Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11440gna 1ON50850826840.0
Kwal_56.22367na 1ON51750817050.0
KLTH0B03806g5.184ON52250814190.0
Kwal_33.150415.184ON52251213700.0
SAKL0G13288g5.184ON54050312921e-174
Suva_8.434na 2ON52550010761e-141
Smik_6.2915.184ON53551210721e-141
YGR177C (ATF2)5.184ON53551210681e-140
YOR377W (ATF1)na 2ON52550910541e-138
Skud_15.544na 2ON52450910471e-137
Kpol_2002.895.184ON52351010441e-136
Smik_15.559na 2ON52450910421e-136
Suva_7.4705.184ON54652710111e-131
CAGL0D05918g5.184ON56450410081e-130
Skud_7.5075.184ON53551210011e-130
NCAS0A069205.184ON5185039901e-128
TPHA0E031705.184ON5345129911e-128
NDAI0D019805.184ON5385219831e-127
KAFR0D017305.184ON5345029691e-125
KNAG0H026505.184ON5445138681e-110
KLLA0F15202g5.184ON5175108251e-104
TBLA0G010106.17ON71095970.004
Suva_13.4728.848ON510135810.23
TPHA0H009605.119ON47648810.28
TDEL0E051105.119ON469494800.32
Skud_13.4558.848ON494126761.1
Kwal_27.98985.119ON460493742.0
SAKL0E06710g2.324ON634103732.7
KAFR0C043001.337ON184845732.9
Kpol_1032.835.247ON67787723.2
TDEL0A038705.523ON63787723.2
ADL293W2.324ON57749705.2
NDAI0D023605.119ON470191689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11440g
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {...  1038   0.0  
Kwal_56.22367 s56 (67552..69105) [1554 bp, 517 aa] {ON} YOR377W ...   661   0.0  
KLTH0B03806g Chr2 complement(309522..311090) [1569 bp, 522 aa] {...   551   0.0  
Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177...   532   0.0  
SAKL0G13288g Chr7 complement(1139419..1141041) [1623 bp, 540 aa]...   502   e-174
Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W ...   419   e-141
Smik_6.291 Chr6 complement(456731..458338) [1608 bp, 535 aa] {ON...   417   e-141
YGR177C Chr7 complement(848829..850436) [1608 bp, 535 aa] {ON}  ...   416   e-140
YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}  ATF1Alc...   410   e-138
Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377...   407   e-137
Kpol_2002.89 s2002 (209104..210675) [1572 bp, 523 aa] {ON} (2091...   406   e-136
Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377...   405   e-136
Suva_7.470 Chr7 complement(806476..808116) [1641 bp, 546 aa] {ON...   394   e-131
CAGL0D05918g Chr4 (563388..565082) [1695 bp, 564 aa] {ON} simila...   392   e-130
Skud_7.507 Chr7 complement(822986..824593) [1608 bp, 535 aa] {ON...   390   e-130
NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON} Anc_5...   385   e-128
TPHA0E03170 Chr5 complement(670756..672360) [1605 bp, 534 aa] {O...   386   e-128
NDAI0D01980 Chr4 (468576..470192) [1617 bp, 538 aa] {ON} Anc_5.184    383   e-127
KAFR0D01730 Chr4 complement(345374..346978) [1605 bp, 534 aa] {O...   377   e-125
KNAG0H02650 Chr8 (492038..493672) [1635 bp, 544 aa] {ON} Anc_5.1...   338   e-110
KLLA0F15202g Chr6 (1401627..1403180) [1554 bp, 517 aa] {ON} simi...   322   e-104
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...    42   0.004
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...    36   0.23 
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    36   0.28 
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    35   0.32 
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...    34   1.1  
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    33   2.0  
SAKL0E06710g Chr5 (548443..550347) [1905 bp, 634 aa] {ON} simila...    33   2.7  
KAFR0C04300 Chr3 complement(849932..855478) [5547 bp, 1848 aa] {...    33   2.9  
Kpol_1032.83 s1032 (178927..180960) [2034 bp, 677 aa] {ON} (1789...    32   3.2  
TDEL0A03870 Chr1 (687098..689011) [1914 bp, 637 aa] {ON} Anc_5.5...    32   3.2  
ADL293W Chr4 (187231..188964) [1734 bp, 577 aa] {ON} Syntenic ho...    32   5.2  
NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.1...    31   9.8  

>KLTH0C11440g Chr3 complement(940466..941992) [1527 bp, 508 aa] {ON}
           similar to uniprot|P53296 Saccharomyces cerevisiae
           YGR177C ATF2 Alcohol acetyltransferase may play a role
           in steroid detoxification forms volatile esters during
           fermentation which is important in brewing
          Length = 508

 Score = 1038 bits (2684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/508 (97%), Positives = 497/508 (97%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI
Sbjct: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI
Sbjct: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180
           EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG
Sbjct: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPI      
Sbjct: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPISYLLQL 240

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300
                VRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT
Sbjct: 241 LSSSYVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300

Query: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360
           PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY
Sbjct: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360

Query: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420
           NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD
Sbjct: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420

Query: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480
           DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV
Sbjct: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480

Query: 481 ACAAQGSVASEHDWADVCELFKEQTLAL 508
           ACAAQGSVASEHDWADVCELFKEQTLAL
Sbjct: 481 ACAAQGSVASEHDWADVCELFKEQTLAL 508

>Kwal_56.22367 s56 (67552..69105) [1554 bp, 517 aa] {ON} YOR377W
           (ATF1) - Alcohol acetyltransferase [contig 186] FULL
          Length = 517

