Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11462g6.13ON49249226240.0
Kwal_56.223626.13ON49349224040.0
SAKL0E00946g6.13ON49349323470.0
Ecym_30166.13ON48949122590.0
KLLA0D00902g6.13ON49246022060.0
TDEL0G045806.13ON48446021960.0
Kpol_1032.46.13ON46745921600.0
CAGL0A01045g6.13ON48347821600.0
ACR013C6.13ON48847721590.0
NCAS0D026206.13ON49347520870.0
Kpol_1045.766.13ON48547420790.0
Skud_16.166.13ON48846020780.0
Smik_6.4706.13ON48846020740.0
YPL262W (FUM1)6.13ON48846020690.0
ZYRO0C07964g6.13ON50548120710.0
Suva_16.436.13ON48846020560.0
TPHA0J002706.13ON49648420470.0
KNAG0E027506.13ON49847320210.0
KAFR0B065206.13ON49547420150.0
TBLA0G010006.13ON46546119480.0
NDAI0I024706.13ON47546019470.0
TBLA0A071306.13ON50048119300.0
SAKL0D09746g1.354ON4642781232e-06
KLLA0A08404g1.354ON4612451196e-06
NCAS0A090101.354ON4622411171e-05
TDEL0D022201.354ON4652411134e-05
Skud_8.701.354ON4632411125e-05
NDAI0G059401.354ON4622451091e-04
CAGL0I08987g1.354ON4612751091e-04
Ecym_27491.354ON4702881091e-04
YLR359W (ADE13)4.197ON4821861082e-04
Suva_10.4594.197ON4821861072e-04
Smik_12.4464.197ON4821861072e-04
Ecym_24524.197ON4821941062e-04
CAGL0B02794g4.197ON4821921062e-04
AEL019W1.354ON4692961053e-04
Suva_15.2011.354ON4632411044e-04
KNAG0I015601.354ON4622451044e-04
ZYRO0G00748g1.354ON4622441018e-04
Skud_12.4434.197ON4821861010.001
Smik_8.831.354ON4632411000.001
TPHA0B010404.197ON4821921000.001
TBLA0A083204.197ON482213990.001
TPHA0A021901.354ON463240990.002
TBLA0F034801.354ON466237990.002
Kpol_1018.1251.354ON460245980.002
NDAI0J019504.197ON482194950.005
NCAS0J012004.197ON482192940.006
Kpol_1042.164.197ON482192940.006
YHR018C (ARG4)1.354ON463241930.008
Kwal_47.180664.197ON482189930.009
KNAG0B058404.197ON482192930.010
KAFR0A062304.197ON482192920.011
ZYRO0B07964g4.197ON482186920.013
SAKL0B04972g4.197ON482192910.016
KLTH0G19338g1.354ON465257890.027
Kwal_27.127821.354ON465269890.029
KLLA0B13189g4.197ON482192880.039
TDEL0E017604.197ON482192840.10
KLTH0A03344g4.197ON482192830.12
ABL006C4.197ON482192800.29
Kwal_27.106577.429ON462161800.34
YGR130C3.492ON81642770.93
Suva_4.4946.148ON85092770.93
TDEL0G04710na 1ON40643714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11462g
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...  1015   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   930   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   908   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   874   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   854   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   850   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   836   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   836   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   836   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   808   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   805   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   805   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   803   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   801   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   802   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   796   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   793   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   783   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   780   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   754   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   754   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   748   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    52   2e-06
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    50   6e-06
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    50   1e-05
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    48   4e-05
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    48   5e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    47   1e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    47   1e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    47   1e-04
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    46   2e-04
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    46   2e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    46   2e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    45   2e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    45   2e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    45   3e-04
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    45   4e-04
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    45   4e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    44   8e-04
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    44   0.001
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    43   0.001
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    43   0.001
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    43   0.001
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    43   0.002
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    43   0.002
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    42   0.002
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    41   0.005
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    41   0.006
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    41   0.006
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    40   0.008
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    40   0.009
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    40   0.010
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    40   0.011
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    40   0.013
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    40   0.016
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    39   0.027
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    39   0.029
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    39   0.039
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    37   0.10 
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    37   0.12 
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    35   0.29 
Kwal_27.10657 s27 complement(437681..439069) [1389 bp, 462 aa] {...    35   0.34 
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    34   0.93 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    34   0.93 
TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON}               32   4.2  

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/492 (100%), Positives = 492/492 (100%)

Query: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60
           MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN
Sbjct: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60

Query: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120
           FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP
Sbjct: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420
           AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420

Query: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480
           EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD
Sbjct: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480

Query: 481 QWVVPENMVGPK 492
           QWVVPENMVGPK
Sbjct: 481 QWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/492 (90%), Positives = 470/492 (95%)

Query: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60
           MFK+T E ANK+L    K RLISTSS++ QK RVETDAFGEI VP DK WGAQTQRSLEN
Sbjct: 1   MFKVTTEAANKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLEN 60

Query: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120
           FKIGG RERMPEP+V+AFGILKKSAAIVNESLGTLDPK+SKPIQ AADEVISGKL+DHFP
Sbjct: 61  FKIGGQRERMPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFP 120

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAI++VGG++G+KSIHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTE+TH LLPEL ALRD+FA K++EF+SIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG
Sbjct: 181 AVTEVTHLLLPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           ISRVE SL +LKFLAQGGTAVGTGLNTKVGF EKIAEQVSKETGIDFKTAPNKFEALAAH
Sbjct: 241 ISRVEHSLHNLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420
           AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSS+RLLGDACYSFRVHCV+GI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGI 420

Query: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480
           +AN DKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALEL VL+SAEFD
Sbjct: 421 QANEDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFD 480

Query: 481 QWVVPENMVGPK 492
           +WVVPENMVGPK
Sbjct: 481 EWVVPENMVGPK 492

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/493 (88%), Positives = 463/493 (93%), Gaps = 2/493 (0%)

Query: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQ-KCRVETDAFGEINVPADKYWGAQTQRSLE 59
           M ++TA  AN++L  S   R++STSS+++Q K R+ETDAFGEI VPADKYWGAQTQRS E
Sbjct: 1   MLRITA-AANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFE 59

Query: 60  NFKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHF 119
           NFKIGGARERMPE VVRAFG+LKKSAAIVNESLGTLDP+ISKPIQ+AADEVI GKL+DHF
Sbjct: 60  NFKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHF 119

