXXX------XXXXXXXXXXXDDELVGILNDILQXXXXXXXXXX 401
            + +E N+W  ++++ Q                    + EL  +LN IL           
Sbjct: 355 MFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDE 414

Query: 402 XX--XXXXXXXXXXHRLDEEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWE 459
                            +E++     Q+   +  QLPH RFNAAT VV D+LFI+ G WE
Sbjct: 415 NDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWE 474

Query: 460 YGERDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQGXXXXXXXXXXXXXXXXXXXXX 519
            GE+D+ I+SFYSIDLN+ DGV+V+WE+L  IE+AK  G                     
Sbjct: 475 LGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQS 534

Query: 520 XXXXXXIAEMEDDKXXXXXXXXXXXXXXAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEF 579
                      D+               A  EIPD R WLPHPK FETLRAFY+R GA F
Sbjct: 535 EEEQDAGLLESDED----EESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 580 LQWAISNNRSAKGKHLKKQSFDLSQDRWWERREQVRIEEDKLEEMGGVENIIERD-SSHS 638
           L W+ISNNR+ KGK LK +SF+L +DRWWERR+QV +EE++LE+ GG   IIERD ++  
Sbjct: 591 LTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKP 647

Query: 639 TKRR 642
           +KRR
Sbjct: 648 SKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 105/261 (40%), Gaps = 58/261 (22%)

Query: 123 WKKITSRNAPMPR----SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKE 178
           W +I  +N+P PR    SSA A    S  + I GG            Y D+W++ C+  +
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATA--SNNIYILGGLHDQSV------YGDTWIISCNP-D 189

Query: 179 WTKIDQK------NGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYK 231
            T+   K      N P  R GH  T+  N F++ GG    +       +D +LF+I +YK
Sbjct: 190 ATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYK 249

Query: 232 WKQVEFP-PNHPVPDARSGHSLIPTQEGAI-----VWGGYCXXXXXXXXXXXXXXTDCWY 285
           W     P P  P P  R GH +       +     ++GG                 D ++
Sbjct: 250 WT---IPNPIGPRPLGRYGHKICILATSTVKTKLYLFGGQFD--------------DTYF 292

Query: 286 LRMKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLS 339
             +   D++  R     WE  K +GF P P    +M  +     ++GG     +T++GL 
Sbjct: 293 NDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL- 346

Query: 340 SEFFNDLLSYQVEANRWYSIK 360
               ND+  +    N W  ++
Sbjct: 347 ---INDIFKFSPNTNTWTKVE 364

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 88/195 (45%), Gaps = 28/195 (14%)

Query: 79  VCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-AP 132
           +C++   S  K +L +FGG++ +      T++N+L  + L +       W+ I S+   P
Sbjct: 268 ICILAT-STVKTKLYLFGGQFDD------TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMP 320

Query: 133 MPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSAR 191
            P ++     + S +  I+GG+      N  + +S       ++  WTK++     P   
Sbjct: 321 PPLTNHTMVTYGSDL-WIYGGDTQQGLINDIFKFS------PNTNTWTKVETTGTKPPPM 373

Query: 192 SGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPP-NHPVPDARSGH 250
             H   V+KN   + GG  +   +  YLN  +LF+  + KW    FP     +   RSGH
Sbjct: 374 QEHAAVVYKNIMCVVGGKDE---NDMYLNSVYLFNFDSSKW--YTFPDFKSGIIQGRSGH 428

Query: 251 SL-IPTQEGAIVWGG 264
           S+ +   +  ++ GG
Sbjct: 429 SVTLLNNDKLLIMGG 443

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 69/146 (47%), Gaps = 21/146 (14%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKI-TSRNA 131
           P P +N  MV   ++G  +L I+GG+      +     N++F +S +T+ W K+ T+   
Sbjct: 320 PPPLTNHTMV---TYG-SDLWIYGGD------TQQGLINDIFKFSPNTNTWTKVETTGTK 369

Query: 132 PMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEW-TKIDQKNG-PS 189
           P P    AA  + + + ++ G +     +N  Y  S  +L +  S +W T  D K+G   
Sbjct: 370 PPPMQEHAAVVYKNIMCVVGGKD-----ENDMYLNS-VYLFNFDSSKWYTFPDFKSGIIQ 423

Query: 190 ARSGHRMTVWKN--FFVMHGGFRDLG 213
            RSGH +T+  N    +M G   D  
Sbjct: 424 GRSGHSVTLLNNDKLLIMGGDKYDFA 449

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 122/296 (41%), Gaps = 59/296 (19%)

Query: 77  SNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQ--------WKKITS 128
           S + M P P+ G+R   +     T   + + T  N L +Y+  TD         W +I  
Sbjct: 109 SRIFMTPTPA-GQRN--VSAASSTMPMAYSQTLGNNLPSYNEPTDYHKLHPTTIWNRIKL 165

Query: 129 RNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEW-TKIDQK 185
           +N+P PR    A+ + S  G + + GG            Y D+W+L   +    T I  K
Sbjct: 166 QNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENNGLSTTITSK 219

Query: 186 ------NGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQVEFP 238
                 N P  R GH  T+  N FV+ GG    +    +  +D +LF+I +YKW   +  
Sbjct: 220 TVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSYKWTIPK-- 277

Query: 239 PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLRMKS-DI 292
           P    P  R GH  S+I T +      ++GG                 D ++  +   D+
Sbjct: 278 PVGQRPLGRYGHKISIIATSQMKTKLYLFGGQFD--------------DTYFNDLVVFDL 323

Query: 293 TGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFF 343
           +  R     WE  + + F P P    +M  +  +  +FGG     +T +GL+++ F
Sbjct: 324 SSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG-----DTLQGLTNQVF 374

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 80/194 (41%), Gaps = 34/194 (17%)

Query: 86  SHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN---APMPRSS 137
           S  K +L +FGG++ +      T++N+L  + L +       W+ I  ++    P+   +
Sbjct: 297 SQMKTKLYLFGGQFDD------TYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHT 350

Query: 138 AAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKI-------DQKNGPSA 190
             +  H    + + GG+      N  + Y      D    +W  +       D  N P  
Sbjct: 351 MCSYDHK---LWVFGGDTLQGLTNQVFMY------DPVDNDWCVVETFANNNDVSNIPPP 401

Query: 191 RSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGH 250
              H   ++K+   + GG  +   S  YLND +  ++ T KW ++ F     VP  RSGH
Sbjct: 402 IQEHAAVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGH 457

Query: 251 SLIPTQEGAIVWGG 264
           S+   +   I+  G
Sbjct: 458 SVTLLKNDKILIMG 471

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 104/258 (40%), Gaps = 52/258 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLL----DCSS 176
           W +I  +N+P PR    A+ + +    + + GG            Y D+W+L    D + 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV------YGDTWILSAFDDATK 166

Query: 177 KEWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
              T ID  +  P  R GH   +  N FV+ GG    +       +D +L ++ +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKWT- 225

Query: 235 VEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P  P P  R GH  S+I T +      V+GG                 D ++  +
Sbjct: 226 --VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFD--------------DTYFNDL 269

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     W+  K   F P P    +M  +  +  +FGG     +T +GL    
Sbjct: 270 AVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG-----DTLQGL---- 320

Query: 343 FNDLLSYQVEANRWYSIK 360
            ND+  Y    N W++I+
Sbjct: 321 INDVFMYDPAKNDWFTIE 338

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 77/186 (41%), Gaps = 29/186 (15%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT--------DQWKKITSRNAPMPRSSAAA 140
           K +L +FGG++ +      T++N+L  Y L +        D  K +T    P P ++   
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWDFLKPMTF--TPPPMTNFTM 302