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/508 (59%), Positives = 398/508 (78%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           ++ ++E GH R LGHLENYF++ QRQ LY+NFSM+C LS  C+P Q A ALR+IC+++PI
Sbjct: 10  LEKMEELGHVRRLGHLENYFALCQRQNLYSNFSMFCALSNSCTPSQFAAALRAICVEHPI 69

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           LVH V PK+WPNH+EYYAS+EF+  P L+HE MRLL+ V LSDIVMNEQ+EY   VS+ +
Sbjct: 70  LVHTVTPKNWPNHMEYYASEEFVNNPVLEHEKMRLLERVDLSDIVMNEQDEYSETVSKIL 129

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180
            EF+QNGG Y+++IFDIIA +RIPYGDP KPNWR LC PE     W KFI+I+NHCS DG
Sbjct: 130 AEFAQNGGIYTREIFDIIATVRIPYGDPTKPNWRFLCIPEKSGPNWNKFIFISNHCSMDG 189

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
            SA+NL RD+  QLN +      S+++F+Y+ D + L+KLP PI+ RI+Y+PP+      
Sbjct: 190 TSASNLFRDICTQLNDLSMKEDKSNLVFDYALDCDSLKKLPSPIDERIEYRPPLSYFPQF 249

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300
                VR ++GY+S GPLV+R+D + E    Y+ FLN +++QMK +K+KLKS+ P CTMT
Sbjct: 250 LGSNFVRKHIGYHSNGPLVSRVDALDEGTACYTEFLNLTSQQMKEVKKKLKSKAPQCTMT 309

Query: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360
           PFLQAC L SMY SG+VF+ SMREWFFDVVI MNT Q+LPDD E++SMYKYGSN+GG+RY
Sbjct: 310 PFLQACLLVSMYDSGKVFTGSMREWFFDVVIPMNTVQLLPDDGEVQSMYKYGSNIGGSRY 369

Query: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420
           NYLISSFNVG +++AFW+LVDYY+ VF SA EK HYL+PLGALM+D++ +KSN+DK+++D
Sbjct: 370 NYLISSFNVGHEEEAFWNLVDYYRIVFESAREKNHYLYPLGALMMDAVCQKSNVDKLVVD 429

Query: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480
           DL+GKPR+G + SN+G+  Q+ +   YY+ DLVF+Q+LGSLRH F  +SCT +  GMNIV
Sbjct: 430 DLIGKPREGAVFSNLGFISQEIDNKIYYMNDLVFSQTLGSLRHGFTLSSCTIEKAGMNIV 489

Query: 481 ACAAQGSVASEHDWADVCELFKEQTLAL 508
           ACAA G+V +  DWA+VCELFK++ L++
Sbjct: 490 ACAALGTVENRSDWAEVCELFKKRILSI 517

>KLTH0B03806g Chr2 complement(309522..311090) [1569 bp, 522 aa] {ON}
           similar to uniprot|P40353 Saccharomyces cerevisiae
           YOR377W ATF1 Alcohol acetyltransferase with potential
           roles in lipid and sterol metabolism responsible for the
           major part of volatile acetate ester production during
           fermentation
          Length = 522

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 358/508 (70%), Gaps = 7/508 (1%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           ++ L++RGHAR LG+LENYF++ QRQ LY+NF M+CEL + CS  +LA ALR +CL+ P+
Sbjct: 10  LEELEKRGHARRLGNLENYFALGQRQDLYSNFGMFCELDRACSENELAEALRGMCLEYPL 69

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           L+H VL K     + +Y + E+L++P  QH+ +R+L  V  +D+++N+QEEY  +V+ A+
Sbjct: 70  LLHTVLEKKEAQDVNFYQTSEYLSKPWPQHDYIRVLQRVRFADVLLNDQEEYAEIVNAAL 129

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPE---GESNLWRKFIYITNHCS 177
           +EF+ NGGQYS ++F++I  +RIPY    +PNWR++CFPE    +S  WRK + ++NHCS
Sbjct: 130 KEFASNGGQYSSEVFELINKVRIPYCHNSRPNWRIMCFPEEGNAQSREWRKILLLSNHCS 189

Query: 178 SDGRSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXX 237
           SDG S+AN   DL + LN++P +LP +D+IF+YS D+E L KLP PIE +I Y  P    
Sbjct: 190 SDGMSSANFFHDLQDHLNNLPPSLPQADVIFDYSQDHETLGKLPAPIETQISYVGPKSYF 249

Query: 238 XXXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRL-PG 296
                   +R+Y GY S  P + R++E G N  +YSYFL  +  ++  +K+KLK++L P 
Sbjct: 250 AQLVGNQVLREYFGYKSPTPPIPRVNEPGGND-FYSYFLKITPSEVAAVKKKLKNKLDPS 308

Query: 297 CTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVG 356
           CT+TPF QACW  ++YKSG VFSKS  +   ++++ MNTAQ+LP+D +L+  Y+YG+NVG
Sbjct: 309 CTLTPFFQACWFAALYKSGIVFSKSFSQQLSNIMVAMNTAQLLPEDKQLKKQYRYGANVG 368

Query: 357 GTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDK 416
           G+ YNY ISSFNV +  +AFW LV YYQ VF  A  KKH+L+PLGALM+DS+ +  N+D 
Sbjct: 369 GSHYNYQISSFNVADKPEAFWKLVRYYQDVFVDAKRKKHFLYPLGALMIDSIYKTKNIDL 428

Query: 417 VIMDDLLGKPRQGVILSNVGYFQQKKETD--GYYVRDLVFAQSLGSLRHTFVCNSCTTDV 474
            + + +LGK R G +LSNVGYF QK      G++++DL+FAQ+ GS R TF  N C TD+
Sbjct: 429 AVTNSILGKSRLGTMLSNVGYFPQKARATVGGFHIQDLIFAQTTGSFRFTFDINLCATDI 488