Query: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHI 179
           PLVVFQTGSGTQSNMNANEVISNRAIEI+GG+ G+K +HPNNHCNQAQSSNDTFPSVMHI
Sbjct: 120 PLVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHI 179

Query: 180 AAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239
           AAVTEITHSLLPELTALRDSF  KS EF SIVKIGRTHLQDATPLTLGQEFSGYVQQLTN
Sbjct: 180 AAVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTN 239

Query: 240 GISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAA 299
           GI+RVEQSL HLKFLAQGGTAVGTGLNTKVGF EKIAEQVSKETGIDFKTAPNKFEALAA
Sbjct: 240 GIARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAA 299

Query: 300 HDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359
           HDA+VECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN
Sbjct: 300 HDAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQN 359

Query: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDG 419
           EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLL DA YSFRVHCVDG
Sbjct: 360 EAMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDG 419

Query: 420 IEANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEF 479
           I+AN D+I+KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESAL+L VL   EF
Sbjct: 420 IKANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEF 479

Query: 480 DQWVVPENMVGPK 492
           D+WV+PE M+GPK
Sbjct: 480 DEWVIPEKMIGPK 492

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/491 (84%), Positives = 453/491 (92%), Gaps = 4/491 (0%)

Query: 1   MFKLTAEVANKSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLEN 60
           MF  + ++  K ++     R++ST++ ++QK R+ETDAFGEI VPA+KYWGAQTQRSLEN
Sbjct: 1   MFSASKKIPAKRIA----DRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLEN 56

Query: 61  FKIGGARERMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFP 120
           FKIGG RERMPEP+++AFGILKKSAAIVNESLGTLDPKISKPIQQAADEVI GKL+DHFP
Sbjct: 57  FKIGGPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFP 116

Query: 121 LVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIA 180
           LVVFQTGSGTQSNMNANEVISNRAIE++GG++GTK IHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 117 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIA 176

Query: 181 AVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240
           AVTEIT++LLPELTALRDSF  K++EF  IVKIGRTHLQDATPLTLGQEF GY QQ+TNG
Sbjct: 177 AVTEITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNG 236

Query: 241 ISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
           I+RVEQSL HLKFLAQGGTAVGTGLNTKVGF EKIAEQVSKET I+FKTAPNKFEALAAH
Sbjct: 237 ITRVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAH 296

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
           DA+VECSGALNT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 297 DAVVECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 356

Query: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGI 420
           AMTQ CVQVMGNN+ ITFAGASGQFELNVFKPVMISNLL+S+RLL DA YSFRVHCVDGI
Sbjct: 357 AMTQACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGI 416

Query: 421 EANRDKIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFD 480
           +AN DKIAK+LHESLMLVTALNPKIGYD+A KVAKNAHKK ITLKESALEL VL+  EF 
Sbjct: 417 KANEDKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFS 476

Query: 481 QWVVPENMVGP 491
           +WVVPE M+GP
Sbjct: 477 EWVVPEKMIGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/460 (87%), Positives = 434/460 (94%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           RVETDAFGEI VP+DKYWGAQTQRSL+NFKIGG RERMPEP+V+AFG+LKKSAA+VNE L
Sbjct: 32  RVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERL 91

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           GTLDP+I+KPI+QAADEV  GKL++HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG++
Sbjct: 92  GTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 151

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEITH LLPEL  L+ +   KS EF+ IVK
Sbjct: 152 GSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVK 211

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+QSL HLKFLAQGGTAVGTGLNTKVGF 
Sbjct: 212 IGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFA 271

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
           E IAEQVSKETGIDFKTAPNKFEALAAHDA+VE SGALNTLA SLFKIANDIRYLGSGPR
Sbjct: 272 EDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPR 331

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AAITFAGASGQFELNVFKP
Sbjct: 332 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKP 391

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMISNLLSS+RLLGDA  SFR+HCV+GI+AN D+IAKLLHESLMLVTALNPKIGYDAASK
Sbjct: 392 VMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASK 451

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLKESALELKVL+S EFDQWV+PE M+GPK
Sbjct: 452 VAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPK 491

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/460 (87%), Positives = 430/460 (93%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           RVETDAFGEI V AD+YWGAQTQRSLENF+IGG RERMPEP+VRAFG+LKKSAA+VNESL
Sbjct: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           GTLDPK+++PI+QAADEV  GKL  HFPLVVFQTGSGTQSNMNANEVISNRAIE++GG++
Sbjct: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPEL  LRDS   KSKEF  IVK
Sbjct: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ++NGI RVE SL  LK+LAQGGTAVGTGLNTK+GF 
Sbjct: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
           EKIAEQVSKETG+DFKTAPNKFEALAAHDA+VE SGALNT+ACSLFKIA DIRYLGSGPR
Sbjct: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAGASGQFELNVFKP
Sbjct: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMISNLLSSVRLL DA YSFRVHCVDGI ANRD+I KL+HESLMLVTALNPKIGYDAASK
Sbjct: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLK+SAL+L VLT +EFD+WVVPENM+GPK
Sbjct: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/459 (86%), Positives = 426/459 (92%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           R+ETD FGEI VPADKYWGAQTQRS ENFKIGG RERMPEPVV+AFG+LKKSAAIVNE  
Sbjct: 8   RLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEEF 67

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           G LD  ISK IQQAADEVI GKL +HFPLVVFQTGSGTQSNMNANEVISNRAIE+ GG M
Sbjct: 68  GILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGIM 127

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K IHPNNHCN AQSSNDTFP+VMHIAAVTEITH L+P++T L+D+ A KSKEFE IVK
Sbjct: 128 GSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIVK 187

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E SLI+LKFLAQGGTAVGTGLNTK+GF 
Sbjct: 188 IGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGFA 247

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
           E+IAEQVSKETGI+FKTAPNKFEALAAHDAIVE SGALNT+ACSLFKIA DIRYLGSGPR
Sbjct: 248 ERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGPR 307

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP
Sbjct: 308 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 367

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMISNLLSS+RLLGDAC+SF +HCV+GI+AN DKI KLLHESLMLVTALNPKIGYD+A+K
Sbjct: 368 VMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSATK 427

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPE M+GP
Sbjct: 428 VAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/478 (83%), Positives = 434/478 (90%), Gaps = 1/478 (0%)

