Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11506g6.11ON54454429280.0
Kwal_56.223556.11ON54154021740.0
SAKL0E00902g6.11ON54454118580.0
Ecym_30146.11ON55153517170.0
ACR015W6.11ON55254115860.0
KLLA0D00858g6.11ON54153815330.0
TPHA0M002106.11ON54554115330.0
Kpol_1032.26.11ON53953915120.0
ZYRO0F00506g6.11ON55055714570.0
TBLA0G009806.11ON55854214330.0
TDEL0G046006.11ON52853814190.0
Suva_5.106.11ON55355314170.0
Smik_5.296.11ON55555514020.0
NCAS0F002006.11ON54955213950.0
Skud_5.316.11ON55755313900.0
YEL058W (PCM1)6.11ON55755613810.0
CAGL0B03597g6.11ON54054513680.0
KAFR0L003406.11ON54054713391e-180
NDAI0K028906.11ON56155113391e-180
KNAG0E009406.11ON53854913101e-176
TDEL0B005708.840ON63091980.003
NCAS0C004108.840ON62575890.030
CAGL0M02981g8.840ON617131870.054
Kpol_1068.88.840ON63222860.071
TPHA0I002508.840ON62952860.080
KLLA0D01573g8.840ON60722850.092
Kwal_27.102588.840ON62041850.11
KLTH0C03872g8.840ON62160830.19
KNAG0J002708.840ON625113830.20
TBLA0B032508.840ON64364810.26
YMR278W (PGM3)8.840ON62220810.29
Skud_13.4508.840ON62220810.30
Suva_13.4668.840ON62220810.30
Ecym_46118.840ON63022810.32
ZYRO0G14190g8.840ON61020810.33
NDAI0K004108.840ON62620800.35
KAFR0B039208.840ON62418800.40
Smik_13.4918.840ON62220800.42
ABL126W8.840ON62420780.77
SAKL0D01474g8.840ON62420770.99
KLTH0A02684g8.69ON2140104742.4
SAKL0C05918g1.199ON875167699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11506g
         (544 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...  1132   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   842   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   720   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   665   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   615   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   595   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   595   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   587   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   565   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   556   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   551   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   550   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   544   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   541   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   540   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   536   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   531   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   520   e-180
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   520   e-180
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   509   e-176
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    42   0.003
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.030
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.054
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    38   0.071
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    38   0.080
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    37   0.092
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    37   0.11 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    37   0.19 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    37   0.20 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    36   0.26 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    36   0.29 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    36   0.30 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    36   0.30 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.32 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    36   0.33 
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    35   0.35 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    35   0.40 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    35   0.42 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.77 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    34   0.99 
KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa] ...    33   2.4  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    31   9.4  

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/544 (100%), Positives = 544/544 (100%)

Query: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV
Sbjct: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180
           TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND
Sbjct: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180

Query: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240
           TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR
Sbjct: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240

Query: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300
           VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG
Sbjct: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360
           QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT
Sbjct: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360

Query: 361 PTGVKHLHHEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSK 420
           PTGVKHLHHEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSK
Sbjct: 361 PTGVKHLHHEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSK 420

Query: 421 FANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNA 480
           FANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNA
Sbjct: 421 FANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNA 480

Query: 481 ERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540
           ERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV
Sbjct: 481 ERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540

Query: 541 EHNG 544
           EHNG
Sbjct: 541 EHNG 544

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/540 (73%), Positives = 461/540 (85%)

Query: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           MLDTK L++LYE HC +GF YAYGTAGFRYKADVLDTVMFTTGV+AGLRSI+LEG+TVGV
Sbjct: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           MITASHNPPEDNGVKIVDPKGEMLEQSWE YATDLANSA+Q F+ F+A ++ L+++L + 
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120

Query: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180
           ++  GS+ VARDSRESGPRLL A L+G +VL N+++TD+GLLTTPQLHFLTSK NELP  
Sbjct: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180

Query: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240
           T I +  YY  FLSAW +I  LC I SLPYKLEIDAANGIGAP V EMLS HKFF G F 
Sbjct: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240

Query: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300
           VVND+WETP SLNHLCGAD+VKTNQ+LP+GI    +  RICCSFDGDADRIVFY+C   G
Sbjct: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360
            F LLDGDKMATLFAKFFQ++L  A LQ+ L LGVVQTAYANGSST YIE+VLGI VTCT
Sbjct: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360

Query: 361 PTGVKHLHHEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSK 420
           PTGVKHLHHEA+ YDIGVYFEANGHGTVVFS KF +V++  LS K +SD++ +SL+VL  
Sbjct: 361 PTGVKHLHHEAVKYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLHL 420

Query: 421 FANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNA 480
           FA LINQTVGDAISDM+ VLAVLSILKW+P+KW++EYTDLPNKL+KVLVPDRTVFKT NA
Sbjct: 421 FAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKNA 480

Query: 481 ERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540
           ERQL+SP G+Q KI+ALVA + + RSFVRASGTEDAVRVYAEA+T +E ++L+ +V +++
Sbjct: 481 ERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKLL 540

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/541 (62%), Positives = 428/541 (79%), Gaps = 3/541 (0%)

Query: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           M++ + LE LY+ HCK+GFTY YGTAGFRYKADVLDTVMFTTG+LA +RSIYL+G+ VGV
Sbjct: 1   MVNIQLLEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           MITASHNPP+DNGVKIVDPKGEML+Q+WE +AT+LANSA++     +  L  L+++LG+D
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120

Query: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180
                 + ++RDSRESGPRLL A+++G++VL N+++ D+ LLTTPQLHFLT + N+  + 
Sbjct: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179

Query: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240
           + ++   YY  F SAW  I  L  I SLPY++ IDAANGIG P+V EML  +KFF     
Sbjct: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239

Query: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300
           V+N+ W++P  LN  CGADYVKTNQ  P G+  N++ + I CSFDGDADRIVFY+ D + 
Sbjct: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360
           +F LLDGDK++TLFAKFF+++L +A  +  L LGVVQTAYANGSST Y+  +L +PV+CT
Sbjct: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359