Query: 141 AGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVW 199
             + S + +  G              +D ++ D +  +W  I+     P     H   V+
Sbjct: 303 ISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVY 355

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSL-IPTQEG 258
            +   + GG  +      YLN  +  ++ T+KW ++       +P  RSGHSL +   + 
Sbjct: 356 NDLMCVVGGKDE---HDAYLNTVYFLNLKTHKWFKLPIFA-AGIPQGRSGHSLTLLKNDK 411

Query: 259 AIVWGG 264
            ++ GG
Sbjct: 412 VLIMGG 417

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 106/258 (41%), Gaps = 52/258 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWL---LDCSSK 177
           W +I  +N+P PR    A+ + +    + + GG            Y D+W+   LD ++K
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV------YGDTWILTALDNATK 166

Query: 178 -EWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
              T ID  +  P  R GH   +  N FV+ GG    +       +D +L +I +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT- 225

Query: 235 VEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P  P P  R GH  S+I T +      V+GG                 D ++  +
Sbjct: 226 --VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFD--------------DTYFNDL 269

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     WE  K + F P P    +M  +  +  +FGG     +T +GL    
Sbjct: 270 AVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG-----DTLQGL---- 320

Query: 343 FNDLLSYQVEANRWYSIK 360
            ND+  Y    N W+ I+
Sbjct: 321 INDVFMYDPAINDWFIIE 338

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 76/184 (41%), Gaps = 26/184 (14%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N+L  Y L +       W+ +  +   P P ++     
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVWKN 201
           + S + +  G              +D ++ D +  +W  I+     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYND 357

Query: 202 FFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPP-NHPVPDARSGHSLIPTQEGAI 260
              + GG  +      YLN  +  ++ ++KW   + P     +P  RSGHSL   ++  I
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSHKW--FKLPVFTAGIPQGRSGHSLTLLKDDKI 412

Query: 261 VWGG 264
           +  G
Sbjct: 413 LIMG 416

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 106/261 (40%), Gaps = 52/261 (19%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLL----DCSS 176
           W +I  +++P PR     + + +    V + GG      Q+ F    D W++    + + 
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHD---QSVF---GDVWIIKSLENGTK 250

Query: 177 KEWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
              T ID  +N P  R GH  T+  N FV+ GG    +       +D +LF+I +YKW  
Sbjct: 251 FTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINSYKWT- 309

Query: 235 VEFP-PNHPVPDARSGHSL-----IPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P  P P  R GH +      P +    ++GG                 D ++  +
Sbjct: 310 --IPNPIGPRPLGRYGHKVSIIATTPMKTKLYLFGGQFD--------------DTYFNNL 353

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     WE  K + F P P    +M  ++ +  +FGG     +T +GL    
Sbjct: 354 AVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG-----DTLQGL---- 404

Query: 343 FNDLLSYQVEANRWYSIKMRP 363
            N +  Y  E N W  ++  P
Sbjct: 405 INKIFMYDPEVNDWTVVETFP 425

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 74/177 (41%), Gaps = 30/177 (16%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N L  + L         W+ +  ++  P P ++     
Sbjct: 335 KTKLYLFGGQFDD------TYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVS 388

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKI-------DQKNGPSARSGHR 195
           +    + I GG+      N  + Y      D    +WT +       DQ+N P     H 
Sbjct: 389 Y-QNKLWIFGGDTLQGLINKIFMY------DPEVNDWTVVETFPANNDQENFPPPMQEHA 441

Query: 196 MTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSL 252
             ++ +  V+ GG  +      YLN  +   I T +W ++ F  +  +P  RSGHS+
Sbjct: 442 SVMYGDLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPF-LSVGIPQGRSGHSI 494

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 100/258 (38%), Gaps = 52/258 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W +I   ++P PR    A+ + S    V + GG            Y D+W+L   +   T
Sbjct: 73  WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV------YGDTWILTAHANN-T 125

Query: 181 KIDQKN------GPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N FV+ GG    +       +D +LF+I +YKW 
Sbjct: 126 RFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVYLFNINSYKWT 185

Query: 234 QVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH  S+I T +      V+GG                  C Y  
Sbjct: 186 ---IPHPVGPRPLGRYGHKISVIATSQMKTKLYVFGGQFDDTYFNDL--------CVY-- 232

Query: 288 MKSDITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     WE  K Q F P P    +M  +  +  +FGG     +T +GL    
Sbjct: 233 ---DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTAQGL---- 280

Query: 343 FNDLLSYQVEANRWYSIK 360
            N++  Y    N W  ++
Sbjct: 281 INEVFMYDPTVNDWTVVE 298

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 78/172 (45%), Gaps = 24/172 (13%)

Query: 86  SHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAA 139
           S  K +L +FGG++ +      T++N+L  Y L +       W+ +  ++  P P ++  
Sbjct: 208 SQMKTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHT 261

Query: 140 AAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG-PSARSGHRMTV 198
              +   +  I GG+ +    N  + Y      D +  +WT ++     P A   H   V
Sbjct: 262 MVSYDYKL-WIFGGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAVV 314

Query: 199 WKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGH 250
           +K+   + GG  +     +Y ND +  ++ ++KW ++ F  N  VP  RSGH
Sbjct: 315 YKDLMCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 111/278 (39%), Gaps = 58/278 (20%)

Query: 103 TSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHP--SGVVLIHGGEFSSPKQ 160
           TS+ +T   ++FT       W +I  + +P PR    A+ +   SG + + GG       
Sbjct: 79  TSTQSTLQQQVFT------PWNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV- 131

Query: 161 NTFYHYSDSWLLD-----CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG-FRDLGT 214
                Y D+W++       S K  T       P  R GH  T+  N FV+ GG    +  
Sbjct: 132 -----YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVND 186

Query: 215 STTYLNDCWLFDITTYKWKQVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXX 268
           +    +D +LF+I ++KW     P P  P P  R GH  S+I   +      V+GG    
Sbjct: 187 AGLMDDDIYLFNINSHKWT---IPTPQGPRPLGRYGHKISIIAANQMKTKLYVFGGQFD- 242

Query: 269 XXXXXXXXXXXXTDCWYLRMKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRG 322
                        D ++  +   D++  R     WE  K   F P P    +M     + 
Sbjct: 243 -------------DTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKL 289

Query: 323 ILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIK 360
            +FGG     +T +GL++E F     +   AN W  ++
Sbjct: 290 WVFGG-----DTPQGLTNEVF----MFDPAANDWCVVQ 318

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 84/187 (44%), Gaps = 31/187 (16%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQW---KKITSRNAPMPRSSAAA 140
           K +L +FGG++ +      T++N+L  + L +       W   K  T    P+   +  +
Sbjct: 231 KTKLYVFGGQFDD------TYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMIS 284

Query: 141 AGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVW 199
             H    + + GG+  +P+  T    ++ ++ D ++ +W  +    N P     H   ++
Sbjct: 285 FDHK---LWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAIIY 335

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPP-NHPVPDARSGHSL-IPTQE 257
           ++   + GG +D      Y N  +  +  + KW   + P  N+ +P ARSGHSL + +  
Sbjct: 336 RDLMCVFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARSGHSLTLLSNN 390

Query: 258 GAIVWGG 264
             ++ GG
Sbjct: 391 KLLIMGG 397

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/263 (25%), Positives = 104/263 (39%), Gaps = 54/263 (20%)