Query: 14  SGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEP 73
           S   KT LI  S+ +    RVETD FGEI VPADKYWGAQTQRS +NFKIGGARERMPEP
Sbjct: 5   SSRAKTSLIGYSARMMH-YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEP 63

Query: 74  VVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSN 133
           +VRAFG+LKKSAAIVNE LGTLD +I+ PIQQAADEV  GKL DHFPLVVFQTGSGTQSN
Sbjct: 64  IVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSN 123

Query: 134 MNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPEL 193
           MNANEVISNRAIE++GG++G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT+SLLPE+
Sbjct: 124 MNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEI 183

Query: 194 TALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKF 253
           T L+D+   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E +L HLK+
Sbjct: 184 TQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKY 243

Query: 254 LAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTL 313
           LAQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDAIVE SGALNT+
Sbjct: 244 LAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTV 303

Query: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373
           ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN
Sbjct: 304 ACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 363

Query: 374 AAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHE 433
           AA+TFAGA+GQFELNVFKPVMISNLLSS+RLL DAC+SFRVHCV+GIEANR+KI   LH 
Sbjct: 364 AAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHN 423

Query: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491
           SLMLVTALNPKIGYDAASK+AKNA KK ITLKESALELK LTS EFD+WV+PENMVGP
Sbjct: 424 SLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/477 (83%), Positives = 434/477 (90%), Gaps = 1/477 (0%)

Query: 16  SPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVV 75
           S   RL+ST+ A  Q+ RVETDAFGEI VPADKYWGAQTQRSLENF+IGGARERMPEPVV
Sbjct: 12  SAARRLMSTAGA-PQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVV 70

Query: 76  RAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMN 135
           RAFG+LKKSAA+VNE LGTL+P I+K IQQAADEV  G+L++HFPLVVFQTGSGTQSNMN
Sbjct: 71  RAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMN 130

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANEVISNRAIE++GG++G+K +HPNNHCNQAQSSNDTFPSVMHIAAVTEIT SLLPEL A
Sbjct: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           LR SF  K+ EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVE +   L+FLA
Sbjct: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250

Query: 256 QGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLAC 315
           QGGTAVGTGLNT+ GF E+IA QVS+ETG++F+TAPNKFEALAAHDA+VE SGALNTLAC
Sbjct: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLAC 310

Query: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375
           SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA
Sbjct: 311 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA 370

Query: 376 ITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESL 435
           ITFAGASGQFELNVFKPVMI+NLLSSVRLL DA  SFRVHCVDGI+ N D+IAKLLHESL
Sbjct: 371 ITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESL 430

Query: 436 MLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           MLVTALNPKIGYDAAS VAKNAHKKGITL+ SALEL VLT AEFD+WVVPE M+GP+
Sbjct: 431 MLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/475 (78%), Positives = 430/475 (90%)

Query: 18  KTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRA 77
           +  L +T++A  Q+ R+ETD+FGEI VPADKYWGAQTQRS +NFKIGG+RER+P+P++ A
Sbjct: 18  RMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITA 77

Query: 78  FGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNAN 137
           FGILKKSAAIVNESLGTLDPK++ PI++AADEV+ GKL DHFPLVVFQTGSGTQ+NMN N
Sbjct: 78  FGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVN 137

Query: 138 EVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALR 197
           EVISNRAIE+VGGK+G+K IHPNNHCNQ+QSSNDTFPSVMHIAAV EIT+SL+PELT L+
Sbjct: 138 EVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLK 197

Query: 198 DSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQG 257
           D+   K+KEF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI R+E SL HLKFLAQG
Sbjct: 198 DALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQG 257

Query: 258 GTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSL 317
           GTAVGTGLNTK+GF + IAE+VSKETGI+FKTAPNKFEALAAHDAIV  SGALNT+A SL
Sbjct: 258 GTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSL 317

Query: 318 FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAIT 377
           FKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  I+
Sbjct: 318 FKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTIS 377

Query: 378 FAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLML 437
            AG+ GQFELNV+KP+MI+NLL+S+RL+ DAC SFR+HC+D ++AN+DKI + L++SLML
Sbjct: 378 IAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLML 437

Query: 438 VTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VTALNPKIGYDAASK+AKNAH K ITLKESALELK LT+ EFD+WVVPENM+GPK
Sbjct: 438 VTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/474 (81%), Positives = 422/474 (89%), Gaps = 4/474 (0%)

Query: 18  KTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRA 77
           +TR IS         RVETD FGEI VPA+KYWGAQT+RS ENFKIGG+RERMPE VVRA
Sbjct: 14  QTRYISNLKGF----RVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRA 69

Query: 78  FGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNAN 137
           FG+LKK AAIVN  LG LDP  SK IQQAADEV +GKL DHFPLVVFQTGSGTQSNMNAN
Sbjct: 70  FGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNAN 129

Query: 138 EVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALR 197
           EVISNRAIE+ GG +G+K IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  LLPELT LR
Sbjct: 130 EVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLR 189

Query: 198 DSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQG 257
           D+ A KS EFE IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E++  +L+FLAQG
Sbjct: 190 DALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQG 249

Query: 258 GTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSL 317
           GTAVGTGLNTK G+ E+IA ++SKETG+ FKTAPNKFEALAAHDAIVE SGALNT+ACSL
Sbjct: 250 GTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSL 309

Query: 318 FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAIT 377
           FKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+T
Sbjct: 310 FKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVT 369

Query: 378 FAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLML 437
           FAGASGQFELNVFKPV+ISNLLSSV+LLGDA  SFRVHCV+GI+AN  KI++LLH SLML
Sbjct: 370 FAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLML 429

Query: 438 VTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491
           VTALNPKIGYDAA+KVAKNAHKKGITLKESALEL VLT  EFD+WVVPE M+GP
Sbjct: 430 VTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/460 (83%), Positives = 418/460 (90%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           R+ETDAFGEINVPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAA+VNESL
Sbjct: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           G LDPKISK IQQAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K +HPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PELT L+++   KSKEFE IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
            KIAEQ+S ETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMI+NLL+S+RL+ D+ YSFRVHCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPENM+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  803 bits (2074), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/460 (83%), Positives = 417/460 (90%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           R ETDAFGEINVPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAAIVNESL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           G LDPKISK IQ+AADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 89  GGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K +HPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PEL  L+++   KSKEF+ IVK
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVK 208