Query: 361 PTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419
            TGVKHLHHEAI NYDIG+YFEANGHGTV+FS +F + ++  L  + Q + + ++L+ L 
Sbjct: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKL-KEPQDEKTAKALKTLY 418

Query: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479
            F NLINQTVGDAISDM+ VLAVL ILKW+PQKW+QEYTDLPNKLVKV+VPDR+VFKT+N
Sbjct: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478

Query: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539
           AERQL+SP GLQ KI++ V E+   RSFVRASGTEDAVRVYAEA+T+E+AD LA+ VS +
Sbjct: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538

Query: 540 V 540
           V
Sbjct: 539 V 539

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/535 (59%), Positives = 402/535 (75%), Gaps = 4/535 (0%)

Query: 10  LYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPP 69
           LY+ HC S F Y YGTAGFRYKA++LDTV+FTTGVLA LRS++L+G+ VG MITASHNPP
Sbjct: 10  LYDKHCCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPP 69

Query: 70  EDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLAV 129
           +DNGVK+VDPKGEML+Q WE YAT+LAN A+     FL  LQ L+++ G+  D+   + V
Sbjct: 70  QDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGIKADSEARIVV 129

Query: 130 ARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT---SKRNELPNDTAIDRF 186
           ARDSRESG RLL AL++G+ V  N+ I DY +LTTPQLHFLT   +++ E      ++  
Sbjct: 130 ARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQMESERVIEVNEA 189

Query: 187 FYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVNDDW 246
           FYY  FLSA  ++T L  I  LPY L IDAANG+G  + +E+   + FF     ++N +W
Sbjct: 190 FYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFKDSTTIINGNW 249

Query: 247 ETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEGQFRLLD 306
                LN  CGADYVKTNQ LP GI A  D   + CSFDGDADR++FY+ D +G F LLD
Sbjct: 250 SQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYRDVDGMFHLLD 309

Query: 307 GDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGVKH 366
           GDK++TLFAKFFQ +L  A +Q+ + LGVVQTAYANGSST Y+  VL +PV+CTPTGVK+
Sbjct: 310 GDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVPVSCTPTGVKY 369

Query: 367 LHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLI 425
           LH +A+ NYD+G+YFEANGHGTV+FS+ F+  V+  L     S  S  +L+ L  F+ LI
Sbjct: 370 LHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMALKTLQSFSKLI 429

Query: 426 NQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLL 485
           NQTVGDA+SDMM VLAVL ILKWTPQ+W+ EYTDLPN L+KV+VPDR++FKTTNAERQL+
Sbjct: 430 NQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLFKTTNAERQLV 489

Query: 486 SPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540
           SP GLQ +I+ ++  Y  ARSFVRASGTEDAVR+YAEA+T+E+AD L+ ++SQ+V
Sbjct: 490 SPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIKISQLV 544

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/541 (54%), Positives = 387/541 (71%), Gaps = 1/541 (0%)

Query: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           M   + +  LY+ H   G  YAYGTAGFR +A+VL  V+F TG+LA LRS+YL G  VGV
Sbjct: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           M+TASHNPPEDNGVK+VDP GEML   WE +AT LAN A+Q     L  L  LV  LGLD
Sbjct: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLD 120

Query: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180
                 + VARDSR SGP+LL ALL+G+R+L ++ + D G+LTTPQLHFLT   NE  + 
Sbjct: 121 LALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180

Query: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240
             +    YY  F++A +++ AL G+++LP+ L +D ANG+GA + +E+      F     
Sbjct: 181 AGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240

Query: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300
           ++ND+W     LN  CGADYVKT Q LP GI A+   + + CS+DGDADR++FY+ D + 
Sbjct: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360
           +F LLDGDK++TL AKF Q  L +A + + + LGVVQTAYANGSST Y+  VL +PV+CT
Sbjct: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360

Query: 361 PTGVKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419
           PTGVKHLH EA+  YD+G+YFEANGHGTV+FS+ F   V   L N   S  +  SL+ L 
Sbjct: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420

Query: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479
            FANLINQT+GDAI+DM+ V+A+LSIL W+P+ W+++YTDLPN LVKV+VPDR++FKTTN
Sbjct: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480

Query: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539
           AE+QL SP GLQ  I+ +V  Y   RSFVRASGTEDAVR+YAEA+++++AD LA++VS +
Sbjct: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540

Query: 540 V 540
           V
Sbjct: 541 V 541

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/538 (56%), Positives = 379/538 (70%), Gaps = 5/538 (0%)

Query: 10  LYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPP 69
           LYE +CK G  Y YGTAGFR    VLDTVMFTTG++A LRSIYL+ + VGVMITASHNPP
Sbjct: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65

Query: 70  EDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLAV 129
           EDNGVK+V+P GEML Q+WE  AT LAN+A+ SFT   + LQ++++EL +DT  L ++ V
Sbjct: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125

Query: 130 ARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDRFFYY 189
           ARDSRESGPRLL AL  G  V P ++I D+ LLTTPQLHFL    N     + +    YY
Sbjct: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYY 185

Query: 190 KEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLS-THKFFDGVFRVVNDDWET 248
             F+S W+ +T L  +  LP+ L ID ANGIGA +VK+++S      +     VN + +T
Sbjct: 186 DHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245

Query: 249 PASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD-SEGQFRLLDG 307
              LN  CGAD+VKTNQ  P     N    ++ CSFDGDADR+VFY+ D  E +F LLDG
Sbjct: 246 FQLLNESCGADFVKTNQTFP--ANCNPKPSQLYCSFDGDADRVVFYYVDGKENKFHLLDG 303

Query: 308 DKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGVKHL 367
           DK+ATL AK   D+L    L + L LGVVQTAYANGSST YI   L IPV+CT TGVKHL
Sbjct: 304 DKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHL 363

Query: 368 HHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFANLIN 426
           HHEA++ YDIG+YFEANGHGTV+FS++F E V+S L     ++   +SL  L   + LIN
Sbjct: 364 HHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQLIN 423

Query: 427 QTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQLLS 486
           QTVGDAISDM+ V+A LSI    P+ W+  Y DLPN+L KV+VPDR+VF +TNAERQLLS
Sbjct: 424 QTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLS 483