Query: 475 GGMNIVACAAQGSVASEHDWADVCELFK 502
           GG+NI AC A+G++ +  DW  +CELFK
Sbjct: 489 GGLNITACVAEGALPTREDWKKLCELFK 516

>Kwal_33.15041 s33 (927424..928992) [1569 bp, 522 aa] {ON} YGR177C
           (ATF2) - 1:1 [contig 96] FULL
          Length = 522

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/512 (47%), Positives = 353/512 (68%), Gaps = 7/512 (1%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           MD L+ RGHAR LG+LENYF+I QRQ LY+NF M+CE  + CS  +LA A+R +CL+ P+
Sbjct: 10  MDDLERRGHARRLGNLENYFAIAQRQDLYSNFGMFCEFERGCSQSELAAAIRGVCLEFPL 69

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           L+H V+ K       +Y  +E+L++P   H+ +R+L+ V ++D+V+NEQ EY  +V EA+
Sbjct: 70  LLHTVVAKKRDEDAGFYQREEYLSKPWPDHDYIRVLEKVQMADVVLNEQPEYAELVEEAL 129

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPE--GESNLWRKFIYITNHCSS 178
           E F++ GG+Y+ ++F++I +IRIPY    +PNWRL+CFPE   E  +WRKF++++NHCSS
Sbjct: 130 ERFAECGGRYTSEVFEVINEIRIPYSHQSRPNWRLVCFPEEGEEKAIWRKFLFLSNHCSS 189

Query: 179 DGRSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXX 238
           DG SAAN   DL   LN +P    ++D+IF+Y  D+E L +LP PIE +I Y  P     
Sbjct: 190 DGISAANFFHDLQRHLNQLPSDAAENDVIFDYDRDHEKLAELPSPIEKQISYVSPKSFFA 249

Query: 239 XXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLP-GC 297
                  +R+Y+GY S  P ++R+ E   N+ ++SYF N + +Q+ ++KQ+LKS+L    
Sbjct: 250 RLVGAQVIREYVGYKSPCPTISRVCEPNGNR-FHSYFFNITPDQVNSVKQRLKSKLSVAG 308

Query: 298 TMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGG 357
           T+TP+ QACW  ++ KS ++F+ S +E   ++++ MNTAQ+LP+D  +R  Y+YG+NVGG
Sbjct: 309 TLTPYFQACWFAALAKSNKIFTNSFKEQLTNIMVAMNTAQLLPEDESIRKQYRYGANVGG 368

Query: 358 TRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKV 417
           + YNY ISSFNV +D  AFW LV+YYQ VF +A +K H L+ LGALM+DS+ EK N+D  
Sbjct: 369 SHYNYQISSFNVADDPVAFWKLVEYYQTVFINAKQKNHSLYSLGALMVDSIYEKKNIDLA 428

Query: 418 IMDDLLGKPRQGVILSNVGYFQQKKETDG---YYVRDLVFAQSLGSLRHTFVCNSCTTDV 474
           + + LLGK R G ++SN+GYF QK        +++ DLVFAQ+ GS R++F  N C TDV
Sbjct: 429 VTNALLGKQRLGTMMSNLGYFPQKSRVPSHHKFHILDLVFAQTTGSFRYSFDLNMCATDV 488

Query: 475 GGMNIVACAAQGSVASEHDWADVCELFKEQTL 506
           GG+NI AC A+G+++S  DW  +CELFK   L
Sbjct: 489 GGLNIAACVAEGTLSSRQDWHALCELFKNIIL 520

>SAKL0G13288g Chr7 complement(1139419..1141041) [1623 bp, 540 aa]
           {ON} similar to uniprot|P53296 Saccharomyces cerevisiae
           YGR177C ATF2 Alcohol acetyltransferase may play a role
           in steroid detoxification forms volatile esters during
           fermentation which is important in brewing
          Length = 540

 Score =  502 bits (1292), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/503 (47%), Positives = 338/503 (67%), Gaps = 3/503 (0%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L +RGHAR +GHLENYF++T RQKLY NFSMYCEL++ CS  QL YA+RSICL+ P L+H
Sbjct: 17  LIDRGHARRMGHLENYFALTNRQKLYTNFSMYCELNEACSKDQLVYAIRSICLKYPTLIH 76

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            V+PK+ PN  E+Y+S E+L++P   H+ ++++D++ + DI+MN Q EY ++VS+  + F
Sbjct: 77  TVVPKNLPNSEEFYSSQEYLSKPWPVHDFIKVIDHLEIDDILMNNQPEYASLVSQLEDLF 136

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNL--WRKFIYITNHCSSDGR 181
             NG +YSK++ +I++ + IPY    +PNWRL+C PE + +   WR+FI+++NHCSSDG 
Sbjct: 137 VHNGFKYSKEVAEILSPVAIPYCHQGRPNWRLICLPEEDRSTEKWRRFIFVSNHCSSDGS 196

Query: 182 SAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXXX 241
           SA N  ++L  +L+  PE + +S  +F+Y++D+  L KLP PIE RID+KPP+       
Sbjct: 197 SAINFFKELVNELDDEPEKISNSTTVFDYTADHLQLNKLPKPIEERIDFKPPLSHIPRYL 256

Query: 242 XXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTMT 300
               +    GY S G   T +DE+ ++ T+YSY  NFS  +M  I+  +K  +   CTMT
Sbjct: 257 TNSFISSSFGYRSPGGHTTPVDEIRDSNTHYSYMFNFSTAEMNQIRNTIKKHVHDRCTMT 316