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
            KIAEQ+SKETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMI+NLL+S+RL+ DA YSFRVHCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPENM+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/460 (83%), Positives = 418/460 (90%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           R ETDAFGEI+VPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAAIVNESL
Sbjct: 29  RTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           G LDPKISK IQQAADEV SGKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 89  GGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K +HPNNHCNQ+QSSNDTFP+VMHIAA  +I + L+PELT L+++   KSKEF+ IVK
Sbjct: 149 GSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIVK 208

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  SL  L FLAQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
            KIAEQ+SKETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITFAG+ GQFELNVFKP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMI+NLL+S+RL+ DA YSFRVHCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPE+M+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/481 (79%), Positives = 426/481 (88%), Gaps = 2/481 (0%)

Query: 14  SGSPKTRL--ISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMP 71
           S +P +++  + T++   Q+ RVETDAFGEI VPADKYWGAQTQRS ENF+IGG RERMP
Sbjct: 24  SKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMP 83

Query: 72  EPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQ 131
           E VV AFGILKK+ A VNE+ G LDPK++  I+QAADEV SGKL DHFPLVVFQTGSGTQ
Sbjct: 84  EAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQ 143

Query: 132 SNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLP 191
           SNMNANEVISNRAIE++GGK+G+KS+HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP
Sbjct: 144 SNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLP 203

Query: 192 ELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHL 251
            LTAL+DS   KS+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RVE +L  L
Sbjct: 204 NLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSL 263

Query: 252 KFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALN 311
           K LAQGGTAVGTGLNTK+G+ E +A +V+KETGIDF+TAPNKFEALAAHDA+VE SGALN
Sbjct: 264 KLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALN 323

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           TLA SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQVCVQV G
Sbjct: 324 TLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFG 383

Query: 372 NNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLL 431
           N++AITFAGASGQFELNVFKPVMISNLLSS+ LL DA YSFRVHCVDGI+ANR+ IAKLL
Sbjct: 384 NHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLL 443

Query: 432 HESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491
           HESLMLVTALNPKIGYDAASKVAKNAHK GITLKESAL+L +LT+ EFD WVVPE+M+GP
Sbjct: 444 HESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

Query: 492 K 492
           K
Sbjct: 504 K 504

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/460 (82%), Positives = 414/460 (90%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           R ETDAFGEINVPADKYWGAQTQRS +NFKIGGARERMP P+V AFG+LKKSAAIVNESL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           G LDPK+SK IQQAADEV +GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEI+GGK+
Sbjct: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K +HPNN CNQ+QSSNDTFP+VMHIAA  +I   L+PELT L+++   KSKEFE IVK
Sbjct: 149 GSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV  +L  L FLAQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
            KIAEQ+SKETG+ F+TAPNKFEALAAHDAIVECSGALNTLACSLFKIA DIRYLGSGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAAITF G+ GQFELNVFKP
Sbjct: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           VMI+NLL+S+RL+ DA  SFR+HCV+GI+AN  +I +LL +SLMLVTALNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           VAKNAHKKGITLKESALEL VLT  EFD+WVVPENM+GPK
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/484 (77%), Positives = 427/484 (88%), Gaps = 2/484 (0%)

Query: 11  KSLSGSPKTRLISTSSAISQKC--RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARE 68
           KS++   KT +  +   +S +   R+ETD FGEI VPA+KYWGAQT+RS ENF+IGG RE
Sbjct: 13  KSVAKVQKTGMHQSMRCLSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRE 72

Query: 69  RMPEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGS 128
           RMP+PVV+AFG+LKKSAAIVNE  GTLDP+ISK IQ+AADEVI GKL DHFPLVVFQTGS
Sbjct: 73  RMPDPVVKAFGVLKKSAAIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGS 132

Query: 129 GTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHS 188
           GTQSNMNANEVISNRAIE++GG +G+K +HPNNH NQAQSSND+FP+VMHIAAVTEIT  
Sbjct: 133 GTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDH 192

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+PE+  LRD+  +KSK+F  IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGI R+E SL
Sbjct: 193 LIPEVANLRDALESKSKDFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSL 252

Query: 249 IHLKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSG 308
           I+LKFLAQGGTAVGTGLNT++GF EKIAEQ+SKETG+ FKTAPNKFEALAAHDAIVE SG
Sbjct: 253 INLKFLAQGGTAVGTGLNTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASG 312

Query: 309 ALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 368
           A+ T+A SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQVC Q
Sbjct: 313 AITTVATSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQ 372

Query: 369 VMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIA 428
           ++GNN  I FAG  GQFELNVFKPVMISNLLSS+RLLGD   SFR+HCV+GI+AN ++IA
Sbjct: 373 IIGNNQTIIFAGTQGQFELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIA 432

Query: 429 KLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENM 488
            L+++SLMLVTALNPKIGYD A+KVAKNAHKKGITLKESA++L  LT +EFD+WVVPE M
Sbjct: 433 DLMNKSLMLVTALNPKIGYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKM 492

Query: 489 VGPK 492
           +GPK
Sbjct: 493 IGPK 496

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/473 (78%), Positives = 419/473 (88%)

Query: 20  RLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFG 79
           R +S S+  +Q+ RVETD+FGEINVPAD+YWGAQTQRS +NFKIGG RE++PEPVVRAFG
Sbjct: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84

Query: 80  ILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEV 139
           ILKKSAA VNE+LGTLD  I+  I+ AADEV  GKL DHFPLVVFQTGSGTQSNMNANEV
Sbjct: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144

Query: 140 ISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDS 199
           ISNRAIE++GG++G+K +HPNNH NQ+QSSNDTFP+VMHIAA TEI + L+PEL  L+D+
Sbjct: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204

Query: 200 FATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGT 259
              K +EF SIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RV+ SL HL FLAQGGT
Sbjct: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264

Query: 260 AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFK 319
           AVGTGLNTKVGF + +AE+VSKETG+ F+TAPNKFEALAAHDAIVE SGALNTLACSLFK
Sbjct: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324

Query: 320 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFA 379
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ ITFA
Sbjct: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384

Query: 380 GASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVT 439
           G+ GQFELNV+KP+MISNLLSS+RLL DA  SFR+HC++ ++AN+DKI + L++SLMLVT
Sbjct: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444