Query: 487 PLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVVEHNG 544
           P GLQ KI+ LV ++  +RSFVRASGTEDAVRVYAEA T E A  LA++V ++V+  G
Sbjct: 484 PEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELVKLFG 541

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/541 (57%), Positives = 388/541 (71%), Gaps = 12/541 (2%)

Query: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITAS 65
           LE+++E+ C +    Y YGTAGFR  A VLDTVM TTG+LA LRSI L+G+ VGVMITAS
Sbjct: 6   LESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITAS 65

Query: 66  HNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVSELGLDTDA 123
           HN P DNGVKIV+P G ML+QSWE +AT+LAN A+   S   F  YLQ   ++  +D+  
Sbjct: 66  HNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGI 125

Query: 124 LGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAI 183
              L V RDSR+SGPRLL  L + +  L   +I DYGLLTTPQLHFLT+  N   +   +
Sbjct: 126 TPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPV 185

Query: 184 DRFFYYKEFLSAWDDITALCGIQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFDGVFRVV 242
               YY  F+ AW  ITAL GI+ L   +L IDAANGIG P+V ++        G F +V
Sbjct: 186 TEDDYYSFFMDAWVSITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLV 244

Query: 243 NDDWETPASLNHLCGADYVKTNQRLPYGIQ--ANNDCQRICCSFDGDADRIVFYFCDSEG 300
           N+ W+TP  LN+ CGADYVKTNQRLP  I   A++D   + CSFDGDADRIVFY+ D++ 
Sbjct: 245 NNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQN 304

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360
            F LLDGDK++TLFA F    L  A L E++S+GVVQTAYANG+ST+Y+E VL IPV+C 
Sbjct: 305 SFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCA 364

Query: 361 PTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419
            TGVKHLHHEAI NYD+G+YFEANGHGT++FS KF E   S L   ++S      ++ L 
Sbjct: 365 KTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENNES----LEVKTLL 420

Query: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479
            FA+LINQTVGDAISDM+GVLAVLSI+K TP  W++EYTDLPN L KV+VPDR++F TT+
Sbjct: 421 SFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTD 480

Query: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539
            ER+LL+P G Q KI+A+VA+Y   RSFVRASGTEDAVRVYAEAST ++A +L   VS+ 
Sbjct: 481 QERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKA 540

Query: 540 V 540
           V
Sbjct: 541 V 541

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/539 (55%), Positives = 387/539 (71%), Gaps = 12/539 (2%)

Query: 10  LYETHCKSG-FTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNP 68
           L+E +C +    Y YGTAGFR  A +L+TVMFTTG++A LRSI L G+ VGVMITASHNP
Sbjct: 5   LFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNP 64

Query: 69  PEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSELGLDTDALGS- 126
           PEDNGVKIV+P G ML+QSWE  AT+LAN +A  +F    AY++  V +   ++ +    
Sbjct: 65  PEDNGVKIVEPNGAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQP 124

Query: 127 -LAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDR 185
            + V RDSRESG  LL  LL  +    N +I +YGLLTTPQLHFLT++ N +    A+  
Sbjct: 125 VVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEIN-VKKSYAVQE 183

Query: 186 FFYYKEFLSAWDDITALCGIQSL-PYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVND 244
             YY  F+ +W+ ITAL  I  L    L ID ANGIG P+++E+L +  F   V  +VN+
Sbjct: 184 SSYYNYFIESWNKITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWPFASKV-TLVNN 242

Query: 245 DWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEGQFRL 304
           +WE P  LN  CGAD+VKTNQ+LP G+  N+    + CS+DGDADRIVFYF D + QF L
Sbjct: 243 EWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHL 302

Query: 305 LDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTGV 364
           LDGDK++TLFAK    +L+ ANL  ++SLGVVQTAYANGSST+Y++  L +PV+C  TGV
Sbjct: 303 LDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGV 362

Query: 365 KHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFAN 423
           KHLHHEA+ NYDIGVYFEANGHGT++FS  F +V    L    +++S   ++  L   ++
Sbjct: 363 KHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL----KANSESIAVNTLVALSH 418

Query: 424 LINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAERQ 483
           LINQTVGDAISDM+GVL+VLSI+K + Q+W+ EYTDLPN L KV+VPDR+VF TT+ ER+
Sbjct: 419 LINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERK 478

Query: 484 LLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVVEH 542
           LLSP GLQ KI+  ++E+   RSFVRASGTEDAVRVYAEAS++EEA  L + V+++V+ 
Sbjct: 479 LLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKE 537

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/557 (53%), Positives = 383/557 (68%), Gaps = 30/557 (5%)

Query: 1   MLDTKTLETLYETHC-KSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVG 59
           ML   TL  L + +C  S   Y YGTAGFR  A  LDTV+F TG+LA LRS+ L+G  +G
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN------SATQSFTAFLAYLQ-N 112
           VM+TASHNPP DNGVK+V+P G M+ +SWE  AT+LAN      S+ +   A  ++LQ  
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 113 LVSEL-----GLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQL 167
           L  +L       +   + +L V RDSRESGP+LL  L+  ++ L + +I D GLLTTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 168 HFLTSKRNELPNDTAIDRFFYYKEFLSAWDDITALCGI-QSLPY--KLEIDAANGIGAPR 224
           HFLTS+  +   +    R  YY+ FL AWD +  L GI +SLP    L IDAANGIGAP+
Sbjct: 181 HFLTSETAKGVANVTESR--YYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238

Query: 225 VKEMLSTHKFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSF 284
           V+E+LS      G    +ND W  P  LNH CGAD+VK+NQR P G    ND   + CS+
Sbjct: 239 VQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF---NDSTGLGCSY 294

Query: 285 DGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGS 344
           DGDADR+VFY+ +   +F LLDGD+++ LFA FF  IL  A LQ  LSLGVVQTAYANG+
Sbjct: 295 DGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGN 354

Query: 345 STHYIERVLGIPVTCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLS 403
           ST Y+++ L +PV+C  TGVKHLHHEA+  YDIG+YFEANGHGT++FS KF +V+     
Sbjct: 355 STEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI----- 409