Query: 119 DTDQWKKITSRNAPMPR---SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCS 175
           D   W +I   N+P PR    ++A A     + +I G    S        Y D+W+L   
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 176 SKEWTKIDQK-----NGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITT 229
           +     I Q      N P  R GH  T+  N F++ GG    +       +D +LF+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 230 YKWKQVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDC 283
           +KW     P P  P P  R GH  S+I T        ++GG                 D 
Sbjct: 243 HKWT---IPNPVGPRPLGRYGHKISIIATANSKTRLYLFGGQFD--------------DA 285

Query: 284 WYLRMKS-DITGI-----RWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEG 337
           ++  +   D++       RWE  K + F P P    +M  +  +  +FGG     +T +G
Sbjct: 286 YFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-----DTLQG 340

Query: 338 LSSEFFNDLLSYQVEANRWYSIK 360
           L++  F     Y    N W +I+
Sbjct: 341 LTNRVF----MYDPMINDWTTIE 359

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 84/187 (44%), Gaps = 21/187 (11%)

Query: 86  SHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAA 139
           ++ K  L +FGG++ +       ++N+L  + L +      +W+ +  ++  P P ++  
Sbjct: 269 ANSKTRLYLFGGQFDD------AYFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHT 322

Query: 140 AAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVW 199
              +    + + GG+      N  + Y D  + D ++ E +  +  N       H   V+
Sbjct: 323 MVSY-DNKLWVFGGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAAIVY 380

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVE-FPPNHPVPDARSGHSL-IPTQE 257
           K+   + GG  +     TYLN  +  ++ T KW ++  F P   +P  RSGHS+ +   +
Sbjct: 381 KDLMCIFGGKDE---QDTYLNGVYFLNLRTLKWYKLPIFAPG--IPQGRSGHSITLLKND 435

Query: 258 GAIVWGG 264
             ++ GG
Sbjct: 436 KLLIMGG 442

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 103/257 (40%), Gaps = 52/257 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLL----DCSS 176
           W +I  +N+P PR    A+ + +    + + GG            Y D+W+L    + + 
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV------YGDTWILTAFDNATR 166

Query: 177 KEWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
              T ID  +  P  R GH   +  N FV+ GG    +       +D +L +I +YKW  
Sbjct: 167 FSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT- 225

Query: 235 VEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P  P P  R GH  S+I T +      V+GG                 D ++  +
Sbjct: 226 --VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFD--------------DTYFNDL 269

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     WE  K + F P P    +M  +  +  +FGG     +T +GL    
Sbjct: 270 AVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG-----DTLQGL---- 320

Query: 343 FNDLLSYQVEANRWYSI 359
            ND+  Y    N W+ I
Sbjct: 321 VNDVFMYDPAINDWFII 337

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 74/184 (40%), Gaps = 26/184 (14%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N+L  Y L +       W+ +  R   P P ++     
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVWKN 201
           + S + +  G              +D ++ D +  +W  ID     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYND 357

Query: 202 FFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPP-NHPVPDARSGHSLIPTQEGAI 260
              + GG  +      YLN  +  ++ + KW   + P     +P  RSGHSL   +   I
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSRKW--FKLPVFTAGIPQGRSGHSLTLLKNDKI 412

Query: 261 VWGG 264
           +  G
Sbjct: 413 LIMG 416

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 107/259 (41%), Gaps = 54/259 (20%)

Query: 123 WKKITSRNAPMPR---SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLL---DCSS 176
           W +I  +++P PR    S+A     + + +I G    S        Y D+W+L   D ++
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 K-EWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           K   T ID  +  P  R GH   +  N FV+ GG    +       +D +L +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 234 QVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH  S+I T +      V+GG                 D ++  
Sbjct: 226 ---VPAPVGPRPLGRYGHKISIIATNQMKTKLYVFGGQFD--------------DTYFND 268

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     WE  K + F P P    +M  +  +  +FGG     +T +GL   
Sbjct: 269 LAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG-----DTLQGL--- 320

Query: 342 FFNDLLSYQVEANRWYSIK 360
             ND+  Y    N W+ I+
Sbjct: 321 -VNDVFMYDPALNDWFIIE 338

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 75/184 (40%), Gaps = 26/184 (14%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N+L  Y L +       W+ +  +  +P P ++     
Sbjct: 251 KTKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVWKN 201
           + S + +  G              +D ++ D +  +W  I+     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYND 357

Query: 202 FFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPP-NHPVPDARSGHSLIPTQEGAI 260
              + GG  +      YLN  +  ++ + KW   + P     +P  RSGHSL   +   I
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSNKW--FKLPVFTAGIPQGRSGHSLTLLKNDKI 412

Query: 261 VWGG 264
           +  G
Sbjct: 413 LIMG 416

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/260 (25%), Positives = 101/260 (38%), Gaps = 54/260 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPSGV--VLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W +I  +N+P PR    A+   S    V + GG            Y D+W+L C   + +
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQSV------YGDTWVLTCEDPQTS 184

Query: 181 KI-------DQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYL-NDCWLFDITTYKW 232
            +         +  P  R GH  T+  N FV+ GG          + +D +LF+I +YKW
Sbjct: 185 TMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYKW 244

Query: 233 KQVEFP-PNHPVPDARSGH--SLIP---TQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYL 286
                P P  P P  R GH  S+I     Q    ++GG                 D ++ 
Sbjct: 245 T---IPHPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFD--------------DNYFN 287

Query: 287 RMKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSS 340
            +   D++  R     WE  K + F P P    +M  +  +  +FGG     +T EGL  
Sbjct: 288 DLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-----DTLEGL-- 340

Query: 341 EFFNDLLSYQVEANRWYSIK 360
              N +  Y    N W  ++
Sbjct: 341 --LNQVFMYDPAVNDWCVVE 358

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 79/193 (40%), Gaps = 41/193 (21%)

Query: 91  ELLIFGGEYTNQTSSTTTFYNELFTYSL-----DTDQWKKITSRN-APMPRSSAAAAGHP 144
           +L +FGG++ +       ++N+L  + L     D   W+ I  R+  P P ++     + 
Sbjct: 273 KLYLFGGQFDD------NYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSY- 325

Query: 145 SGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKI-------DQKNGPSARSGHRMT 197
              + + GG+      N  + Y      D +  +W  +       D +N P     H   
Sbjct: 326 DFKLWVFGGDTLEGLLNQVFMY------DPAVNDWCVVETTCQDDDLENMPPPMQEHATL 379

Query: 198 VWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHP-----VPDARSGHSL 252
           ++K    + GG  +      YLND +  ++ + KW ++      P     +P  RSGHS+
Sbjct: 380 IYKGLMCIVGGKDE---QDHYLNDVYFLNLKSLKWFRL------PRFMDGIPQGRSGHSV 430

Query: 253 -IPTQEGAIVWGG 264
            +   +  ++ GG
Sbjct: 431 TLLKNDKLLIMGG 443

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 104/254 (40%), Gaps = 52/254 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLL---DCSSK 177
           W ++   N+P PR    A+ + S    V + GG            Y D+W++   D  SK
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQSV------YGDTWIISAHDNGSK 131

Query: 178 EWTK-ID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
             +K +D     P  R GH  T+  N FV+ GG    + +     +D +LF+I +YKW  
Sbjct: 132 FSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT- 190

Query: 235 VEFP-PNHPVPDARSGH--SLIPTQE---GAIVWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P  P P  R GH  S+I T +      V+GG                 D ++  +
Sbjct: 191 --IPRPVGPRPLGRYGHKISIIATSQMRTKLYVFGGQFD--------------DTYFNDL 234

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     W+  K   F P P    +M  +  +  +FGG     +T +GL    
Sbjct: 235 TVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL---- 285