Query: 440 ALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           ALNPKIGYDAA+KVAKNAH K ITLKESALEL VLT  EFD+WV+PENM+ PK
Sbjct: 445 ALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/474 (77%), Positives = 417/474 (87%)

Query: 19  TRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAF 78
           T    T S+I    R ETD+FGEINVP DKYWGAQTQRSL+NFKIGG RE++P P++ AF
Sbjct: 21  TSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAF 80

Query: 79  GILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANE 138
           GILKKSAAIVNE LGTLD +++K I  AADEV  GKL DHFPLVVFQTGSGTQSNMNANE
Sbjct: 81  GILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANE 140

Query: 139 VISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRD 198
           VISNRAIE++GGK+G+K++HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPEL +L++
Sbjct: 141 VISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKN 200

Query: 199 SFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGG 258
           S   KS EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+TNGI R+E +L HLKFLAQGG
Sbjct: 201 SLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGG 260

Query: 259 TAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLF 318
           TAVGTGLNTK GF + IAEQ+S+ETGI+F+TAPNKFEALAAHDAIVE SGALNTLACSLF
Sbjct: 261 TAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLF 320

Query: 319 KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITF 378
           KIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++ ITF
Sbjct: 321 KIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITF 380

Query: 379 AGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLV 438
           AG+ GQFELNV+KP++ISNLLSS+RLL DA YSFRVHC+DG++ANR+ I + L++SLMLV
Sbjct: 381 AGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLV 440

Query: 439 TALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           TALNP IGYD ASK+AKNAH K ITLKESALEL +LT  +F +WV+PE M+GPK
Sbjct: 441 TALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/461 (75%), Positives = 408/461 (88%)

Query: 31  KCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNE 90
           + R+E D FGE+ VPA+KYWGAQTQR+L NF IGG RERMPEP++ A+GILKKS AIVNE
Sbjct: 3   ETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNE 62

Query: 91  SLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGG 150
           SLGTLDPKISK IQ+AADEV  G L +HFPLVVFQTGSGTQ+NMN NEVISNRAIEI+GG
Sbjct: 63  SLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGG 122

Query: 151 KMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESI 210
           ++G+K++HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPEL  LRD+   KS EF  I
Sbjct: 123 QLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKI 182

Query: 211 VKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVG 270
           VKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI+RV+ SL +LKF+AQGGTAVGTG+NTK  
Sbjct: 183 VKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKD 242

Query: 271 FGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSG 330
           F   +A+Q+S ETGI+FKTAPNKFEALA+HDAIVECSGALNTLACSLFKI+ DIR+LGSG
Sbjct: 243 FDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSG 302

Query: 331 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 390
           PRCGYGELSLPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+AITFAGASGQFELN +
Sbjct: 303 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTY 362

Query: 391 KPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAA 450
           KP+MISNLL+S+RLL D+C SFR+HC+ GI AN DKI KLL+ESLMLVTALNPKIGYDAA
Sbjct: 363 KPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAA 422

Query: 451 SKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491
           + +AK+AHK G+TLKE+AL+ K+LT+ +FD+W+VPE+MV P
Sbjct: 423 TAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 413/460 (89%)

Query: 33  RVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVVRAFGILKKSAAIVNESL 92
           RVETD+FGEI VP++KYWGAQTQRS +NFKIGG RE++P P+++AFGILKKSAAIVN+SL
Sbjct: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74

Query: 93  GTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKM 152
           GTLDP I+ PI +A+DEVI GKL DHFPLVVFQTGSGTQ+NMNANEVISNRA E++G ++
Sbjct: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134

Query: 153 GTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVK 212
           G+K IHPNNH NQ+QSSNDTFPSVMHIAAV E+ ++L+P+LT L++S   K+KE+ +IVK
Sbjct: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194

Query: 213 IGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFG 272
           IGRTHLQDATPLTLGQEFSGYVQQLTNGI R++ SL HLKFLAQGGTAVGTGLNTKVGF 
Sbjct: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254

Query: 273 EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPR 332
           + IA++VSKETGIDF+TAPNKFEALAAHDAIV  S A+ T+A SLFKIA DIRYLGSGPR
Sbjct: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314

Query: 333 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFKP 392
           CGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  I  AG+ GQFELNV+KP
Sbjct: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374

Query: 393 VMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESLMLVTALNPKIGYDAASK 452
           +MI+NLL+S+RL+ DAC+SF++HCVDG++AN DKI + LH+SLMLVTALNPKIGYDAASK
Sbjct: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434

Query: 453 VAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492
           +AKNAH K ITLKESALEL +LT  EFDQWV+PENM+GPK
Sbjct: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/481 (72%), Positives = 409/481 (85%), Gaps = 4/481 (0%)

Query: 11  KSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERM 70
           +S S +P    +S S A  Q  R ETD+FGEI VPA+KYWGAQTQRS  NFKIGG RERM
Sbjct: 23  RSFSITP----VSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERM 78

Query: 71  PEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGT 130
           PEP++RAFG  KK+AAIVN SLGTLD  +   I QAA+EV  G L +HFPLVVFQTGSGT
Sbjct: 79  PEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGT 138

Query: 131 QSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLL 190
           QSNMNANEVISNRAIE++GG +G+K +HPNNH NQ+QSSNDTFP+VMHIAA+TEIT++LL
Sbjct: 139 QSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLL 198

Query: 191 PELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIH 250
           P L  LR++  +K+KEFE I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E++L  
Sbjct: 199 PNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPE 258

Query: 251 LKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGAL 310
           L+++AQGGTAVGTGLNTK+GF E+ A Q+S +T + F T+PNKFE+LAAHDAIV    +L
Sbjct: 259 LQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASL 318

Query: 311 NTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 370
           NTLACSLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVM
Sbjct: 319 NTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVM 378

Query: 371 GNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKL 430
           GNN+ I+FAGASGQFELN +KP+MI+NLLSS RLL DA +SF +HC  GI+AN+DKI +L
Sbjct: 379 GNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRL 438

Query: 431 LHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVG 490
           LHESLMLVT+LNPKIGYDAASKVAKNAH KGITLK+SALEL +L+S +FD+WV PENM+G
Sbjct: 439 LHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLG 498