Query: 404 NKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNK 463
            K Q + S+ ++E L  F+ LINQTVGDAISDM+GVLA LSI KWTP+ W QE+TDLPN+
Sbjct: 410 -KEQKERSV-AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNR 467

Query: 464 LVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEA 523
           L KV+VPDR+VF TT+ ER+L  P GLQ KI+  V  + Q RSFVRASGTEDAVRVYAEA
Sbjct: 468 LAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEA 527

Query: 524 STREEADSLASRVSQVV 540
           ++ E+ + L++ V ++V
Sbjct: 528 ASLEDVEKLSNTVKELV 544

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/542 (54%), Positives = 379/542 (69%), Gaps = 26/542 (4%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           LD      L+   CK+    Y YGTAGFR KA +LDTVMFTTG +A LRS+  +G+ VGV
Sbjct: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           M+TASHNPP DNGVKIV+P G ML Q WE  ATDLAN A+Q     L    N    + L+
Sbjct: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDELVQFVN-AKLIELN 123

Query: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRN---EL 177
           ++ + +L V RDSRES   LL  L  GS  L + +I DY LLTTPQLHFLT+  N   +L
Sbjct: 124 SNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDL 183

Query: 178 PNDTAIDRFFYYKEFLSAWDDITALC--GIQSLPYKLE---IDAANGIGAPRVKEMLSTH 232
           P +T      YY  F +AWD + ++      S   K+E   ID+ANGIG P+++ +L   
Sbjct: 184 PKETD-----YYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYW 238

Query: 233 KFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQAN--NDCQR--ICCSFDGDA 288
           K    V R++N++W+ P SLN+ CGADYVKTNQ+LP GI  +  N+  +  I CSFDGDA
Sbjct: 239 KTNYKV-RLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDA 297

Query: 289 DRIVFYFCDSEGQ-FRLLDGDKMATLFAKF--FQDILSSANLQERLSLGVVQTAYANGSS 345
           DR+VFY+ D +   F LLDGDK++TLFA F   Q  L+  + +  + LGVVQTAYANGSS
Sbjct: 298 DRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSS 357

Query: 346 THYIERVLGIPVTCTPTGVKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSN 404
           T+Y+++ L IPV C  TGVKHLHHEA   YDIGVYFEANGHGT++FS+ F +++N  ++ 
Sbjct: 358 TNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINA 417

Query: 405 KHQSDSS--LQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPN 462
           + Q +++  L++L+ L   + LINQTVGDAISDMMGV+AVL+IL WTPQ WN+EYTDLPN
Sbjct: 418 ESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPN 477

Query: 463 KLVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAE 522
           KL K++VPDR+VF+TT+ ER+L SP GLQ KIN +VA+Y   RSFVRASGTEDAVRVYAE
Sbjct: 478 KLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAE 537

Query: 523 AS 524
           AS
Sbjct: 538 AS 539

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/538 (55%), Positives = 372/538 (69%), Gaps = 22/538 (4%)

Query: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITAS 65
           LE+L E +C + G+ Y YGTAGFR  ++ LDTVMF TG++A LRS  L G+ VGVMITAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 66  HNPPEDNGVKIVDPKGEMLEQSWESYATDLANS-ATQSFTAFLAYLQNLVSELGLDTDAL 124
           HNP  DNGVK+V+P G ML QSWES AT+LAN  A +      A +  L S    ++   
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKVGQLTSG---ESSVR 121

Query: 125 GSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAID 184
             L V RDSR SGP LL  L+  +  L + +ITDYGLLTTPQLHFLT++   +     +D
Sbjct: 122 PQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE--TMITGAHVD 179

Query: 185 RFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFRVVND 244
              Y+  FL AWD I AL  ++ LP  + +D ANGIG P++  +L T   F     V+ND
Sbjct: 180 EQAYFAHFLGAWDQIAALQPVK-LP-NVVVDCANGIGGPKMSALL-TQWGFAKQCSVIND 236

Query: 245 DWETPASLNHLCGADYVKTNQRLPYGIQAN-NDCQRICCSFDGDADRIVFYFCDSEGQFR 303
             + P  LNH CGAD+VKT+QRLP G++ N ND   + CSFDGDADR+VFY+ D    F 
Sbjct: 237 KCDEPELLNHGCGADFVKTSQRLPNGVKPNAND---LYCSFDGDADRVVFYYLDQNLGFH 293

Query: 304 LLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCTPTG 363
           LLDGDK++TLFA F   +L    L   LS+GVVQTAYANGSST Y++  L +PV+CT TG
Sbjct: 294 LLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTG 353

Query: 364 VKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLSKFA 422
           VKHLHHEA+N YDIG+YFEANGHGTV+FS KF E V       + +D + + L++L   A
Sbjct: 354 VKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVT------NHADQTPE-LKILKYLA 406

Query: 423 NLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTNAER 482
            LINQTVGDAISDMM VLAVLSIL+W+P +W++E+TDLPNKL KV+V DR+ F TT+ ER
Sbjct: 407 KLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQER 466

Query: 483 QLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQVV 540
           +L+SP GLQ KI+  VA     RSFVRASGTEDAVRVYAEA+T+ E D L+S V  +V
Sbjct: 467 RLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/553 (52%), Positives = 375/553 (67%), Gaps = 18/553 (3%)

Query: 2   LDTKTLETLYE-THCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +D   L  LYE T C     Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 3   IDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVSELG 118
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F A L  L+    
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEK 122

Query: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178
           +D DA   + V RDSRES P LL  L +    + +  + D G +TTPQLH++T+  N+  
Sbjct: 123 IDLDAAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQ 182

Query: 179 NDTAIDRFF----YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEMLST 231
            +    +      YY  F++A++++   C I+   S+P KL +D ANGIG P++K++L++
Sbjct: 183 REGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVP-KLFVDTANGIGGPQLKKLLAS 241

Query: 232 HKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDAD 289
             +        +VND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGDAD
Sbjct: 242 KDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSP-DSLYCSFDGDAD 300

Query: 290 RIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYI 349
           R+VFY+ D E +F LLDGDK++TLFAKF    L  ANL + L +GVVQTAYANGSST YI
Sbjct: 301 RVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYI 360

