Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11484g6.12ON89894744e-63
SAKL0E00924g6.12ON97942621e-30
Kwal_56.223596.12ON91892575e-30
Ecym_30156.12ON70712148e-24
ACR014C6.12ON70701912e-20
KLLA0D00880g6.12ON71721913e-20
Smik_5.286.12ON74751462e-13
Suva_5.96.12ON73731435e-13
YEL059C-A (SOM1)6.12ON74731429e-13
TDEL0G045906.12ON74761402e-12
Kpol_1032.36.12ON78801307e-11
Skud_5.306.12ON74731262e-10
ZYRO0F00528g6.12ON77781132e-08
TPHA0M002206.12ON78781132e-08
NCAS0F002106.12ON79821114e-08
KNAG0E009306.12ON10955979e-06
TBLA0G009906.12ON7882891e-04
KAFR0L003506.12ON7136836e-04
Skud_6.3na 1ON62936670.44
KLTH0G17534g4.183ON29742640.90
Kwal_14.14114.183ON29327641.0
Ecym_24554.200ON57227622.0
TBLA0A019906.208ON34860612.7
KNAG0A071002.547ON128651604.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11484g
         (89 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...   187   4e-63
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...   105   1e-30
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...   103   5e-30
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    87   8e-24
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    78   2e-20
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    78   3e-20
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    61   2e-13
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    60   5e-13
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    59   9e-13
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    59   2e-12
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    55   7e-11
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    53   2e-10
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    48   2e-08
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    48   2e-08
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    47   4e-08
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    42   9e-06
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    39   1e-04
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    37   6e-04
Skud_6.3 Chr6 complement(4885..6774) [1890 bp, 629 aa] {ON} YFL0...    30   0.44 
KLTH0G17534g Chr7 (1519882..1520775) [894 bp, 297 aa] {ON} highl...    29   0.90 
Kwal_14.1411 s14 complement(314496..315377) [882 bp, 293 aa] {ON...    29   1.0  
Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}...    28   2.0  
TBLA0A01990 Chr1 complement(480298..481344) [1047 bp, 348 aa] {O...    28   2.7  
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    28   4.2  

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score =  187 bits (474), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60
          MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60

Query: 61 RIEVTDQDTNHLAFDATVTRFWESSRRCT 89
          RIEVTDQDTNHLAFDATVTRFWESSRRCT
Sbjct: 61 RIEVTDQDTNHLAFDATVTRFWESSRRCT 89

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score =  105 bits (262), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 9/94 (9%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKEC------- 53
          MAPPT VFGK+EL+ + +K   PC LK+L+QNEC FNG EY+C PFKRLFKEC       
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 54 -GAGKRIVRIEVTDQDTNH-LAFDATVTRFWESS 85
           G   R VRIE+TD+ TN  +  D  V RFWE+ 
Sbjct: 61 DGRTSRTVRIEITDRHTNDGILEDQMVKRFWEAD 94

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score =  103 bits (257), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 59/89 (66%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60
          MAPPT+VFGKEEL+ +       C  K+L Q+EC F+GH+YVC PFKR+FKEC    + +
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60

Query: 61 RIEVTDQDTNHLAFDATVTRFWESSRRCT 89
          RIEVTD++TN    D  V  FW S +  T
Sbjct: 61 RIEVTDRNTNKAKADEMVDSFWNSRKSFT 89

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 87.0 bits (214), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 50/71 (70%), Gaps = 1/71 (1%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60
          MAPPT +  ++E++ I  +  + C L +L+QNEC F+GH YVC PFKRLF+EC   KR V
Sbjct: 1  MAPPTPIITRDEVEPILSRTKD-CILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRV 59

Query: 61 RIEVTDQDTNH 71
          RIEVTD  TN 
Sbjct: 60 RIEVTDISTNQ 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 78.2 bits (191), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60
          MAPPT V  +EE+      + + C L +L QNEC F+G  YVC PF+RLF+EC   KR V
Sbjct: 1  MAPPTPVLTREEVAPALATSRD-CVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV 59