Query: 491 P 491
           P
Sbjct: 499 P 499

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 108/278 (38%), Gaps = 36/278 (12%)

Query: 98  KISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSI 157
           K+   ++Q   E  +G+   H            +    ANE    R  EI+G ++  K  
Sbjct: 63  KVHHGLEQIEKEWAAGEFARH---------PSDEDIHTANE---RRLGEIIGREISGK-- 108

Query: 158 HPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTH 217
                 +  +S ND   + M I     +   LLP L A      T++KE   ++  G TH
Sbjct: 109 -----VHTGRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAKEEIDVLMPGYTH 163

Query: 218 LQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAE 277
           LQ A P+      S Y    T   +R++Q +  L       + +G G      +G     
Sbjct: 164 LQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLN-----KSPLGAGALAGHPYG----- 213

Query: 278 QVSKE---TGIDFK-TAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRC 333
            + +E    G+ F+    N   A++  D +VE           + + + D+  + S    
Sbjct: 214 -IDREFLARGLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL-IIYSTAEF 271

Query: 334 GYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 272 GFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 99/245 (40%), Gaps = 27/245 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + M I     +  ++LP L++
Sbjct: 90  ANE---RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALSS 139

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      +++E   ++  G THLQ A P+      S Y    T    R++Q +  L    
Sbjct: 140 LIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNV-- 197

Query: 256 QGGTAVGTGLNTKVGFGEKIAEQVSKE---TGIDFK-TAPNKFEALAAHDAIVECSGALN 311
              + +G G      +G      + +E    G++F     N   A+A  D +VE     +
Sbjct: 198 ---SPLGAGALAGHPYG------IDREFLAAGLNFNGVIGNSLTAVADRDFVVEIMFWGS 248

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 249 LFMNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

Query: 372 NNAAI 376
             A  
Sbjct: 307 QLAGF 311

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 97/241 (40%), Gaps = 27/241 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + + I     +   L P LT+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      + +E   I+  G THLQ A P+      S Y    T  ++R++Q L+      
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRF---- 196

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFK-TAPNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G++F     N   A++  D +VE      
Sbjct: 197 -NKSPLGAGALAGHPYGIDREFLAE------GLEFNGVIGNSLVAVSDRDFVVELMFWST 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 N 372
           +
Sbjct: 308 D 308

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 93/241 (38%), Gaps = 19/241 (7%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + + I     +   L P+L A
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L D    + KE   ++  G THLQ A P+      S Y    T    R+ Q +  +    
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN--- 197

Query: 256 QGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLAC 315
              + +G G      +G    E ++   G D     N   A++  D IVE          
Sbjct: 198 --QSPLGAGALAGHPYGID-REFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMN 253

Query: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375
            + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

Query: 376 I 376
            
Sbjct: 312 F 312

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 95/241 (39%), Gaps = 27/241 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L D    ++K   +I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTA-PNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G+ F +   N   A++  D IVE      
Sbjct: 198 --QSPLGAGALAGHPYGIDREFLAE------GLGFNSVIGNSMVAVSDRDFIVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 N 372
           +
Sbjct: 308 D 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 97/245 (39%), Gaps = 27/245 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + + I     +   L P +T+
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L +    +++E   I+  G THLQ A P+      S Y    T  + R++Q L       
Sbjct: 141 LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFK-TAPNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G+ F     N   A++  D +VE      
Sbjct: 198 --KSPLGAGALAGHPYGIDREFLAE------GLGFDGVIGNSLVAVSDRDFVVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 NNAAI 376
           + A  
Sbjct: 308 DLAGF 312

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 106/275 (38%), Gaps = 30/275 (10%)

Query: 98  KISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSI 157
           KI   ++   +E   GK V H            +S+ + +     R  E++G  +  K  
Sbjct: 63  KIHSGLKDIENEWDEGKFVRH------------ESDEDIHTANERRLGELIGRDIAGK-- 108

Query: 158 HPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTH 217
                 +  +S ND   + M I     +   + P + +L +    ++++   I+  G TH
Sbjct: 109 -----VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPGYTH 163

Query: 218 LQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVGTGLNTKVGFGEKIAE 277
           LQ A P+      S Y    T  + R+EQ    L       + +G+G      +G  I  
Sbjct: 164 LQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLN-----KSPLGSGALAGHPYG--IDR 216

Query: 278 QVSKETGIDFK-TAPNKFEALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYG 336
           Q   E G+ F     N   A++  D +VE           + + + D+  + S    G+ 
Sbjct: 217 QFLAE-GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDL-IIYSTAEFGFI 274

Query: 337 ELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
           +LS      GSS+MP K N    E +     +V G
Sbjct: 275 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 113/288 (39%), Gaps = 40/288 (13%)

Query: 92  LGTLDPK----ISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNRAIEI 147
           +G LD +    I K + +   E  SGK  +H            +    ANE    R  E+
Sbjct: 52  IGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGEL 99

Query: 148 VGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSFATKSKEF 207
           +G  +  K        +  +S ND   + M I     +   +LP +++       +++E 
Sbjct: 100 IGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE 152

Query: 208 ESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTAVG---TG 264
             ++  G THLQ A P+      S Y    T   +R+ Q +  L     G  A+     G
Sbjct: 153 VDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPYG 212

Query: 265 LNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIANDI 324
           ++ K      +AEQ+    GI      N   A++  D ++E     +     + + A D+
Sbjct: 213 IDRKY-----LAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDL 262

Query: 325 RYLGSGPRCGYGELSLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
               +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 263 IIYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 86/186 (46%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 85/186 (45%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
             +      GT        A+  G + KV   E + E+V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDERVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 90/194 (46%), Gaps = 35/194 (18%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + +  +T + +++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             + F    GT        A+  G + KV   E + ++V++ +G D       +T   K 
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKV---EALDKRVAELSGFDIIYPVTGQTYSRKV 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 352
           +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  
Sbjct: 245 D--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAY 291

Query: 353 KVNPTQNEAMTQVC 366
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 112/296 (37%), Gaps = 32/296 (10%)

Query: 81  LKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVI 140
           L+K+  +  + L +    I + ++Q   E   G  V H            +    ANE  
Sbjct: 49  LQKTGLLTKDELES----IHEGLKQVEQEWEQGVFVKHVD---------DEDIHTANE-- 93