Query: 350 ERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQS 408
           +  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FSKKF + + S LS   ++
Sbjct: 361 KDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELS---RA 417

Query: 409 DSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVL 468
             SL +L  L  FANLINQTVGDAISDM+ VLA LSIL   P  W++EYTDLPNKLVK +
Sbjct: 418 QGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCI 477

Query: 469 VPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREE 528
           VPDR++F+TT+ ER+L +P GLQ KI++++ +Y   RSFVRASGTEDAVRVYAE     +
Sbjct: 478 VPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTK 537

Query: 529 ADSLASRVSQVVE 541
            D   + V + V+
Sbjct: 538 LDQFCNEVVEYVK 550

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/555 (51%), Positives = 383/555 (69%), Gaps = 20/555 (3%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +D + L  LY+  C++    Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 3   IDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVS--E 116
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F A L  L+   +
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEK 122

Query: 117 LGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNE 176
           +GLDT  +  + V RDSRES P LL  L +    + + ++ D G +TTPQLH++T   N+
Sbjct: 123 IGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNK 182

Query: 177 LPNDTAIDRFF----YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEML 229
              +           YY  F+ A++++ +   I+   S+P +L IDAANGIG P++K++L
Sbjct: 183 REREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVP-RLFIDAANGIGGPQLKKLL 241

Query: 230 STHKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGD 287
           ++  +        V+ND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGD
Sbjct: 242 TSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSH-DSLYCSFDGD 300

Query: 288 ADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTH 347
           ADR+VFY+ DSE QF LLDGDK++TLFAKF    L  A+L+  L +GVVQTAYANGSST+
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 348 YIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKH 406
           YIE  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF +V+ S LS   
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELS--- 417

Query: 407 QSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVK 466
           ++   + +L+ L  F+ LINQTVGDA+SDM+ VLA L+I+K  P  W++EYTDLPNKLVK
Sbjct: 418 RARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVK 477

Query: 467 VLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTR 526
            +VPDR++F+T + ER+L +P+GLQ KI+ ++A+Y   RSFVRASGTEDAVR+YAE    
Sbjct: 478 CIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDS 537

Query: 527 EEADSLASRVSQVVE 541
            + D   + + ++V+
Sbjct: 538 SQLDQFCNEIVELVK 552

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 372/552 (67%), Gaps = 24/552 (4%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +D   L+ +Y + C +  + Y YGTAGFR KA  LDTVMF TG++A  RS+ L G  VGV
Sbjct: 3   IDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSELGL 119
           M+TASHNPP DNGVK+V+P G ML Q WE   T LAN +A +SF     ++  +  +   
Sbjct: 63  MVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKF 122

Query: 120 D-TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTS----KR 174
              +   SL +  DSRES PRL   L+N +  + N  I +YGL+TTPQLHF+TS    K 
Sbjct: 123 PFQENKPSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKY 182

Query: 175 NELPNDT-AIDRFFYYKEFLSAWDDITALCGIQSLPY--KLEIDAANGIGAPRVKEMLST 231
           N+  ND  ++D   YY  F ++W     L    S      L ID+ANGIG P+V +++ST
Sbjct: 183 NKNTNDVISVDN--YYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLIST 240

Query: 232 H-KFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADR 290
                 G   ++N+ WE P  LN+ CGADYVKTNQ+LP GIQ N     + CSFDGDADR
Sbjct: 241 WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADR 299

Query: 291 IVFYFC-DSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYI 349
           IVFY+  + + +F LLDGDK+ATLFAKF  ++L   NL ++L LGVVQTAYANGSST+Y+
Sbjct: 300 IVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYL 359

Query: 350 ERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQS 408
             VL +PV+CT TGVKHLHHEA   YDIG+YFEANGHGTV+FS++F +V+        Q+
Sbjct: 360 TNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVL--------QN 411

Query: 409 DSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVL 468
           +    + + L  F  +INQTVGDA++DM+GV+ VLS+ K TP +W+Q Y DLPNKL KV+
Sbjct: 412 EPKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVI 471

Query: 469 VPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREE 528
           VPDR+VF TTN ERQL SP+GLQ KI+  V++    RSFVRASGTEDAVRVYAEA+T+EE
Sbjct: 472 VPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEE 531

Query: 529 ADSLASRVSQVV 540
            + L+  V + V
Sbjct: 532 TEKLSQEVCKFV 543

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/553 (51%), Positives = 379/553 (68%), Gaps = 24/553 (4%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +D + L  LY+  C++    Y+YGTAGFR  A  LDTVMFTTG+LA LRS+ L+G+ VGV
Sbjct: 3   IDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120
           MITASHNP +DNGVKIV+P G ML  SWE YA  LAN+A+ + T F  +   LV  + L+
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFA-THFEEFYAELVKLIELE 121

Query: 121 TDALGS------LAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT--S 172
              LG+      + V RDSRES P LL  L +    + + R+ D G +TTPQLH++T  S
Sbjct: 122 KIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLS 181

Query: 173 KRNELPNDTAIDRFF---YYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVK 226
            R E   D+A+       YY  F+ A++++     ++   S+P KL ID ANGIG P++K
Sbjct: 182 NRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVP-KLFIDTANGIGGPQLK 240

Query: 227 EMLSTHKFF--DGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSF 284
           ++L++  +        ++ND  + P  LN  CGADYVKTNQRLP G+  ++  + + CSF
Sbjct: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSS-FESLYCSF 299

Query: 285 DGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGS 344
           DGDADR+VFY+ DSE +F LLDGDK++TLFAKF    L  ANL+  L +GVVQTAYANGS
Sbjct: 300 DGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGS 359

Query: 345 STHYIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLS 403
           ST YI+  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF + + S LS
Sbjct: 360 STAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELS 419

Query: 404 NKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNK 463
              + +    +L+ LS FA LINQTVGDA+SDM+ VLA L+ILK  P  W++EY DLPNK
Sbjct: 420 ---KPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNK 476

Query: 464 LVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEA 523
           LVK +VPDR++F+TT+ ER+L +P+GLQ KI++++A+Y   RSFVRASGTEDAVRVYAE 
Sbjct: 477 LVKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAEC 536