Query: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360
           PFLQA W  ++Y+SG+VF++S+ EW  D+V+ MN+ Q+LPDD +L   YK+GSN+ GT Y
Sbjct: 317 PFLQAAWFVALYRSGKVFTRSIMEWTTDIVVAMNSRQLLPDDEDLLDSYKFGSNIAGTHY 376

Query: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420
           NYLISSFNVGEDK  FW LV YY  VF  A     +L+ +G +MLD      N+D  +  
Sbjct: 377 NYLISSFNVGEDKAKFWKLVGYYHDVFIKARGNNDFLYTMGMMMLDGFVNNKNIDLTVRT 436

Query: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480
           + L   R G ILSNVGYF  +  +  Y ++DL+FAQS G+L  T+  N C+TDV GMN V
Sbjct: 437 NTLSSDRGGSILSNVGYFPLRNHSTDYKIQDLIFAQSPGALAFTYGINVCSTDVSGMNFV 496

Query: 481 ACAAQGSVASEHDWADVCELFKE 503
              A+ ++    DW D+CELFKE
Sbjct: 497 MSMAKNALNDRKDWEDLCELFKE 519

>Suva_8.434 Chr8 (783961..785538) [1578 bp, 525 aa] {ON} YOR377W
           (REAL)
          Length = 525

 Score =  419 bits (1076), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/500 (40%), Positives = 307/500 (61%), Gaps = 4/500 (0%)

Query: 6   ERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQV 65
           + GH+R +G +E+ ++   RQKLY NFS Y EL+  C+  QLA ALR+ICL+NP L+H V
Sbjct: 21  QNGHSRRMGSVEDLYAALNRQKLYRNFSTYSELNDYCTKDQLALALRNICLKNPTLLHIV 80

Query: 66  LPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQ 125
           LP  WP+H  YY S E+ +QP  +H+ + +L  +    +++NEQ E+  ++ + +EE   
Sbjct: 81  LPARWPDHENYYLSSEYYSQPHPKHDYISVLPELKFDGVILNEQPEHNALMKQILEELKD 140

Query: 126 NGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFP-EGESNLWRKFIYITNHCSSDGRSAA 184
           + G Y+ KIF +   + IPY  P  P WRL+C P EG ++ W+KFI+++NHC  DGR++ 
Sbjct: 141 SNGSYTAKIFKLTTALTIPYAGPTSPTWRLICLPEEGYTDKWKKFIFLSNHCMCDGRTSI 200

Query: 185 NLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXXXXXX 244
           +  +DL ++LN++       D IF Y  DY+ LRKLP+PIEN ID++PP           
Sbjct: 201 HFFQDLRDELNNIKTPPKKLDYIFQYEKDYQLLRKLPEPIENMIDFRPPYMFIPKSLISG 260

Query: 245 XVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTMTPFL 303
            +  +L + SKG + TR+DE+ +N    +  +  S  +++ I+ K+KS +PG CT+TPFL
Sbjct: 261 FIYSHLRFSSKG-VCTRMDELEKNDDIVTEIITISPSELQKIRTKIKSNIPGKCTITPFL 319

Query: 304 QACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRYNYL 363
           + CW  S++K G+ F     EW  DV I  +   +LP+D ++R+MY+YG+NVG   +   
Sbjct: 320 EVCWFVSLHKWGKFFKPLKFEWLTDVFIPADCRSLLPEDEDVRAMYRYGANVGFVDFTPW 379

Query: 364 ISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMDDLL 423
           IS FN+ + K+ FW L+ +Y  V + A+  K +L  LG  +   +++  N+DKV+ D  L
Sbjct: 380 ISEFNMNDSKENFWPLIAHYHEVISGAINDKKHLNGLGFNIQGLVQKYVNIDKVMRDRAL 439

Query: 424 GKPRQGVILSNVGYFQQKKETDGYY-VRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIVAC 482
           GK R G +LSNVG F Q +ETD  Y +RDL F Q  GS    F    C+T+V GMNIV  
Sbjct: 440 GKSRGGTLLSNVGIFHQSEETDSRYSIRDLAFGQFQGSWHQAFSLGVCSTNVKGMNIVIS 499

Query: 483 AAQGSVASEHDWADVCELFK 502
           + + +V S+    ++C ++K
Sbjct: 500 STKNAVGSQELLEELCAMYK 519

>Smik_6.291 Chr6 complement(456731..458338) [1608 bp, 535 aa] {ON}
           YGR177C (REAL)
          Length = 535

 Score =  417 bits (1072), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 204/512 (39%), Positives = 313/512 (61%), Gaps = 15/512 (2%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L  RGHAR +GHLENYF+I  RQ +Y+NF++Y EL+K  S +QL  ALR +  + PIL H
Sbjct: 15  LINRGHARRMGHLENYFAILSRQNMYSNFTVYAELNKSVSRRQLKLALRILLHKYPILAH 74

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            V+PK +P+H  YY S+E+L  P  QH+ ++++ ++ L+D++MN Q  Y  V+ +  E+F
Sbjct: 75  TVIPKKYPDHEAYYCSEEYLNTPFPQHDFIKVIPHLELNDLIMNNQPAYREVIEKVSEQF 134

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFP---EGESNLWRKFIYITNHCSSDG 180
            ++  + +  + ++I  + +P GD  +PNWRL+C P     +++ W  F+Y++NHC SDG
Sbjct: 135 RRDDFKVTNSLIELITPVIVPLGDLKRPNWRLICLPGKNTSQADTWTNFVYVSNHCGSDG 194