Query: 61 RIEVTDQDTN 70
          RIE+T+++TN
Sbjct: 60 RIEITERNTN 69

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 78.2 bits (191), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGK-RI 59
          MAPPT + G +  + + ++  E C LK+LVQNEC FNG++YVCTPFKRLF++C     R+
Sbjct: 1  MAPPTKILGLDTQQRMLQRG-ENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRV 59

Query: 60 VRIEVTDQDTNH 71
          + IEVT+ +TN 
Sbjct: 60 LNIEVTNLNTNR 71

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 60.8 bits (146), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 7/75 (9%)

Query: 1  MAPPTLVFGKEE----LKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKEC-GA 55
          MAPPT +  +++    L  +  +A+  C LK LVQ EC+F G +YVC+PFKRLF+ C   
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQAS--CQLKELVQWECQFKGADYVCSPFKRLFEHCVEH 58

Query: 56 GKRIVRIEVTDQDTN 70
          GK     EVTD  TN
Sbjct: 59 GKPATNYEVTDTYTN 73

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 59.7 bits (143), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57
          MAPPT +  +++         +   C LK LVQ EC+F G +YVC+PF+RLF+ C A G+
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 58 RIVRIEVTDQDTN 70
               EVTD  TN
Sbjct: 61 AATNYEVTDTYTN 73

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 59.3 bits (142), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57
          MAPPT +  +++         +   C LK LVQ EC+F G EYVC+PFKRLF+ C A  K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 58 RIVRIEVTDQDTN 70
               EVTD  TN
Sbjct: 61 SATNYEVTDTYTN 73

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 58.5 bits (140), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 43/76 (56%), Gaps = 7/76 (9%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEF---NGHEYVCTPFKRLFKEC--GA 55
          MAPPT V  +EEL  I +     C LK+L Q +C+        Y C PFKRLF+EC   +
Sbjct: 1  MAPPTPVLAREELPEIPQSKN--CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPS 58

Query: 56 GKRIVRIEVTDQDTNH 71
          G+   RIEVT   TNH
Sbjct: 59 GRFKSRIEVTSPLTNH 74

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 54.7 bits (130), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (57%), Gaps = 13/80 (16%)

Query: 1  MAPPTLVFGKEE-LKG-----IWEKAAEPCFLKALVQNECEFNGH---EYVCTPFKRLFK 51
          MAPPT +  +EE L+G     + +     C L ++ Q +C F      EY+C PFKRLF+
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 52 ECGAGKRIVRIEVTDQDTNH 71
          EC      +RIEVTD+ TN+
Sbjct: 61 ECSG----IRIEVTDRFTNN 76

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 53.1 bits (126), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57
          MAPPT +  +++         +   C LK LVQ EC+F   +YVC PFKRLF+ C A  K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 58 RIVRIEVTDQDTN 70
               EVTD  TN
Sbjct: 61 SATDYEVTDTYTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 48.1 bits (113), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 1  MAPPTLVFGKEELKGIWE-----KAAEPCFLKALVQNECEFNGH-EYVCTPFKRLFKECG 54
          MAPPT +   E++    E     K    C LK+L Q+ C      EY+C PFKR+F++C 
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 55 AGKRIVRIEVTDQDTNHL 72
                 +EVTD DTN +
Sbjct: 61 GHA----LEVTDADTNDI 74

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 48.1 bits (113), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 1  MAPPTLVFGKEE----LKGIWEKAAEPCFLKALVQNECEF---NGHEYVCTPFKRLFKEC 53
          MAP T V  +E     L+   ++  + C LKAL Q EC+F     + Y+C PFKRLF+ C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 54 GAGKRIVRIEVTDQDTNH 71
                   E T Q TN 
Sbjct: 61 AGTS----YETTAQPTNS 74

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 47.4 bits (111), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 16/82 (19%)

Query: 1  MAPPTLVFGKEELK--------GIWEKAAEP---CFLKALVQNECEF-NGHEYVCTPFKR 48
          MAPP +VFGK++++           E  AE    C    L Q +C+     +Y+C PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 49 LFKECGAGKRIVRIEVTDQDTN 70
          +F+EC      VR EVT+ D+N
Sbjct: 61 VFQECQG----VRTEVTNVDSN 78