Query: 524 STREEADSLASRV 536
               + D   + +
Sbjct: 537 QDMSKLDQFCNEI 549

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/556 (52%), Positives = 383/556 (68%), Gaps = 21/556 (3%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +D + L  LY+  C++    ++YGTAGFR  A  LDTVMF+TG+LA LRS+ L+G+ VGV
Sbjct: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVS--E 116
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F   L  L+   +
Sbjct: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122

Query: 117 LGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT--SKR 174
           + L+T  +  + V RDSRES P LL  L +    + + ++ D G +TTPQLH++T  S R
Sbjct: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182

Query: 175 NELPNDTA--IDRFFYYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEML 229
            +L  DTA       YY  F+ A++++ A   ++   S+P KL ID ANGIG P++K++L
Sbjct: 183 RKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241

Query: 230 STHKFFDGV--FRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGD 287
           ++  +        V+ND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGD
Sbjct: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSFDGD 300

Query: 288 ADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTH 347
           ADR+VFY+ DS  +F LLDGDK++TLFAKF    L  A+L+  L +GVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 348 YIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKH 406
           YI+  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF   + S LS   
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 407 QSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVK 466
            +  +L +L  L  F+ LINQTVGDAISDM+ VLA L+ILK +P  W++EYTDLPNKLVK
Sbjct: 421 LNGDTL-ALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVK 479

Query: 467 VLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTR 526
            +VPDR++F+TT+ ER+LL+P+GLQ KI+ +VA+Y   RSFVRASGTEDAVRVYAE    
Sbjct: 480 CIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC--- 536

Query: 527 EEADSLASRVSQVVEH 542
           +++  L     +VVEH
Sbjct: 537 KDSSKLGQFCDEVVEH 552

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/545 (53%), Positives = 359/545 (65%), Gaps = 29/545 (5%)

Query: 10  LYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNP 68
           LY  +C +    Y YGTAGFR  A +LD+VMFTTGV+A LRSI  +   VGVMITASHNP
Sbjct: 5   LYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNP 64

Query: 69  PEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLDTDALGSLA 128
           P DNGVKIV+  G ML Q WE  AT LANS     T F + L  ++ EL +       + 
Sbjct: 65  PRDNGVKIVESDGSMLLQDWEPLATRLANSVADYHT-FESTLNAIMQELNISPGHAPQIV 123

Query: 129 VARDSRESGPRLLHALLNGSR-VLPNIRITDYGLLTTPQLHFLTSKRNELPNDTAIDRFF 187
           V  DSRES PRLL  LL+G + V P+ RIT++GLLTTPQLHFLT+      +       +
Sbjct: 124 VGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANPAHFED-------Y 176

Query: 188 YYKEFLSAWDDITALCGIQSLPY--KLEIDAANGIGAPRVKEMLS--------THKFFDG 237
           YY+ FL AW+ +  L GI+      KL ID ANGIG P+  +MLS          K    
Sbjct: 177 YYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLH 236

Query: 238 VFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD 297
              + N+ W  P+ LN  CGAD+VKTNQRLP GI  N D + + CSFDGDADR+VFY+ D
Sbjct: 237 QIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGI--NADPRNLYCSFDGDADRVVFYYVD 294

Query: 298 SEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPV 357
               F LLDGDK++TL A F   +L  A L E L LGVVQTAYANGSST Y+ + L +PV
Sbjct: 295 DSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPV 354

Query: 358 TCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLS-NKHQSDSSLQSL 415
           +   TGVKHLHHEA+ NYDIGVYFEANGHGTV+FS+ F EV+   L+ N H      +S 
Sbjct: 355 SIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHD-----KST 409

Query: 416 EVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVF 475
             L   + LINQT+GDAISDM+ ++ VL IL W+P  W+ EYTDLPNKL KV+VPDR++F
Sbjct: 410 LTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIF 469

Query: 476 KTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASR 535
            TT+ ER+L+SP GLQ KI+ LVA+    RSF+RASGTEDAVRVYAEA T E  + L++ 
Sbjct: 470 ITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTE 529

Query: 536 VSQVV 540
           V+  +
Sbjct: 530 VTDAL 534

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  520 bits (1339), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 273/547 (49%), Positives = 370/547 (67%), Gaps = 11/547 (2%)

Query: 1   MLDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVG 59
           M D   LE  +  +C +   +Y YGTAGFR  A  LDTVMFTTG++A LRS+ L+G+ +G
Sbjct: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60

Query: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQ-SFTAFLAYLQNLVSELG 118
           VMITASHNPP+DNGVKIV+P G ML +SWE  ATDLAN A+  +FTAF+ +L  ++++L 
Sbjct: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLN 120

Query: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178
           +D      L V  DSRES P L+  L   + V   I I ++ L+TTPQLH+LT  +N++ 
Sbjct: 121 IDETTTPRLIVGHDSRESSPYLMECLQAAAPVFDTIVI-NHTLITTPQLHYLTMLQNDVV 179

Query: 179 NDTAIDRFFYYKEFLSAWDDITALCGIQSLPYK-LEIDAANGIGAPRVKEMLSTHKFFDG 237
             T +D   YYK F ++W+++ +L    +L +  L +D ANG+G+ +  + L        
Sbjct: 180 --TEVD---YYKFFSTSWNNLFSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLAT 234

Query: 238 VFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCD 297
           +  ++ND    P  LN  CGAD+VKTNQ+LP GI  N +   +  SFDGDADRIVFY+ D
Sbjct: 235 LTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVD 293

Query: 298 SEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPV 357
           +  +F LLDGDK++T+  K    +L  + L   ++LGVVQTAYANGSST YI + L +PV
Sbjct: 294 NNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPV 353

Query: 358 TCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLE 416
            CT TGVKHLHH A   +DIG+YFEANGHGTV+FS KF EV+   + N   S+   ++  
Sbjct: 354 ECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARL 413

Query: 417 VLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFK 476
            L  F+ LINQTVGD+++D++ V+A LSIL+ +P  W+ EY DLPN L K  V +R VFK
Sbjct: 414 SLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFK 473