Query: 181 RSAANLMRDLSEQLNHVP-------ETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPP 233
            S  N  +DL+  L  +        E L + D+I +Y+ DY  + K P PI +RIDYKP 
Sbjct: 195 VSGTNFFQDLAVLLAEIEEHGFDYDEQLIEDDVIIDYNEDYGEISKFPIPITDRIDYKPK 254

Query: 234 IXXXXXXXXXXXVRDYLGY--YSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLK 291
           +           + ++  Y   S+  +  R +   +    Y++ L+FS ++   I+ ++K
Sbjct: 255 VTSLPSFFLKAFIYEHCNYKTSSESTVTARYNPSTKANASYNHLLHFSTKETDQIRAEIK 314

Query: 292 SRL-PGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYK 350
             +  GCT+TPF+QAC+  ++Y+  ++F+KS  E+ FDV +  NT + LP D ELR  YK
Sbjct: 315 KNVHDGCTITPFIQACFFVALYRYDKLFTKSFLEYGFDVALPSNTRRFLPKDKELRDAYK 374

Query: 351 YGSNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLR 409
           YG+NVGG+ Y YLISSFN+ E D D FWSLV+YY   F  + E   +L  LGAL LD + 
Sbjct: 375 YGANVGGSHYAYLISSFNISEGDNDKFWSLVEYYHDCFLRSYENGDHLIGLGALQLDFIV 434

Query: 410 EKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNS 469
           +  N+D++I+   L + R G I+SNVG  +Q   T  YY+RDL+F+QS G+LR  F  N 
Sbjct: 435 QNKNIDELIVKSYLDQQRGGAIISNVGLVRQDT-TKPYYIRDLIFSQSAGALRFAFGLNI 493

Query: 470 CTTDVGGMNIVACAAQGSVASEHDWADVCELF 501
           C+T+V GMN+     QG++    +W   CE+F
Sbjct: 494 CSTNVNGMNMDMSVVQGTLRDRGEWESFCEIF 525

>YGR177C Chr7 complement(848829..850436) [1608 bp, 535 aa] {ON}
           ATF2Alcohol acetyltransferase, may play a role in
           steroid detoxification; forms volatile esters during
           fermentation, which is important for brewing and
           winemaking
          Length = 535

 Score =  416 bits (1068), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/512 (39%), Positives = 316/512 (61%), Gaps = 15/512 (2%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L +RGHAR +GHLENYF++  RQK+Y+NF++Y EL+K  + +QL   L+ +  +   L H
Sbjct: 15  LIDRGHARRMGHLENYFAVLSRQKMYSNFTVYAELNKGVNKRQLMLVLKVLLQKYSTLAH 74

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            ++PKH+P+H  YY+S+E+L++P  QH+ ++++ ++   D++MN Q EY  V+ +  E+F
Sbjct: 75  TIIPKHYPHHEAYYSSEEYLSKPFPQHDFIKVISHLEFDDLIMNNQPEYREVMEKISEQF 134

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESN---LWRKFIYITNHCSSDG 180
            ++  + + ++ ++I+ + IP G+P +PNWRL+C P  +++    W+ F+Y+TNHC SDG
Sbjct: 135 KKDDFKVTNRLIELISPVIIPLGNPKRPNWRLICLPGKDTDGFETWKNFVYVTNHCGSDG 194

Query: 181 RSAANLMRDLSEQLNHVPETLPDSD-------IIFNYSSDYEGLRKLPDPIENRIDYKPP 233
            S +N  +DL+     + E   D D       +I +Y  DY  + KLP PI +RIDYKP 
Sbjct: 195 VSGSNFFKDLALLFCKIEEKGFDYDEEFIEDQVIIDYDRDYTEISKLPKPITDRIDYKPA 254

Query: 234 IXXXXXXXXXXXVRDYLGY--YSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLK 291
           +           + ++  +   S+  L  R          Y+Y L+FS +Q++ I+ ++K
Sbjct: 255 LTSLPKFFLTTFIYEHCNFKTSSESTLTARYSPSSNANASYNYLLHFSTKQVEQIRAQIK 314

Query: 292 SRL-PGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYK 350
             +  GCT+TPF+QAC+L ++Y+  ++F+KS+ E+ FDV I  N  + LP+D ELR  YK
Sbjct: 315 KNVHDGCTLTPFIQACFLVALYRLDKLFTKSLLEYGFDVAIPSNARRFLPNDEELRDSYK 374

Query: 351 YGSNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLR 409
           YGSNVGG+ Y YLISSF++ E D D FWSLV+YY   F  + +   +L  LG L LD + 
Sbjct: 375 YGSNVGGSHYAYLISSFDIPEGDNDKFWSLVEYYYDRFLESYDNGDHLIGLGVLQLDFIV 434

Query: 410 EKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNS 469
           E  N+D ++ +  L + R G I+SN G   Q   T  YYVRDL+F+QS G+LR  F  N 
Sbjct: 435 ENKNIDSLLANSYLHQQRGGAIISNTGLVSQDT-TKPYYVRDLIFSQSAGALRFAFGLNV 493

Query: 470 CTTDVGGMNIVACAAQGSVASEHDWADVCELF 501
           C+T+V GMN+     QG++    +W   C+LF
Sbjct: 494 CSTNVNGMNMDMSVVQGTLRDRGEWESFCKLF 525

>YOR377W Chr15 (1046226..1047803) [1578 bp, 525 aa] {ON}
           ATF1Alcohol acetyltransferase with potential roles in
           lipid and sterol metabolism; responsible for the major
           part of volatile acetate ester production during
           fermentation
          Length = 525

 Score =  410 bits (1054), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 201/509 (39%), Positives = 298/509 (58%), Gaps = 3/509 (0%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           +  + + GHAR +G +E+ +    RQ LY NF  Y ELS  C+  QL  ALR ICL+NP 
Sbjct: 17  LKEMIQNGHARRMGSVEDLYVALNRQNLYRNFCTYGELSDYCTRDQLTLALREICLKNPT 76