Query: 343 FNDLLSYQVEANRW 356
            ND+  +  + N W
Sbjct: 286 INDVFMFDPQINDW 299

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 80/190 (42%), Gaps = 32/190 (16%)

Query: 86  SHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAA 139
           S  + +L +FGG++ +      T++N+L  + L +       W+ I      P P ++  
Sbjct: 213 SQMRTKLYVFGGQFDD------TYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHT 266

Query: 140 AAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PSARSGHRMT 197
              +    + + GG+      N      D ++ D    +W K+ Q  G  P     H   
Sbjct: 267 MISY-DYKLWVFGGDTPQGLIN------DVFMFDPQINDW-KVMQTTGDKPPPLQEHAAV 318

Query: 198 VWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNH--PVPDARSGHS--LI 253
           ++ +   + GG  +      Y N  +  ++ + KW ++   P++   +P  RSGHS  L+
Sbjct: 319 LYGDLMCVVGGKDE---QDVYSNSVFFLNLISLKWFKL---PSYRSGIPQGRSGHSLTLL 372

Query: 254 PTQEGAIVWG 263
           P  +  I+ G
Sbjct: 373 PNHKLLIMGG 382

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 103/263 (39%), Gaps = 54/263 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W++I   N+P PR    A+ + S    V + GG            Y D+W++  S +   
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQSV------YGDTWIV-TSHENGA 128

Query: 181 KIDQKN------GPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N FV+ GG    + +     +D +LF+I +YKW 
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKWT 188

Query: 234 QVEFP-PNHPVPDARSGH-----SLIPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH     ++ P +    V+GG                 D ++  
Sbjct: 189 ---IPNPVGPRPLGRYGHKISIIAMSPMKTKLYVFGGQFD--------------DTYFND 231

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     W+      F P P    +M  +  +  +FGG     +T +GL   
Sbjct: 232 LAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL--- 283

Query: 342 FFNDLLSYQVEANRWYSIKMRPQ 364
             +D+  +  + N W  I+   Q
Sbjct: 284 -IDDVFVFDPQVNDWKFIQTTGQ 305

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 80/185 (43%), Gaps = 28/185 (15%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N+L  + L +       W+ IT  +  P P ++ A   
Sbjct: 214 KTKLYVFGGQFDD------TYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMIS 267

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PSARSGHRMTVWK 200
           +    + + GG+  +P+        D ++ D    +W K  Q  G  P     H   ++ 
Sbjct: 268 Y-DYKLWVFGGD--TPQG----LIDDVFVFDPQVNDW-KFIQTTGQKPPPLQEHASVLYG 319

Query: 201 NFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHS--LIPTQEG 258
           +   + GG  +      Y N  +  ++ + KW +  F     +P  RSGHS  L+P  + 
Sbjct: 320 DLMCIVGGKDE---QDVYSNGVYFLNLISLKWFKFPFF-RAGIPQGRSGHSLTLLPNHKL 375

Query: 259 AIVWG 263
            I+ G
Sbjct: 376 LIMGG 380

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 103/255 (40%), Gaps = 54/255 (21%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W ++  +++P PR    A+ + S    + + GG            Y D+W+++      T
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV------YGDTWIINVDDS-GT 146

Query: 181 KIDQKN------GPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N FV+ GG    + +     +D +LF+I ++KW 
Sbjct: 147 QFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKWT 206

Query: 234 QVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH  S+I T +      ++GG                 D ++  
Sbjct: 207 ---IPHPVGPRPLGRYGHKISIIATNQMKTKLYLFGG--------------QFDDTFFND 249

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     WE  K + F P P    +M  +  +  +FGG     +T +GL   
Sbjct: 250 LAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG-----DTMQGL--- 301

Query: 342 FFNDLLSYQVEANRW 356
             N +  Y + +N W
Sbjct: 302 -INKVFVYDIMSNDW 315

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 65/158 (41%), Gaps = 29/158 (18%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNA- 131
           P P +N  MV        +L IFGG+      +     N++F Y + ++ W  + +  A 
Sbjct: 275 PPPLANHTMV----SYDHKLWIFGGD------TMQGLINKVFVYDIMSNDWSLVETTGAR 324

Query: 132 PMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTK--IDQKNGPS 189
           P P    AA  +   + ++ G +      N+ Y       L+  S  W K  + +   P 
Sbjct: 325 PPPLQEHAALIYKDLMCVVGGKDEQDIYLNSIY------FLNLKSCRWFKFPVFKAGIPQ 378

Query: 190 ARSGHRMTVWKN--FFVMHG--------GFRDLGTSTT 217
            RSGH +T+ KN    +M G        G  DL TS T
Sbjct: 379 GRSGHSITLLKNNKILIMGGDKFDYACQGEYDLSTSET 416

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 101/256 (39%), Gaps = 43/256 (16%)

Query: 92  LLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMP------RSSAAAAGHPS 145
            +IFGG+ T++ +S     ++L+ +++++ +W  I     P P      + S  A     
Sbjct: 175 FVIFGGD-THKVNSEGLMDDDLYLFNINSFKWT-IPHPVGPRPLGRYGHKISIIATNQMK 232

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS-----KEWTKIDQKN-GPSARSGHRMTVW 199
             + + GG+F     +TF++  D  + D SS       W  +  K   P   + H M  +
Sbjct: 233 TKLYLFGGQFD----DTFFN--DLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSY 286

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGA 259
            +   + GG     T    +N  +++DI +  W  VE     P P     H+ +  ++  
Sbjct: 287 DHKLWIFGG----DTMQGLINKVFVYDIMSNDWSLVETTGARPPP--LQEHAALIYKDLM 340

Query: 260 IVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIRWERRK--KQGFQPSPRVGCSMAH 317
            V GG                   ++L +KS     RW +    K G  P  R G S+  
Sbjct: 341 CVVGG--------KDEQDIYLNSIYFLNLKS----CRWFKFPVFKAGI-PQGRSGHSITL 387

Query: 318 HKGRGILF--GGVYDY 331
            K   IL   G  +DY
Sbjct: 388 LKNNKILIMGGDKFDY 403

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 54/257 (21%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCS----- 175
           W +I   N+P PR    ++ H +  G + + GG            Y D+W+L  S     
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASDIDKT 200

Query: 176 ----SKEWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITT 229
               S + T I+  ++ P  R GH  T+  N FV+ GG    + +     +D +L +I +
Sbjct: 201 GAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINS 260

Query: 230 YKWKQVEFP-PNHPVPDARSGHSLIPT---QEGAIVWGGYCXXXXXXXXXXXXXXTDCWY 285
           YKW     P P    P  R GH ++     Q    ++GG                 D ++
Sbjct: 261 YKWT---IPKPVGQRPLGRYGHKIVTISAEQTKLYLFGGQFD--------------DTYF 303

Query: 286 LRMKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLS 339
             +   D++  R     W   K  GF P P    +M  ++ +  +FGG    +  EEGL 
Sbjct: 304 GDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG----DTLEEGL- 358

Query: 340 SEFFNDLLSYQVEANRW 356
               N +  Y    N W
Sbjct: 359 ---INRVYLYSPTNNSW 372

 Score = 37.7 bits (86), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 188 PSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDAR 247
           P     H   V+K+   + GG +D      YLN  +  ++ + KW ++ F  N+ +P  R
Sbjct: 382 PPPMQEHAAIVYKDLMCVVGG-KD--AEDNYLNTLYFLNLQSLKWFKLPFYKNN-IPQGR 437