Query: 477 TTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRV 536
           TT+ ER+L SP GLQ KI+A V++Y   RSFVRASGTEDAVR+YAEA T+ E ++L+  V
Sbjct: 474 TTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEV 533

Query: 537 SQVVEHN 543
           +Q+VE++
Sbjct: 534 TQLVENS 540

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  520 bits (1339), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 284/551 (51%), Positives = 376/551 (68%), Gaps = 25/551 (4%)

Query: 7   LETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRT----VGVM 61
           L++ +   C++  + Y YGTAGFR  A  LDTVMFTTG++A LRS+ L+       +GVM
Sbjct: 12  LKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVM 71

Query: 62  ITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSEL--G 118
           +TASHNPPEDNGVKI++P G ML Q WE  AT  AN +A +SF  F   L + +  L   
Sbjct: 72  VTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSIVTLEND 131

Query: 119 LDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELP 178
           L+     +L +  DSR+S P L++ ++  + ++ N +I +Y  +TTPQLHFLT+  N   
Sbjct: 132 LNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTG 191

Query: 179 NDTAIDRFFYYKEFLSAWDDITALCGIQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFDG 237
               I+ + ++ ++LS    + +L    +LP+  L IDAANGIGAP+V+++L T   F  
Sbjct: 192 TAEEINYYDHFNKYLS---QLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPP 248

Query: 238 V-----FRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQR-ICCSFDGDADRI 291
           +      +++N+D + P  LN  CGADYVKTNQ+LP GI  + D    + CS+DGDADRI
Sbjct: 249 LNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRI 308

Query: 292 VFYFCDS-EGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIE 350
           VFY+ D     F LLDGDK+ATLFAKFF ++L+ A L   L LGVVQTAYANGSST+YI 
Sbjct: 309 VFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYIS 368

Query: 351 RVLGIPVTCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSD 409
             L +PV+CT TGVKHLHHEAI  YDIG+YFEANGHGTV+FS KF    +S L+   +S 
Sbjct: 369 SKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKF----HSELTKLKESG 424

Query: 410 SSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLV 469
           SS + ++ L  F+ LINQTVGDA+SDM+ V+AVLSIL+ +P  W++EY DLPNKL KV+V
Sbjct: 425 SS-REIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIV 483

Query: 470 PDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEA 529
           PDR+ F TT+ ER+L+ P GLQP +   VA     RSFVRASGTEDAVRVYAEA T+EE 
Sbjct: 484 PDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEET 543

Query: 530 DSLASRVSQVV 540
           + L+ +V Q+V
Sbjct: 544 EWLSKKVCQLV 554

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  509 bits (1310), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 278/549 (50%), Positives = 364/549 (66%), Gaps = 25/549 (4%)

Query: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60
           +  + +  +++  C + G+TY YGTAGFR KA VLDTVMF TG +A LRS  L G  VGV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN-SATQSFTAFLAYLQNLVSELGL 119
           M+TASHNPPEDNGVK+VDP+G ML + WE  AT LAN +A  +F  +  Y  +LV E   
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGTFDQWWEYWTSLVEEGNY 120

Query: 120 DTDALGSLAVARDSRESGPRLLHALLNGSRVLP--NIRITDYGLLTTPQLHFLTSKRNEL 177
              A   L V  D+RES PRLL  L++ +  +   +I I+   +   PQLH+LTS    L
Sbjct: 121 TGGA--RLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTS----L 174

Query: 178 PNDTAIDRFFYYKEFLSAWDDITALCGIQSLPY-KLEIDAANGIGAPRVKEMLSTHKFFD 236
             D   D   Y   F   W  +    G+ + P+ +L ID ANG+GA ++++         
Sbjct: 175 QRDGVTDAAAYNDHFQGCWQKLFP-DGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQ 233

Query: 237 GVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQ----ANNDCQRICCSFDGDADRIV 292
             FR++N D+ TP +LN  CGAD+VKTN RLP  +      +     + CSFDGDADRIV
Sbjct: 234 NKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLYCSFDGDADRIV 293

Query: 293 FYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERV 352
           FYF  ++ QF LLDGDK++TLFAKF   + + A   ++L++GVVQTAYANG+ST YI   
Sbjct: 294 FYFVKNK-QFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASE 352

Query: 353 LGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSS 411
           LGIP  CT TGVKHLHH A   YDIG+YFEANGHGTVVFS KF+EVV +G+++ + + S+
Sbjct: 353 LGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVV-AGVASTNDAAST 411

Query: 412 LQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPD 471
           L        F+ LINQTVGDAI+DM+GVLAVL  L+WTP+ W  EYTDLPN L KV+VPD
Sbjct: 412 LY------HFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPD 465

Query: 472 RTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADS 531
           R++F+TT+ ER+L+SP GLQ KI+A V  + +ARSFVRASGTE+AVR+Y EA   +E   
Sbjct: 466 RSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQE 525

Query: 532 LASRVSQVV 540
           L+ +V++ V
Sbjct: 526 LSKQVTEAV 534

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 55  GRTVGVMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAF-LAYLQNL 113
           G +VGVMITASHNP  DNG K+    G    Q    + +++A S  ++ T +  A+  + 
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNG---CQIIPPHDSEIAQSIEENLTLWPKAWKWDE 212

Query: 114 VSELGLDTDAL---GSLAVARDSRESGPRLL 141
           + + GLDT  L   G   + R +++ G  L+
Sbjct: 213 LLKEGLDTKCLVYAGEEMIERYTKKMGQSLV 243

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 15/75 (20%)

Query: 57  TVGVMITASHNPPEDNGVK--------IVDPK----GEMLEQSWESYATDLANSATQSF- 103
           +VGVMITASHNP  DNG K        I+ P      EM++++ E ++T     AT    
Sbjct: 152 SVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKG 211

Query: 104 --TAFLAYLQNLVSE 116
             T  L ++++L++E
Sbjct: 212 LETNKLVFIKDLMTE 226

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 54/131 (41%), Gaps = 42/131 (32%)