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           L+H VLP  WPNH  YY S E+ ++P   H+ + +L  + LS +V+NEQ EY  V+ + +
Sbjct: 77  LLHIVLPTRWPNHENYYRSSEYYSRPHPVHDYISVLQELKLSGVVLNEQPEYSAVMKQIL 136

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180
           EEF  + G Y+ KIF +   + IPY  P  P+WRL+C PE  +  W+KFI+++NHC SDG
Sbjct: 137 EEFKNSKGSYTAKIFKLTTTLTIPYFGPTGPSWRLICLPEEHTEKWKKFIFVSNHCMSDG 196

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           RS+ +   DL ++LN++       D IF Y  DY+ LRKLP+PIE  ID++PP       
Sbjct: 197 RSSIHFFHDLRDELNNIKTPPKKLDYIFKYEEDYQLLRKLPEPIEKVIDFRPPYLFIPKS 256

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTM 299
                + ++L + SKG +  R+D+V +     +  +N S  + + IK  +KS + G CT+
Sbjct: 257 LLSGFIYNHLRFSSKG-VCMRMDDVEKTDDVVTEIINISPTEFQAIKANIKSNIQGKCTI 315

Query: 300 TPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTR 359
           TPFL  CW  S++K G+ F     EW  D+ I  +    LPDD E+R MY+YG+NVG   
Sbjct: 316 TPFLHVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSQLPDDDEMRQMYRYGANVGFID 375

Query: 360 YNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIM 419
           +   IS F++ ++K+ FW L+++Y  V + A+  K +L  LG  +   +++  N+DKV+ 
Sbjct: 376 FTPWISEFDMNDNKENFWPLIEHYHEVISEALRNKKHLHGLGFNIQGFVQKYVNIDKVMC 435

Query: 420 DDLLGKPRQGVILSNVGYFQQKKETDGYY-VRDLVFAQSLGSLRHTFVCNSCTTDVGGMN 478
           D  +GK R G +LSNVG F Q +E D  Y + DL F Q  GS    F    C+T+V GMN
Sbjct: 436 DRAIGKRRGGTLLSNVGLFNQLEEPDAKYSICDLAFGQFQGSWHQAFSLGVCSTNVKGMN 495

Query: 479 IVACAAQGSVASEHDWADVCELFKEQTLA 507
           IV  + +  V S+    ++C ++K   L 
Sbjct: 496 IVVASTKNVVGSQESLEELCSIYKALLLG 524

>Skud_15.544 Chr15 (985246..986820) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score =  407 bits (1047), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/509 (38%), Positives = 302/509 (59%), Gaps = 3/509 (0%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           ++ + + GHAR +G +E+ +    RQKLY NFS Y ELS  CS  QL  ALR+ICL+NP 
Sbjct: 16  LERMIQNGHARRMGSVEDLYVALNRQKLYRNFSAYAELSDYCSKDQLTLALRNICLKNPT 75

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           L+H VLP  WP+H  YY S E+ + P  +H+ + +L  + L  +++NEQ E G +V + +
Sbjct: 76  LLHIVLPTRWPDHENYYLSSEYYSHPHPEHDYISVLPELKLDGVIINEQPENGKIVRQIL 135

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180
           EEF  + G Y+ KIF +   + IPY  P  PNWRL+C PE  ++ W+KFI+++NHC SDG
Sbjct: 136 EEFRNSNGTYNAKIFKLTTALTIPYFGPTSPNWRLICLPEEHTDKWKKFIFVSNHCMSDG 195

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           RS+ +   DL  +LN +       D +F Y +DY+ LRKLP+PIE  ID++PP       
Sbjct: 196 RSSIHFFHDLKAELNDIKTPPKKLDYLFKYENDYQLLRKLPEPIEKVIDFRPPYLFIPKS 255

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTM 299
                + ++L + S+G + TR+D++ ++    +  +  S  +++ I+ K+KS + G CT+
Sbjct: 256 LLSGFIYNHLRFASRG-ICTRMDDMEKSDDVVAEIITISPSELQEIRTKIKSNIQGKCTL 314

Query: 300 TPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTR 359
           TPFLQ CW  S+++ G+ F     EW  D+ I  +    LPDD E+R MY+YG+NVG   
Sbjct: 315 TPFLQVCWFVSLHQWGKFFKPLNFEWLTDIFIPADCRPQLPDDEEVRQMYRYGANVGFVD 374

Query: 360 YNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIM 419
           +   I   N+ ++K+ FW L+++Y  V + A+    +L  LG  +   +++  N+DK + 
Sbjct: 375 FTPWICESNMNDNKENFWPLIEHYHQVISGALRDNKHLHGLGLNIQGFVQKYVNIDKAMC 434

Query: 420 DDLLGKPRQGVILSNVGYFQQKKETD-GYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMN 478
           D  +GK R G +LSNVG F+Q   ++  Y ++DL F Q  GS    F    C+TDV GMN
Sbjct: 435 DRAIGKARGGTLLSNVGMFKQLDSSNCNYSIKDLAFGQFQGSWHQAFSLGVCSTDVKGMN 494

Query: 479 IVACAAQGSVASEHDWADVCELFKEQTLA 507
           I+  + +  V S+    ++C ++K   L 
Sbjct: 495 IIVASTKNVVGSQESLEELCRVYKAMLLG 523

>Kpol_2002.89 s2002 (209104..210675) [1572 bp, 523 aa] {ON}
           (209104..210675) [1572 nt, 524 aa]
          Length = 523