Query: 248 SGHSLIPTQEGAIVWGG 264
           SGHS+   +   I+  G
Sbjct: 438 SGHSVTLLKNDQILIMG 454

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 95/262 (36%), Gaps = 57/262 (21%)

Query: 119 DTDQWKKITSRNAPMPRSSAAAAG--HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS 176
           D   W KI  +  P PR     +   +PS  + I+GG F S        Y D+W L+   
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKE 71

Query: 177 K-----------EWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYL-NDC 222
                           ID     P  R GH  T+  N  ++ GG    +  S   + +D 
Sbjct: 72  NYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDL 131

Query: 223 WLFDITTYKWKQVEFP-PNHPVPDARSGHSLIPTQEGAIVWGGYCXXXXXXXXXXXXXXT 281
           +  ++ T KW     P P    P  R GH +        ++GG                 
Sbjct: 132 YFLNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQF--------------- 173

Query: 282 DCWYLR--MKSDITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEET 334
           D  Y    +K D+   +     WE  K +GF P P    SM   + +  +FGG     +T
Sbjct: 174 DETYFNDLVKFDLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFENKLYVFGG-----DT 228

Query: 335 EEGLSSEFFNDLLSYQVEANRW 356
            + L++E F     Y  E N W
Sbjct: 229 YQVLTNETF----VYDPELNEW 246

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 97/242 (40%), Gaps = 50/242 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W +I   N+P PR    A+ + S    + + GG            Y D+W +  S+   T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV------YGDTWSI-TSTNNGT 194

Query: 181 KIDQKN------GPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N FV+ GG    +       +D +LF+I ++KW 
Sbjct: 195 QFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKWT 254

Query: 234 QVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH  S+I T        ++GG                 D ++  
Sbjct: 255 ---IPSPVGPRPLGRYGHKISIIATSSSKTKLYLFGGQFD--------------DTYFND 297

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     WE  K +G  P P    +M  +  +  +FGG     +T++GL ++
Sbjct: 298 IAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGLIND 352

Query: 342 FF 343
            +
Sbjct: 353 IY 354

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 98/255 (38%), Gaps = 54/255 (21%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W ++  +N+P PR    A+ + S    + + GG            Y D+W++  ++   T
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQ------SVYGDTWII-STNDNGT 193

Query: 181 KIDQKN------GPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           +   K        P  R GH  T+  N FV+ GG    + +     +D +LF++ +YKW 
Sbjct: 194 QFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKWT 253

Query: 234 QVEFP-PNHPVPDARSGHSLIPTQEGAI-----VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH +       +     ++GG                 D ++  
Sbjct: 254 ---IPHPIGPRPLGRYGHKISIMAANQMKTKLYLFGGQFD--------------DTYFND 296

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     WE  K   F P P    +M  +     +FGG     +T +GL   
Sbjct: 297 LAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG-----DTLQGL--- 348

Query: 342 FFNDLLSYQVEANRW 356
             N +  Y V  N W
Sbjct: 349 -INQVFKYDVANNDW 362

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 83/186 (44%), Gaps = 29/186 (15%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRN-APMPRSSAAAAG 142
           K +L +FGG++ +      T++N+L  + L +       W+ +     +P P ++     
Sbjct: 279 KTKLYLFGGQFDD------TYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMIS 332

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PSARSGHRMTVWK 200
           +    + + GG+      N  + Y      D ++ +W+ I +  G  P     H   V+K
Sbjct: 333 Y-DNHLWVFGGDTLQGLINQVFKY------DVANNDWS-IAETTGTKPPPMQEHAAVVYK 384

Query: 201 NFFVMHGGFRDLGTSTTYLNDCWLFDITTYKW-KQVEFPPNHPVPDARSGHSL-IPTQEG 258
           +  V+ GG  +     TYLN  +  ++ T++W K   F     +P  RSGHSL +   + 
Sbjct: 385 HVMVVVGGKDE---HDTYLNSVYFLNLKTHEWFKLPTFKAG--IPQGRSGHSLTLLNNDK 439

Query: 259 AIVWGG 264
            ++ GG
Sbjct: 440 LLIMGG 445

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 100/258 (38%), Gaps = 53/258 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFY------HYSDSWLLDC 174
           W +     +P PR    A+ H S    + I GG     ++ + Y      ++ D      
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVYGDVWSINHKDDKSFSA 92

Query: 175 SSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           SS E T       P  R GH  T+  N  ++ GG    +       +D +LF++ +YKW 
Sbjct: 93  SSIEITPT----TPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWT 148

Query: 234 QVEFPPNHPVPDARSGH--SLI---PTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
             E  P    P  R GH  S+I   PT+    ++GG                 D ++  +
Sbjct: 149 IPE--PIGLRPLGRYGHKISIIATQPTKTKLFLFGGQFD--------------DTYFNDL 192

Query: 289 KS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++  R     WE  K + F P P    +M  +  +  +FGG     ET +GL +E 
Sbjct: 193 SMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG-----ETLQGLINEV 247

Query: 343 FNDLLSYQVEANRWYSIK 360
           F     Y    N W  I+
Sbjct: 248 F----VYDPIVNDWSVIE 261

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 21/146 (14%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKI-TSRNA 131
           P P SN  M+   S+  + L +FGGE      +     NE+F Y    + W  I T+ ++
Sbjct: 217 PPPVSNHTMI---SYDNK-LWVFGGE------TLQGLINEVFVYDPIVNDWSVIETTGSS 266

Query: 132 PMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PS 189
           P P    AA  + + + ++ G +      N+ Y       L+ ++ +W K+   N     
Sbjct: 267 PPPIQEHAAVVYKNLMCVVGGKDSKDNYMNSVY------FLNLNTLKWFKLPHINPGIMQ 320

Query: 190 ARSGHRMTVWKN--FFVMHGGFRDLG 213
            RSGH  T+  +    ++ G   D  
Sbjct: 321 GRSGHTATLLNDDSILILSGDKNDFA 346

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 70/167 (41%), Gaps = 31/167 (18%)

Query: 188 PSARSGHRMTVWKNFFVMHGGFRDLGTSTTYL-NDCWLFDITTYKWKQVEFPPNHPVPDA 246
           P  R GH  T+  N FV+ GG          + +D +LF+I +YKW   +  P  P P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQ--PVGPRPLG 197

Query: 247 RSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIR----- 296
           R GH  S+I T +      V+GG                  C Y     D++  R     
Sbjct: 198 RYGHKISIIATSQMKTKLYVFGGQFDDSYFNDL--------CVY-----DLSSFRKPESH 244

Query: 297 WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFF 343
           WE  K + F P P    +M  +  +  +FGG     +T++GL ++ F
Sbjct: 245 WEFLKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGLINQLF 286

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 96/261 (36%), Gaps = 41/261 (15%)

Query: 92  LLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMP------RSSAAAAGHPS 145
            +IFGG+ T++T+      ++++ +++++ +W  I     P P      + S  A     
Sbjct: 155 FVIFGGD-THKTNKDGLMDDDIYLFNINSYKWT-IPQPVGPRPLGRYGHKISIIATSQMK 212

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS-----KEWTKIDQKN-GPSARSGHRMTVW 199
             + + GG+F         +++D  + D SS       W  +  K+  P   + H M  +
Sbjct: 213 TKLYVFGGQFDDS------YFNDLCVYDLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSY 266

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGA 259
                + GG    G     +N  ++FD     W+ VE           +G    P QE A
Sbjct: 267 DYKLWVFGGDTQQG----LINQLFMFDPVINDWRVVE----------TTGEKPPPVQEHA 312