Query: 141 SNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTALRDSF 200
             R  EI+G        H +   +  +S ND   + M +     +   + P L  L    
Sbjct: 94  -RRLGEIIGR-------HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVL 145

Query: 201 ATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLAQGGTA 260
             +++E   ++  G THLQ A P+      S Y         R+++ +  L       + 
Sbjct: 146 LHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN-----QSP 200

Query: 261 VGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKI 320
           +G G      +G    E ++ E G D     N   A++  D +VE     +     + ++
Sbjct: 201 LGAGALAGHPYGID-REYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISRL 258

Query: 321 ANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAI 376
           A D+  + S    G+ +L+      GSS+MP K NP   E +     +V G  A  
Sbjct: 259 AEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGF 312

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 93/241 (38%), Gaps = 27/241 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E++G  +  K        +  +S ND   + + I     +  SL P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L D    +++    I+  G THLQ A P+      S Y    T    R+ Q L  L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTA-PNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G+ F +   N   A++  D IVE      
Sbjct: 198 --QSPLGAGALAGHPYGIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 N 372
           +
Sbjct: 308 D 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 94/245 (38%), Gaps = 27/245 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + M I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMAD 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      +++     +  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141 LIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSP 200

Query: 256 QGGTAVG---TGLNTKVGFGEKIAEQVSKETGIDF-KTAPNKFEALAAHDAIVECSGALN 311
            G  A+     G++      E +AE      G++F     N   A++  D +VE      
Sbjct: 201 LGAGALAGHPYGIDR-----EFLAE------GLNFGGVIGNSLVAVSDRDFVVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 NNAAI 376
           + A  
Sbjct: 308 DLAGF 312

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 94/244 (38%), Gaps = 25/244 (10%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + M I     +   LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      ++++    +  G THLQ A P+      S Y    T  + R+ Q L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNT 312
              + +G G      +G   E +AE++  +  I      N   A++  D +VE       
Sbjct: 198 --QSPLGAGALAGHPYGIDREFLAEELGFQGVI-----GNSLVAVSDRDFVVELMFWGTL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
               + + A D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 373 NAAI 376
            A  
Sbjct: 309 LAGF 312

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
             +      GT        A+  G + KV   E +  +V++  G D K  P   +   + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EALDARVTELLGFD-KVYPVTGQTY-SR 242

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 93/241 (38%), Gaps = 27/241 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E++G  +  K        +  +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L D    +++    I+  G THLQ A P+      S Y    T    R+ Q L  L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTA-PNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G+ F +   N   A++  D IVE      
Sbjct: 198 --QSPLGAGALAGHPYGIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 N 372
           +
Sbjct: 308 D 308

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             L      GT        A+  G + KV   E++ E+V++  G D       +T   K 
Sbjct: 188 NDLGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 95/213 (44%), Gaps = 33/213 (15%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  A  + E++ +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E++ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC--VQVMGNNAAITFAGASGQF 385
           NP + E   +VC   + +G+  + T   AS Q+
Sbjct: 294 NPMRCE---RVCSLARHLGSLLSDTVQTASVQW 323

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 94/240 (39%), Gaps = 25/240 (10%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G K+  K        +  +S ND   + + I     ++  LL  L  
Sbjct: 91  ANE---RRLGEIIGTKISGK-------VHTGRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L +    +++E    +  G THLQ A P+      S Y         R+ Q    L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERL---- 196

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNT 312
              + +G G      +G   E +AE++  ++ I      N   A++  D +VE       
Sbjct: 197 -NKSPLGAGALAGHPYGIDREYLAEKLGFDSVI-----GNSLVAVSDRDFVVEILFWSTL 250

Query: 313 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 372
               + + A D+  + S    G+ +LS      GSS+MP K N    E +     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 90/237 (37%), Gaps = 21/237 (8%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  EI+G  +  K        +  +S ND   + + I     +   LLP +  
Sbjct: 91  ANE---RRLGEIIGTHIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMID 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      +++    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 141 LVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCP 200

Query: 256 QGGTAVGTGLNTKVGFGEKIAEQ-VSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLA 314
            G  A+        G    I  Q +S E G +     N   A++  D IV+         
Sbjct: 201 LGAGAIA-------GHPYGIDRQYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFM 252

Query: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
             + + + D+  + S    G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 253 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 93/245 (37%), Gaps = 27/245 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E++G  +  K        +  +S ND   + + I     I   LLP L +
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L      + +    I+  G THLQ A P+      S Y    T    R++Q L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNV-- 196

Query: 256 QGGTAVGTGLNTKVGFGEKIAEQVSKE---TGIDFK-TAPNKFEALAAHDAIVECSGALN 311
              + +G G      +G      + +E    G+ F     N   A++  D +VE      
Sbjct: 197 ---SPLGAGALAGHPYG------IDREFLANGLGFNGVIGNSLVAVSDRDFVVELLFWGT 247

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  + S    G+  LS      GSS+MP K N    E +     +V G
Sbjct: 248 LFMNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFG 305

Query: 372 NNAAI 376
           N + +
Sbjct: 306 NLSGL 310

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 87/194 (44%), Gaps = 35/194 (18%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPG 352
           +        ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAY 291

Query: 353 KVNPTQNEAMTQVC 366
           K NP + E   +VC
Sbjct: 292 KRNPMRCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  A  + E++ +  +G TH Q A   T+G+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKV---EALDKRVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 93/241 (38%), Gaps = 27/241 (11%)

Query: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195
           ANE    R  E++G  +  K        +  +S ND   + + I     +  +L P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255
           L +    +++    ++  G THLQ A P+      S Y    T    R+ Q L  L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLN--- 197

Query: 256 QGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTA-PNKFEALAAHDAIVECSGALN 311
              + +G G      +G   E +AE      G+ F +   N   A++  D IVE      
Sbjct: 198 --QSPLGAGALAGHPYGIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGT 249

Query: 312 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMG 371
                + + A D+  +      G+ +LS      GSS+MP K N    E +     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 372 N 372
           +
Sbjct: 308 D 308

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 82/189 (43%), Gaps = 25/189 (13%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + D  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGTAVGTG-----LNTKVGFGEKIAEQVSKETGIDF------KTAPNKFEAL 297
             +      GT    G      ++     E + ++V++  G D       +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 298 AAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPT 357
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPM 296