 Score =  406 bits (1044), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 200/510 (39%), Positives = 311/510 (60%), Gaps = 10/510 (1%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L +RGHAR +G LENYF++ QRQ LY NF++Y E+++P    QL  A R + L+ PIL+H
Sbjct: 12  LVDRGHARRMGQLENYFALLQRQNLYKNFNVYGEINEPIDKFQLGTAFRQMLLKYPILMH 71

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            ++P+ +P+H EYYASDE+L  P   ++ +++++N+ L DI++N Q EY  +V + ++++
Sbjct: 72  VIVPRKYPHHEEYYASDEYLNNPQPINDYIKVMENIDLEDILLNSQPEYEAIVGKLLDQY 131

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESN-LWRKFIYITNHCSSDGRS 182
             +G +Y+ ++ +II DI IP  D  KPNWRLLC P  ES+  W  F+YI+NHC++DG +
Sbjct: 132 KSDGYKYTNRMIEIIGDISIPICDQTKPNWRLLCLPTKESDKKWHAFVYISNHCAADGMT 191

Query: 183 AANLMRDLSEQLN-HVPETLPDSD---IIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXX 238
           + N   D+   LN    ET+ + +    + NY+ D++ + K P PI  R++Y+P +    
Sbjct: 192 SMNFFHDIVNGLNDKSSETVTEVNGRMNLVNYAKDHKNISKFPKPITERVEYRPSLSQLP 251

Query: 239 XXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRL-PGC 297
                   R  L Y S   L T +D+V  +   + Y LNF+ E++  I++ +K+    G 
Sbjct: 252 KFMIGNIARTKLNYKSPCALTTTVDKV--DMQTFDYILNFTNEEVGKIRKHIKANTHNGV 309

Query: 298 TMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGG 357
           T+TPFLQ C   ++Y+ G +F K++ EW  D V+ +N  + LP+D ELR  YKYGSNVGG
Sbjct: 310 TLTPFLQTCLFVTLYQFGTIFQKTLLEWGLDSVLPVNARKYLPEDAELRDSYKYGSNVGG 369

Query: 358 TRYNYLISSFNVGEDK-DAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDK 416
             Y  LISSFN+  D+ + FWSLVDYY   +  A          G LM D + +  N+DK
Sbjct: 370 IHYFNLISSFNIKNDEAETFWSLVDYYHANYQKAYHNGDTFVGFGLLMSDFIVKNKNVDK 429

Query: 417 VIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGG 476
           +I +D + + R GVILSN+G+F Q    + YY+ DL+FAQ+ GS++ TF  + C+T+V G
Sbjct: 430 LIKEDYVNQKRGGVILSNLGFFPQDTRNE-YYLNDLIFAQTFGSMKFTFGLSLCSTNVNG 488

Query: 477 MNIVACAAQGSVASEHDWADVCELFKEQTL 506
           +NI     + +      +   C+ +KE  +
Sbjct: 489 LNIGISVVRDAFNDRETFEKFCKHYKETII 518

>Smik_15.559 Chr15 (992130..993704) [1575 bp, 524 aa] {ON} YOR377W
           (REAL)
          Length = 524

 Score =  405 bits (1042), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 194/509 (38%), Positives = 302/509 (59%), Gaps = 3/509 (0%)

Query: 1   MDSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPI 60
           ++ + + GHAR +G +E+ +    RQ LY NFS Y EL+  C+  QL  ALR +CL+NP 
Sbjct: 16  LEKMIQNGHARRMGSVEDLYVALNRQNLYRNFSTYAELNDYCTRDQLTLALRELCLKNPT 75

Query: 61  LVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAI 120
           L+H VLP  WPNH  YY S E+ ++P  +H+ + +L  + L  +V+N+Q +Y  ++ + +
Sbjct: 76  LLHIVLPTRWPNHETYYRSSEYYSRPHPKHDYISVLQELKLDGVVLNDQPQYSAIMKQIL 135

Query: 121 EEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDG 180
           EEF  + G Y+ KIF     + IPY  P  PNWRL+C PE  ++ W+KFI+++NHC SDG
Sbjct: 136 EEFKNSNGTYTAKIFKYTTKLTIPYFGPNGPNWRLICLPEEHTDRWKKFIFVSNHCMSDG 195

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           RS+ +   DL ++LN +      +D IF Y SDY+ LRKLP+PIE  ID++PP       
Sbjct: 196 RSSIHFFHDLRDELNRIKTPPRKTDYIFQYESDYQLLRKLPEPIERVIDFRPPYLFIPKS 255

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTM 299
                + ++L + SKG +  R++++ +     +  +  +  +++ I+ K+K  + G CT+
Sbjct: 256 LFSGFIYNHLRFSSKG-ICMRMEDMEKCDDVVTDIITITPSELQEIRAKIKLNIQGKCTI 314

Query: 300 TPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTR 359
           TPFLQ CW  S++K G+ F     EW  D+ I  +    LPDD E+R MY+YG+NVG   
Sbjct: 315 TPFLQVCWFVSLHKWGKFFKPLNFEWLTDIFIPADCRSELPDDEEVRQMYRYGANVGFVD 374

Query: 360 YNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIM 419
           +   IS F++ + ++ FW L+ +Y  V ++A++ K +L  LG  +   +++  N+DK + 
Sbjct: 375 FTPWISEFDMNDSEENFWPLIKHYHEVISAALKDKKHLHGLGFNIQGFVQKYVNIDKAMC 434

Query: 420 DDLLGKPRQGVILSNVGYFQQKKETDGYY-VRDLVFAQSLGSLRHTFVCNSCTTDVGGMN 478
           D  +GK R G +LSNVG F Q KE D  Y +RDL F Q  GS    F    C+T+V GMN
Sbjct: 435 DRAIGKARGGTLLSNVGMFNQVKEPDTKYSIRDLAFGQFQGSWHQAFSLGVCSTNVKGMN 494