Query: 260 IVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIRWERRKKQGFQ-PSPRVGCSMAHH 318
            V                      ++L +KS    ++W +        P  R G S+   
Sbjct: 313 AVMFNDLMCIMGGKDEQDVYLNSVYFLNLKS----LKWFKFNDYKLNIPQGRSGHSITLL 368

Query: 319 KGRGILF--GGVYDYEETEEG 337
           K   +L   G  +DY   +E 
Sbjct: 369 KNNRLLIMGGDKFDYARLDES 389

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 70/154 (45%), Gaps = 19/154 (12%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWL----LDCSS-- 176
           W +I  +N+P PR   +A    S +V      F +   +    Y D+W     LD +S  
Sbjct: 73  WNRIKLKNSPFPRYRHSA----SPIVTNDNRIFVTGGLHDHLVYGDTWQITGNLDGTSFV 128

Query: 177 KEWTKIDQKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQV 235
            +  +I Q N P  R GH  T+  N +V+ GG    L  +    +D +LF+I +YKW   
Sbjct: 129 SKTIQIGQ-NTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWTIP 187

Query: 236 EFPPNHPVPDARSGH--SLI---PTQEGAIVWGG 264
           +  P    P  R GH  S+I   P Q    ++GG
Sbjct: 188 Q--PVGTRPLGRYGHKISIIANNPMQTKLFLFGG 219

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 81/191 (42%), Gaps = 32/191 (16%)

Query: 84  NPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQW---KKITSRNAPMPR 135
           NP   K  L +FGG+         T++N+L  + L +       W   K ++    P+  
Sbjct: 208 NPMQTK--LFLFGGQIDE------TYFNDLAMFDLSSFRRPNSHWVFLKPVSIVPPPLTN 259

Query: 136 SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PSARSG 193
            +     +    + + GG+  +   N  + Y      D    +W+KI Q  G  P A   
Sbjct: 260 HTMVTFDNK---LWVFGGKTPNTLSNETFCY------DPVQNDWSKI-QTTGERPPAVQE 309

Query: 194 HRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLI 253
           H   V+K+   + GG +D+  +  Y ND +  ++ T+KW ++       +P  RSGHSL 
Sbjct: 310 HASVVYKHLMCIFGG-KDIQNA--YSNDVYFLNLITFKWYKLP-RIKEGLPKERSGHSLT 365

Query: 254 PTQEGAIVWGG 264
             +   +V  G
Sbjct: 366 LIKNDKLVIMG 376

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 73/166 (43%), Gaps = 28/166 (16%)

Query: 65  VVVTPVK-RPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQW 123
           V + PV   P P +N  MV        +L +FGG+  N      T  NE F Y    + W
Sbjct: 245 VFLKPVSIVPPPLTNHTMVT----FDNKLWVFGGKTPN------TLSNETFCYDPVQNDW 294

Query: 124 KKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKID 183
            KI +     P     A+     ++ I GG+     QN + +  D + L+  + +W K+ 
Sbjct: 295 SKIQTTGERPPAVQEHASVVYKHLMCIFGGK---DIQNAYSN--DVYFLNLITFKWYKLP 349

Query: 184 Q-KNG-PSARSGHRMTVWKN-FFVMHGG---------FRDLGTSTT 217
           + K G P  RSGH +T+ KN   V+ GG           DL TS+T
Sbjct: 350 RIKEGLPKERSGHSLTLIKNDKLVIMGGDKFDYASSDIHDLHTSST 395

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 103/259 (39%), Gaps = 54/259 (20%)

Query: 123 WKKITSRNAPMPR---SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLL----DCS 175
           W ++  +N+P PR   SS+    + + + +  G    S        Y D W +    D +
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 176 SKEWTKID-QKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
           S    +ID  +N P  R GH  T+  N +V+ GG    L  +    +D +LF+I +YKW 
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 234 QVEFPPNHPVPDARSGH--SLI---PTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLR- 287
             +  P    P  R GH  S+I   P Q    ++GG                 D  Y   
Sbjct: 186 IPQ--PIGRRPLGRYGHKISIIASNPMQTKLYLFGG---------------QVDETYFND 228

Query: 288 -MKSDITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
            +  D++  R     WE  +  G  P P    +M  +  +  +FGG     ET + +S  
Sbjct: 229 LVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS-- 281

Query: 342 FFNDLLSYQVEANRWYSIK 360
             ND   Y    + W  +K
Sbjct: 282 --NDTYRYDPAQSEWSKVK 298

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 98/252 (38%), Gaps = 47/252 (18%)

Query: 93  LIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHG 152
           ++FGG+ T++ +      ++L+ +++++ +W    +   P+ R      GH   ++    
Sbjct: 155 VVFGGD-THKLNKNGLLDDDLYLFNINSYKW----TIPQPIGRRPLGRYGHKISIIA--- 206

Query: 153 GEFSSPKQNTFY---------HYSDSWLLDCSS-----KEWTKIDQ-KNGPSARSGHRMT 197
              S+P Q   Y         +++D  + D SS       W  ++   + P   + H M 
Sbjct: 207 ---SNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMV 263

Query: 198 VWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQE 257
            + N   + GG     T  T  ND + +D    +W +V+           +G    P QE
Sbjct: 264 AYDNKLWVFGG----ETPKTISNDTYRYDPAQSEWSKVK----------TTGEKPPPIQE 309

Query: 258 GAIVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIRWER--RKKQGFQPSPRVGCSM 315
            A V   +                D ++L + S    ++W +  R K+G  P  R G S+
Sbjct: 310 HASVVYKHLMCVLGGKDTHNAYSNDVYFLNLLS----LKWYKLPRMKEGI-PQERSGHSL 364

Query: 316 AHHKGRGILFGG 327
              K   +L  G
Sbjct: 365 TLMKNEKLLIMG 376

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 79/191 (41%), Gaps = 31/191 (16%)

Query: 84  NPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKI---TSRNAPMPR 135
           NP   K  L +FGG+         T++N+L  + L +       W+ +   T+   P+  
Sbjct: 206 NPMQTK--LYLFGGQLDK------TYFNDLAMFDLSSFRRRNSHWEFLEPATTVPPPLAN 257

Query: 136 SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG-PSARSGH 194
            +    G+    + + GGE      N  Y Y      D    +W+KI+     P     H
Sbjct: 258 HTMVTYGNK---LWVFGGETPKTVSNETYCY------DPIQNDWSKIETTGEIPPPVQEH 308

Query: 195 RMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSL-I 253
              V+K+   + GG     T   Y ND +  D+ ++KW ++       +P  RSGHSL +
Sbjct: 309 ASVVYKHIMCVFGGKY---THNAYSNDVYFLDLLSFKWYKLPH-IKEGIPRERSGHSLTL 364

Query: 254 PTQEGAIVWGG 264
              E  ++ GG
Sbjct: 365 MKNEKILIMGG 375

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 69/156 (44%), Gaps = 23/156 (14%)

Query: 123 WKKITSRNAPMPR--SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSK--- 177
           W +I  +++P PR   S++        + + GG ++         Y D W +  ++    
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSSENRIFVTGGLYNQSV------YGDVWQITANADGTS 124

Query: 178 ---EWTKIDQKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
              +  +ID +N P  R GH  T+  N +V+ GG    L       +D +LF++ +YKW 
Sbjct: 125 FTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKWT 183

Query: 234 QVEFPPNHPVPDARSGH--SLI---PTQEGAIVWGG 264
             +  P    P  R GH  S+I   P Q    ++GG
Sbjct: 184 IPQ--PIGSRPLGRYGHKISIIAYNPMQTKLYLFGG 217

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 100/262 (38%), Gaps = 54/262 (20%)