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 42.0 bits (97), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA 55
          MAP   V  + ++     +  + C LK LVQ  CE +G ++ C PF+RLF++C +
Sbjct: 1  MAPNVRVLTRNDVP--LPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQCPS 53

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 38.9 bits (89), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 17/82 (20%)

Query: 1  MAPPTLVFGKEEL-----------KGIWEKAAEPCFLKALVQNECEFNGHEYV-CTPFKR 48
          MAPP  +  KEEL           K   +K+A+P    ++ Q EC  N    + C PFKR
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKY-SITQYECFDNDKGQIECFPFKR 59

Query: 49 LFKECGAGKRIVRIEVTDQDTN 70
          +F++ G  +R    E+TD+ TN
Sbjct: 60 IFQQVGEYRR----EITDETTN 77

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 36.6 bits (83), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 19 KAAEPCFLKALVQNECEFN-GHEYVCTPFKRLFKEC 53
          K AE C L +LVQ  CE+  G    C PFKR+F EC
Sbjct: 18 KGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53

>Skud_6.3 Chr6 complement(4885..6774) [1890 bp, 629 aa] {ON} YFL054C
           (REAL)
          Length = 629

 Score = 30.4 bits (67), Expect = 0.44,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 46  FKRLFKECGAGKRIVRIEVTDQDTNHLAFDATVTRF 81
           +KRL +    GKR+  IE   Q TN +A D   T+ 
Sbjct: 204 WKRLLRSAAPGKRLGDIEAQTQRTNSIAADKAQTKL 239

>KLTH0G17534g Chr7 (1519882..1520775) [894 bp, 297 aa] {ON} highly
           similar to uniprot|P49954 Saccharomyces cerevisiae
           YLR351C
          Length = 297

 Score = 29.3 bits (64), Expect = 0.90,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 20/42 (47%)

Query: 38  GHEYVCTPFKRLFKECGAGKRIVRIEVTDQDTNHLAFDATVT 79
           GH  VC P   +  E G G+ IV  E+  +  +H+     VT
Sbjct: 233 GHSLVCDPQGNIVAEAGEGEEIVYAELDPERISHMRRSIPVT 274

>Kwal_14.1411 s14 complement(314496..315377) [882 bp, 293 aa] {ON}
           YLR351C (NIT3) - nitrilase superfamily member [contig
           242] FULL
          Length = 293

 Score = 29.3 bits (64), Expect = 1.0,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 38  GHEYVCTPFKRLFKECGAGKRIVRIEV 64
           GH  VC P  R+  E G+G+ IV  E+
Sbjct: 231 GHSLVCDPQGRIIAEAGSGEEIVYAEL 257

>Ecym_2455 Chr2 complement(885426..887144) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii ABL009W
          Length = 572

 Score = 28.5 bits (62), Expect = 2.0,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 3   PPTLVFGKEELKGIWEKAAEPCFLKAL 29
           P  +VF  ++++G WE+ +E   LKAL
Sbjct: 289 PDLIVFTGDQIEGEWEQDSETALLKAL 315

>TBLA0A01990 Chr1 complement(480298..481344) [1047 bp, 348 aa] {ON}
           Anc_6.208 YPL200W
          Length = 348

 Score = 28.1 bits (61), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 24  CFLKAL--------VQNECEFNGHEYVCTPFKRLFKECGAGKRIVRIEVTDQDTNHLAFD 75
           CF K L        V+NE   N  E   +P KRLF      +++   E+ + +++ LA+D
Sbjct: 282 CFYKFLNCLSLSGNVENESIINHIEVDSSPIKRLFNYLFIKEKVRDSEMFEDNSSKLAYD 341

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 27.7 bits (60), Expect = 4.2,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 3  PPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKEC 53
          PP  + GK+  K    +A + C  K +   +C++N    +CT  +R+ + C
Sbjct: 39 PPMEMHGKKRTKA--SRACDQCRRKKI---KCDYNDMRNICTNCQRIGERC 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,457,540
Number of extensions: 313174
Number of successful extensions: 582
Number of sequences better than 10.0: 24
Number of HSP's gapped: 576
Number of HSP's successfully gapped: 24
Length of query: 89
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 29
Effective length of database: 46,601,439
Effective search space: 1351441731
Effective search space used: 1351441731
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)