Query: 358 QNEAMTQVC 366
           + E   +VC
Sbjct: 297 RCE---RVC 302

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  +  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A S  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 83/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + +     +   + +  +G TH Q A   TLG+  + ++Q+L   +   E++ 
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   EK+ E+V +  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHNKV---EKLDERVVELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 82/186 (44%), Gaps = 19/186 (10%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + D  +  +  ++ +  +G TH Q A   TLG+  + ++Q L   +   +++ 
Sbjct: 128 IIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAH 300
             +      GT        A+  G + KV   E++ ++V++  G  F+T         + 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKV---EELDQRVTELLG--FETVYPVTGQTYSR 242

Query: 301 DAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360
              ++    L + A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 243 KIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

Query: 361 AMTQVC 366
              +VC
Sbjct: 300 ---RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + +  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 100/257 (38%), Gaps = 36/257 (14%)

Query: 124 FQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 183
           F    G +    ANE    R  EI+G  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 184 EITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISR 243
           E   ++   L  L  +   ++++    +  G THLQ A P+      + Y    T    R
Sbjct: 130 EALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 244 VEQSLIHLKFLAQGGTAVGTGLNTKVGFG---EKIAEQVSKETGIDFKTAPNKFEALAAH 300
           ++Q    L       + +G G      +G   E IAE++    G D     N  +A++  
Sbjct: 190 LKQIRERLNV-----SPLGCGALAGHPYGIDREHIAERL----GFD-GVIGNSLQAVSDR 239

Query: 301 DAIVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVN 355
           D +VE         CSLF     + + D+  + S     + +LS      GSS+MP K N
Sbjct: 240 DFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKN 292

Query: 356 PTQNEAMTQVCVQVMGN 372
           P   E +     +V G+
Sbjct: 293 PDSLELLRGKSGRVFGS 309

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 98/269 (36%), Gaps = 46/269 (17%)

Query: 124 FQTGSGTQSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVT 183
           F    G +    ANE    R  EI+G  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 184 EITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISR 243
           E   +L   L  L  +   +S++    +  G THLQ A P+      + Y    T    R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 244 VEQSLIHLKFLAQGGTAVG--------TGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFE 295
           ++Q    L     G  A+           L  ++GF + I                N  +
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQ 234

Query: 296 ALAAHDAIVECSGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIM 350
           A++  D +VE         CSLF     + + D+  + S     + +LS      GSS+M
Sbjct: 235 AVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLM 287

Query: 351 PGKVNPTQNEAMTQVCVQVMGNNAAITFA 379
           P K NP   E +     +V G+ A    +
Sbjct: 288 PQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 86/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + +  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGTAVGT---------GLNTKV-GFGEKIAEQVSKET--GIDFKTAPNKFEA 296
             +      GT  GT         G + KV    +++AE +   T   +  +T   K + 
Sbjct: 188 NDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKID- 245

Query: 297 LAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKV 354
                  ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K 
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  +  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L++ A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLSPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           L+P+L  + +  +  + +++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + KV   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKV---EALDKRVTELLGFDTVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++    L + A +  K+A DIR L +       E    +++ GSS M  K 
Sbjct: 245 D--------IDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 84/192 (43%), Gaps = 31/192 (16%)

Query: 189 LLPELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSL 248
           ++P+L  + +  +  + E++ +  +G TH Q A   TLG+  + ++Q+L   +    ++ 
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 249 IHLKFLAQGGT--------AVGTGLNTKVGFGEKIAEQVSKETGIDF------KTAPNKF 294
             +      GT        A+  G + +V   E + ++V++  G D       +T   K 
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRV---EALDKRVTELLGFDIVYPVTGQTYSRKI 244

Query: 295 EALAAHDAIVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKV 354
           +        ++  G+ ++   +  K+A DIR L +       E    + + GSS M  K 
Sbjct: 245 D--------IDILGSGSSFEATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKR 293

Query: 355 NPTQNEAMTQVC 366
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kwal_27.10657 s27 complement(437681..439069) [1389 bp, 462 aa] {ON}
           YBL098W (BNA4) - YBL098W [contig 33] FULL
          Length = 462

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 62/161 (38%), Gaps = 28/161 (17%)

Query: 266 NTKVGFGEKIAE---QVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLACSLFKIAN 322
           N  + FG K++      SK+T + F T+P++       D IV C GA +T      ++  
Sbjct: 125 NITLKFGHKLSNIKFSDSKQTCV-FTTSPDQDTQTFDFDFIVGCDGAYSTTRS---QMQR 180

Query: 323 DIR--YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAG 380
           ++R  Y      C Y EL +P  +   +   GK   + N     + +   G    I  A 
Sbjct: 181 ELRMDYSQEYIDCCYIELYIPPAKGNDAAFDGKFAISPN----HLHIWPRGTYMLIALAN 236

Query: 381 ASGQFELNVFKP---------------VMISNLLSSVRLLG 406
             G F    F P                +ISN   +V L+G
Sbjct: 237 GDGSFTSTFFGPWSLIESLDTRDKIQEFLISNFPDAVDLIG 277

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 178 HIAAVTEITHSLLPELTALRDSFATKSKEFESIVKIGRTHLQ 219
           H   +T++  +   +LT L+D  AT+ KE E+ VK  RT LQ
Sbjct: 705 HEQQITQVKQTYNDQLTELQDKLATEEKELEA-VKRERTRLQ 745

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 6/92 (6%)

Query: 84  SAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMNANEVISNR 143
           S A+ ++ L   DP  +K + + +D+  SG     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 144 AIEIVGG-----KMGTKSIH-PNNHCNQAQSS 169
            +E   G     ++  KS H PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>TDEL0G04710 Chr7 (860069..861289) [1221 bp, 406 aa] {ON} 
          Length = 406

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%)

Query: 64  GGARERMP----EPVVRAFGILKKSAAIVNESLGTLDPKISKP 102
           GG + R+P     P+VR   +LK+ A  VNES      ++ KP
Sbjct: 281 GGVQRRLPTAHIHPLVRVHPVLKRKALFVNESFSRRIVELKKP 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,236,907
Number of extensions: 1914873
Number of successful extensions: 5344
Number of sequences better than 10.0: 67
Number of HSP's gapped: 5516
Number of HSP's successfully gapped: 67
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)