Query: 119 DTDQWKKITSRNAPMPRSSAAAAGHPS--GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS 176
           D   W ++    +P PR    A+ + S    V + GG            Y D+W++  S 
Sbjct: 154 DETPWNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIK-SH 206

Query: 177 KEWTKIDQKN------GPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYL-NDCWLFDITT 229
           +   K   K        P  R GH  T+  N FV+ GG      +   + +D +L +I +
Sbjct: 207 ENGNKFTSKTVEITETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLNINS 266

Query: 230 YKWKQVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDC 283
           +KW     P P  P P  R GH  S+I T +      V+GG                 D 
Sbjct: 267 HKWT---IPRPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFD--------------DT 309

Query: 284 WYLRMKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEG 337
           ++  +   D++  R     W+  K   F P P    +M  +  +  +FGG     +T +G
Sbjct: 310 YFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----DTPQG 364

Query: 338 LSSEFFNDLLSYQVEANRWYSI 359
           L     N+L  Y    N W  +
Sbjct: 365 L----INELFMYDPTTNDWSVV 382

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 56/139 (40%), Gaps = 19/139 (13%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAP 132
           P P +N  MV        +L +FGG+      +     NELF Y   T+ W  + +    
Sbjct: 339 PPPLTNHTMV----SYDYKLWVFGGD------TPQGLINELFMYDPTTNDWSVVDTTGVK 388

Query: 133 MPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNG--PSA 190
            P     AA     ++ I GG     K +   +  + + L+  S  W K+       PS 
Sbjct: 389 PPPLQEHAALLYKDLMCIVGG-----KDDQDNYSQEVYFLNLKSFRWFKLPHFRSLVPSP 443

Query: 191 RSGHRMTVWKN--FFVMHG 207
           RSGH +T+  N    +M G
Sbjct: 444 RSGHSVTLLSNKKLLIMGG 462

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 107/270 (39%), Gaps = 41/270 (15%)

Query: 92  LLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAPMP------RSSAAAAGHPS 145
            +IFGG+ T++T++     ++++  ++++ +W  I     P P      + S  A     
Sbjct: 239 FVIFGGD-THKTNAEGLMDDDVYLLNINSHKWT-IPRPVGPRPLGRYGHKISIIATSQMK 296

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS-----KEWTKIDQKN-GPSARSGHRMTVW 199
             + + GG+F         +++D  + D SS       W  +   +  P   + H M  +
Sbjct: 297 TKLYVFGGQFDD------TYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSY 350

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGA 259
                + GG     T    +N+ +++D TT  W  V+     P P     H+ +  ++  
Sbjct: 351 DYKLWVFGG----DTPQGLINELFMYDPTTNDWSVVDTTGVKPPPLQE--HAALLYKDLM 404

Query: 260 IVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIRWERRKK-QGFQPSPRVG--CSMA 316
            + GG                 + ++L +KS     RW +    +   PSPR G   ++ 
Sbjct: 405 CIVGG--------KDDQDNYSQEVYFLNLKS----FRWFKLPHFRSLVPSPRSGHSVTLL 452

Query: 317 HHKGRGILFGGVYDYEETEEGLSSEFFNDL 346
            +K   I+ G  +DY    EG  S    DL
Sbjct: 453 SNKKLLIMGGDKFDYAGPGEGEFSTADQDL 482

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 97/258 (37%), Gaps = 52/258 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGH--PSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWT 180
           W +    ++P+PR    A+ +  P   + + GG            Y D+W+L  +S    
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 181 KIDQK-----NGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWKQ 234
              Q      N P  R GH  T+  N  V+ GG    L +     +D +LF++ +++W  
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWT- 274

Query: 235 VEFP-PNHPVPDARSGHSL-----IPTQEGAIVWGGYCXXXXXXXXXXXXXXTDCWYLRM 288
              P P    P  R GH +      P +    ++GG                 D ++  +
Sbjct: 275 --IPTPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLD--------------DNYFNDL 318

Query: 289 KS-DITGI-----RWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEF 342
              D++       RW+  K + F P P    +M  +  +  +FGG      +  G   E 
Sbjct: 319 AMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG------SSRG---EL 369

Query: 343 FNDLLSYQVEANRWYSIK 360
            N L  Y  + N W  ++
Sbjct: 370 QNQLYVYIPDLNEWRCLE 387

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 68/159 (42%), Gaps = 21/159 (13%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKI-TSRNA 131
           P P +N  MV        +L +FGG      SS     N+L+ Y  D ++W+ + T  + 
Sbjct: 343 PPPLTNHTMVA----YDYKLWVFGG------SSRGELQNQLYVYIPDLNEWRCLETEGDK 392

Query: 132 PMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK--NGPS 189
           P P    +A  + + + +  G       QNT Y       L+  + +W ++D    N P 
Sbjct: 393 PQPIQEHSATIYKNLMCVFGGKNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPL 446

Query: 190 ARSGHRMTVWKN--FFVMHGGFRDLGTSTTYLNDCWLFD 226
            RSG  M++ +N    +M G   D   +   LND   +D
Sbjct: 447 PRSGQSMSLMQNDKILIMGGDKNDYCVNGANLNDIDEYD 485

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 80/181 (44%), Gaps = 23/181 (12%)

Query: 91  ELLIFGGEYTNQTSSTTTFYNELFTYSLDT-----DQWKKITSRNAPMPRSSAAAAGHPS 145
           EL +FGG+         T++N+L  + L +       W+ +   +A  P  +        
Sbjct: 213 ELYLFGGQIDE------TYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFD 266

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQK-NGPSARSGHRMTVWKNFFV 204
             + + GGE  +PK  +    +D++  D     W+K++     P     H   V+K+   
Sbjct: 267 NKLWVFGGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMC 320

Query: 205 MHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSL-IPTQEGAIVWG 263
           + GG +D+    TY ND +  ++ + KW ++       +P  RSGHSL +   E  ++ G
Sbjct: 321 VFGG-KDI--HNTYSNDVYFLNLLSLKWFKLPC-VKEGIPQERSGHSLTLMNNEKLVIMG 376

Query: 264 G 264
           G
Sbjct: 377 G 377

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 24/142 (16%)

Query: 123 WKKITSRNAPMPR--SSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSK--- 177
           W +I  +++P PR   S++        + + GG +          Y D W +  ++    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTNDNRIFVTGGLYDQSV------YGDVWEITANANGTS 126

Query: 178 ---EWTKIDQKNGPSARSGHRMTVWKNFFVMHGG-FRDLGTSTTYLNDCWLFDITTYKWK 233
              +  +ID  N P  R GH  T+  N +V+ GG    L  +    +D +LF+I +YKW 
Sbjct: 127 FTSKRIQIDH-NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKWT 185

Query: 234 QVEFPPNHPV---PDARSGHSL 252
               P  HP+   P  R GH +
Sbjct: 186 ---IP--HPIGSRPLGRYGHKI 202

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 54/256 (21%), Positives = 104/256 (40%), Gaps = 45/256 (17%)

Query: 93  LIFGGEYTNQTSSTTTFYNELFTYSLDTDQWK---KITSRNAPMPR----SSAAAAGHPS 145
           ++FGG+ T++ +      ++L+ +++++ +W     I SR  P+ R     S  A+    
Sbjct: 155 VVFGGD-THKLNKNRLLDDDLYLFNINSYKWTIPHPIGSR--PLGRYGHKISIIASKQMH 211

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDSWLLDCSS-----KEWTKIDQKNG-PSARSGHRMTVW 199
             + + GG+          +++D  + D SS       W  ++  +  P   + H M  +
Sbjct: 212 TELYLFGGQIDET------YFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTF 265