Query: 29  RYKADVLDTVMFTTGVLAGLRSIYLEGR------------------TVGVMITASHNPPE 70
           RY +     V   T + AG +  YL                     +VGVMITASHNP  
Sbjct: 101 RYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKM 160

Query: 71  DNGVK--------IVDPK----GEMLEQSWESYATD------LANSATQSFTAFL----- 107
           DNG K        I+ P      E +  + E ++TD      L+N+ T     ++     
Sbjct: 161 DNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRML 220

Query: 108 -AYLQNLVSEL 117
            +YL ++V++L
Sbjct: 221 TSYLNSVVNQL 231

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%)

Query: 55  GRTVGVMITASHNPPEDNGVKI 76
           G +VGVMITASHNP  DNG K+
Sbjct: 154 GASVGVMITASHNPKMDNGYKV 175

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (57%), Gaps = 4/52 (7%)

Query: 26  AGFR-YKADVLDTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPPEDNGVKI 76
           AGF+ Y  +  D  + T  V  G+    L   ++GVMITASHNP  DNG K+
Sbjct: 127 AGFKVYYLNPNDEFVHTPMVPFGIN---LYSASIGVMITASHNPEMDNGYKV 175

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 18/22 (81%)

Query: 55  GRTVGVMITASHNPPEDNGVKI 76
           G +VG+MITASHNP  DNG K+
Sbjct: 151 GASVGIMITASHNPKMDNGYKV 172

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 8/41 (19%)

Query: 55  GRTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87
           G + GVMITASHNP  DNG K        I+ P   ++ QS
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIAQS 192

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 36  DTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87
           D V+ T  V  G+  +   G   G+MITASHNP  DNG K        I+ P  + + QS
Sbjct: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 27/113 (23%)

Query: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWESYATDLAN 97
           +VGVMITASHNP  DNG K+                   +D   E  E SW+ + T +  
Sbjct: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWD-WPTVIQA 211

Query: 98  SATQSFTAFLAYLQNLVSELGLDTDAL---GSLAVARDSRESGPRLLHALLNG 147
           +  +     + Y+++ +++L   T  L   G   V R+   SGP  ++  ++G
Sbjct: 212 AEKED---RIVYVKDQMTQLYTKTAELQLIGGRKVLRNPG-SGPWFVYTPMHG 260

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 20/64 (31%)

Query: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWESYATDLAN 97
           +VGVM+TASHNP  DNG K+                   +D   E  E SW +Y   +AN
Sbjct: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSW-NYKEIMAN 223

Query: 98  SATQ 101
           + ++
Sbjct: 224 AESK 227

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 150 SVGVMITASHNPKMDNGYKV 169

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/22 (63%), Positives = 17/22 (77%)

Query: 55  GRTVGVMITASHNPPEDNGVKI 76
           G + G+MITASHNP  DNG K+
Sbjct: 160 GASCGIMITASHNPKMDNGYKV 181

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVMITASHNP  DNG K+
Sbjct: 146 SVGVMITASHNPKLDNGYKV 165

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           ++GVMITASHNP  DNG K+
Sbjct: 153 SIGVMITASHNPKMDNGYKV 172

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 16/18 (88%)

Query: 59  GVMITASHNPPEDNGVKI 76
           GVMITASHNP +DNG K+
Sbjct: 158 GVMITASHNPKDDNGYKV 175

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 17/20 (85%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           +VGVM+TASHNP  DNG K+
Sbjct: 150 SVGVMVTASHNPKMDNGYKV 169

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           + GVMITASHNP  DNG K+
Sbjct: 158 SCGVMITASHNPKMDNGYKV 177

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 57  TVGVMITASHNPPEDNGVKI 76
           + G+MITASHNP  DNG K+
Sbjct: 154 SAGIMITASHNPKMDNGYKV 173

>KLTH0A02684g Chr1 complement(227861..234283) [6423 bp, 2140 aa]
           {ON} similar to uniprot|P43583 Saccharomyces cerevisiae
           YFL007W BLM3 Protein involved in assembly of proteasomal
           core particles in the nucleus required for normal
           resistance to bleomycin may be involved in protection
           against oxidative damage
          Length = 2140

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 9/104 (8%)

Query: 87  SWESYATDLANSATQSFTAFLAYLQNLVSELGLDT---DALGSLAVARDSRESGPRLLHA 143
           S+  Y    + S T  F             +G DT   D +G +A      ++  +LLH 
Sbjct: 386 SFVPYRYQKSASITDYFPLIFTLWTTTTPSVGFDTHFYDFIGCIA-----EDALNKLLHE 440

Query: 144 LLNGSRVLPNIRITDYGLLTTPQLHFLTSK-RNELPNDTAIDRF 186
                +VL N+   ++GLLT  Q++F+ ++ +N L ND  +  F
Sbjct: 441 KAPHLQVLGNVSFREFGLLTEDQINFIFNRVQNHLRNDFQVVSF 484

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 34/167 (20%), Positives = 72/167 (43%), Gaps = 20/167 (11%)

Query: 301 QFRLLDGDKMATLFAKFFQDILSSANLQ------ERLSLGVVQTAYANGSSTHYIERVLG 354
             R+L+ D +A   ++   D  S  +++      E LS  +   ++  G S H+++  + 
Sbjct: 475 HMRVLEADYLALGVSEMINDSPSGVDVERVWELLEDLSATLSSVSFEKGESHHHLDMEMR 534

Query: 355 IPVTCTPTGVKHLH----HEAINYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDS 410
           I +      V H H       +  D  +Y+E         +  F+ VV    + +     
Sbjct: 535 ISLQLLEISVSHAHFIHCETQLPQDSKMYWE-------TLNDLFERVVTLSTTCQEYFHG 587

Query: 411 SLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEY 457
              SL+  ++F   +N+ +G +++ + GVL  L +L+++     QE+
Sbjct: 588 VQSSLDPYTRF--YVNKIIGVSLNRVCGVLPGL-LLRFSGAPNFQEW 631

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,894,592
Number of extensions: 2484351
Number of successful extensions: 6355
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6437
Number of HSP's successfully gapped: 51
Length of query: 544
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 429
Effective length of database: 40,294,809
Effective search space: 17286473061
Effective search space used: 17286473061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)