Query: 200 KNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHSLIPTQEGA 259
            N   + GG     T  T  ND + +D     W +VE     P P     H+ +  +   
Sbjct: 266 DNKLWVFGG----ETPKTISNDTYCYDPIQNAWSKVETTGEKPPPVQE--HASVVYKHLM 319

Query: 260 IVWGGYCXXXXXXXXXXXXXXTDCWYLRMKSDITGIRWERRK--KQGFQPSPRVGCSMA- 316
            V+GG                 D ++L + S    ++W +    K+G  P  R G S+  
Sbjct: 320 CVFGG--------KDIHNTYSNDVYFLNLLS----LKWFKLPCVKEGI-PQERSGHSLTL 366

Query: 317 -HHKGRGILFGGVYDY 331
            +++   I+ G  +DY
Sbjct: 367 MNNEKLVIMGGDKFDY 382

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 99/259 (38%), Gaps = 54/259 (20%)

Query: 123 WKKITSRNAPMPRSSAAAAGHPSGV--VLIHGGEFSSPKQNTFYHYSDSWLLDCS----- 175
           W ++     P PR    A+ + S    V++ GG            Y D+W+L        
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQ------SVYGDTWILRAQDNGKQ 105

Query: 176 -SKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYL-NDCWLFDITTYKWK 233
            S    +I +   P  R GH  T+  N FV+ GG      +   + +D +L ++ ++KW 
Sbjct: 106 FSARTIEITETT-PPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNSHKWT 164

Query: 234 QVEFP-PNHPVPDARSGH--SLIPTQEGAI---VWGGYCXXXXXXXXXXXXXXTDCWYLR 287
               P P  P P  R GH  S+I T +      V+GG                 D ++  
Sbjct: 165 ---IPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFD--------------DTYFND 207

Query: 288 MKS-DITGIR-----WERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSE 341
           +   D++  R     W   K   F P P    +M  +  +  +FGG     +T +GL   
Sbjct: 208 LAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL--- 259

Query: 342 FFNDLLSYQVEANRWYSIK 360
             N+L  Y    N W  ++
Sbjct: 260 -INELFVYDPVVNDWSVVE 277

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 57/139 (41%), Gaps = 19/139 (13%)

Query: 73  PSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNAP 132
           P P +N  MV        +L +FGG+      +     NELF Y    + W  + +  A 
Sbjct: 233 PPPLTNHTMV----SYDYKLWVFGGD------TPQGLINELFVYDPVVNDWSVVETTGAK 282

Query: 133 MPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKID--QKNGPSA 190
            P     AA     ++ + GG     K +   +  D + ++  +  W K+   Q   PS 
Sbjct: 283 PPPLQEHAAVLYRDLMCVVGG-----KDDQDNYSQDVYFMNMKTFRWFKLPHFQDMVPSP 337

Query: 191 RSGHRMTVWKN--FFVMHG 207
           RSGH +T+  N    +M G
Sbjct: 338 RSGHSVTLLANRKLLIMGG 356

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 10/100 (10%)

Query: 171 LLDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTY 230
           L    S + TK +  +GP  +     T   +  VMHGG      +T   +D W FD  T 
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 231 KWKQVEFPPNH------PVPDARSGHSLIPTQEGAIVWGG 264
            W Q+E           P+  A +GHS+      +I  GG
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 43/94 (45%), Gaps = 13/94 (13%)

Query: 89  KRELLIFGGEYTNQTSSTTTFYNELFTYSLDTD-QWKKITSRNAPMPRSSAAAAGHPSGV 147
           K++LL FGG    +T       NE+ +   D D +        AP+ R+        +  
Sbjct: 372 KKQLLYFGGSCPQRT-------NEIISIGPDGDCEAVPFDKTTAPVARACHTFTLVNNDT 424

Query: 148 VLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTK 181
            ++ GG     ++N +   SD+W+ + SS EWT+
Sbjct: 425 AMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 27/68 (39%), Gaps = 10/68 (14%)

Query: 203 FVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNH------PVPDARSGHSLIPTQ 256
            +MHGG       T    D W +DI T  W Q+     H      P+     GHSL+   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 257 EGAIVWGG 264
             A+  GG
Sbjct: 727 GMAVFVGG 734

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 11/96 (11%)

Query: 146 GVVLIHGGEFSSP-KQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSARSGHRMTVWKN--- 201
           G + I GG   SP  +  F   +D W LD    +W+ + +  G   R  H M V  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 202 ----FFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233
                 V+ GG  ++      ++   +F++TT +W+
Sbjct: 230 TKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQWE 262

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 61/140 (43%), Gaps = 16/140 (11%)

Query: 127 TSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKN 186
           TS    + R+  ++  H  G ++  GG   +P +      SD+  +D     + ++   +
Sbjct: 384 TSLEYDLKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQNHS 436

Query: 187 G-PSARSGHRMT-VWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVP 244
             P AR+ H  T +      M  G R+       +NDCW +++ T +W++        +P
Sbjct: 437 VLPPARACHTFTRLGDGETAMVIGGRN--APHRAVNDCWFYNLNTNEWQK-----GPELP 489

Query: 245 DARSGHSLIPTQEGAIVWGG 264
           + R  HS + T +  ++  G
Sbjct: 490 EPRFRHSCVATDKNTLLVCG 509

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 17/86 (19%)

Query: 147 VVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQ-----------KNGPSARSGHR 195
           +++IHGG       N    Y D W  D   ++WTKID             N   A  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 196 MTVWKNFFVMHGGFRDLGTSTTYLND 221
           M +  ++ +  GG       T ++++
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

>Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {ON}
           complement(42216..44105) [1890 nt, 630 aa]
          Length = 629

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 18/146 (12%)

Query: 124 KKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKID 183
           +KI + + P+ R     +      ++  GG   +P Q     + + W LD S+K+W+K  
Sbjct: 370 EKIDTTDTPIGRMCHTLSRISESEIISIGGR-KAPGQG----FDECWKLDLSTKQWSKGA 424

Query: 184 QKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVE---FPPN 240
           Q N    R    M   +N  +  G   D        +   L++  +  + + E   +  N
Sbjct: 425 QLNAKRYRHSAFMVDDENVLICGGDTTD--------DPFVLYNTKSNTFHKCEVNGYDIN 476

Query: 241 HPVPDARSGHSLIPTQEGAIVWGGYC 266
             +  A   ++ I TQ G I+ GG C
Sbjct: 477 ESLVAAAISYN-IKTQTGVII-GGAC 500

>TPHA0P01530 Chr16 complement(311917..314019) [2103 bp, 700 aa] {ON}
           Anc_3.15 YOL141W
          Length = 700

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 8/88 (9%)

Query: 70  VKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSR 129
           +  PSPR  +C   N  +  + +L+ G     Q       ++E++TY + T  W+     
Sbjct: 437 INVPSPR--MCHTLNKINDDQYVLVGGRTAPGQG------FDEVYTYRVSTKTWELKEKL 488

Query: 130 NAPMPRSSAAAAGHPSGVVLIHGGEFSS 157
             P PR         S  +L+ GG+ +S
Sbjct: 489 RLPEPRYRHCTVNISSTTLLVFGGKSTS 516

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,279,782
Number of extensions: 2419822
Number of successful extensions: 6071
Number of sequences better than 10.0: 61
Number of HSP's gapped: 5866
Number of HSP's successfully gapped: 115
Length of query: 642
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 526
Effective length of database: 40,180,143
Effective search space: 21134755218
Effective search space used: 21134755218
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)