Query: 479 IVACAAQGSVASEHDWADVCELFKEQTLA 507
           I+  + +  V S+    ++C +FK   L 
Sbjct: 495 ILVASTKNVVGSQESLEELCSIFKSLLLG 523

>Suva_7.470 Chr7 complement(806476..808116) [1641 bp, 546 aa] {ON}
           YGR177C (REAL)
          Length = 546

 Score =  394 bits (1011), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 202/527 (38%), Positives = 314/527 (59%), Gaps = 27/527 (5%)

Query: 1   MDSLKE-----------RGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAY 49
           MDSL+E           RGHAR +GHLENYF++ +RQ +Y+NF++Y EL+K  S +QL  
Sbjct: 1   MDSLEEYEPHVTQELIDRGHARRMGHLENYFAVLRRQNMYSNFTVYGELNKAVSKRQLRL 60

Query: 50  ALRSICLQNPILVHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQ 109
           ALR + L+ PIL H ++PK +P H  YY S E+L +P  QH+ ++++ ++ L D++MN Q
Sbjct: 61  ALRLLLLKYPILSHTIVPKKYPEHEAYYLSQEYLNKPFPQHDFIKVISHLELDDVIMNNQ 120

Query: 110 EEYGTVVSEAIEEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESN----L 165
            EY  V+S+  E+F ++  + +  + ++I  I +P  DP +PNWRL+C P  ++      
Sbjct: 121 SEYKEVISKVSEQFKKDNFKVTSSLIELITPIIVPICDPERPNWRLICLPSTDTTSADEA 180

Query: 166 WRKFIYITNHCSSDGRSAANLMRDLSEQLNHVPET-------LPDSDIIFNYSSDYEGLR 218
           W  F+Y++NHC SDG S  N  +DL+  L+ + E        + D+++I +Y+ D+  + 
Sbjct: 181 WTNFVYVSNHCGSDGISGTNFFQDLTALLSTIEEKGFDYEEEIVDNNVIIDYNEDHNEVS 240

Query: 219 KLPDPIENRIDYKPPIXXXXXXXXXXXVRDYLGYYSKGPL--VTRIDEVGENKTYYSYFL 276
           K P PI +RIDY+P +           + +Y  + +   L   +R          +++ L
Sbjct: 241 KFPIPITDRIDYRPSLTSLPKFFLKNILAEYCEFRTSNELTVTSRYTSSPNANASFNHLL 300

Query: 277 NFSAEQMKTIKQKLKSRL-PGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNT 335
           +FSA   + I+ ++K  +  GCT+TPF+QAC+  ++Y+  +VF+KS+ E+ FDV +  +T
Sbjct: 301 HFSANDTQQIRSEIKKNVHAGCTITPFIQACFFVALYRHDKVFTKSLLEYGFDVALPSST 360

Query: 336 AQMLPDDPELRSMYKYGSNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKK 394
            + LP D ELR  YKYGSNVGG+ Y YLISSF+V E D + FW LV+YY   F  + +  
Sbjct: 361 RRFLPKDEELRDTYKYGSNVGGSHYTYLISSFDVPEGDTNKFWRLVEYYHDCFLKSYDNG 420

Query: 395 HYLFPLGALMLDSLREKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVF 454
            +L  LG L LD + +  N+D +I    L   R G I+SN G+ +Q   T  YY RDL+F
Sbjct: 421 DHLIGLGTLQLDFIVQNKNVDDMISTSYLDHQRGGAIISNTGFVRQDT-TKPYYARDLIF 479

Query: 455 AQSLGSLRHTFVCNSCTTDVGGMNIVACAAQGSVASEHDWADVCELF 501
           +QS G+LR  F  N C+T+V GMN+     QG++    +W   C++F
Sbjct: 480 SQSAGALRFAFGLNVCSTNVAGMNMDMSVVQGTLRDRGEWESFCDVF 526

>CAGL0D05918g Chr4 (563388..565082) [1695 bp, 564 aa] {ON} similar
           to uniprot|P53296 Saccharomyces cerevisiae YGR177c ATF2
           alcohol O-acetyltransferase or uniprot|P40353
           Saccharomyces cerevisiae YOR377w ATF1
          Length = 564

 Score =  392 bits (1008), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/504 (40%), Positives = 315/504 (62%), Gaps = 28/504 (5%)

Query: 2   DSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPIL 61
           +SL ERGH+R +GHLENYF+I QRQKLY NF+MY EL+K  + +QLA A+R I L++PI+
Sbjct: 30  ESLLERGHSRRMGHLENYFAIMQRQKLYTNFNMYGELNKEVTREQLAVAIRQILLRHPIM 89

Query: 62  VHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDN-VLLSDIVMNEQ-EEYGTVVSEA 119
           +  ++PK +P H EYY SD++   P  +++ +R++ + + LSDI++NEQ E+YG ++   
Sbjct: 90  MQAIIPKKFPEHEEYYTSDDYYNTPFPENDFLRVITSKIKLSDIIINEQSEDYGEIIDMI 149

Query: 120 IEEFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFP--EGESNLWRKFIYITNHCS 177
           + E+ +NG ++   + ++I +I IP G+P KPNWRLLC P  EG    W+KF+YI+NHC 
Sbjct: 150 LSEYKKNGYKFDAYMQELIGNIVIPIGNPNKPNWRLLCLPSAEGGGAQWKKFVYISNHCC 209

Query: 178 SDGRSAANLMRDLSEQLNHVPE---TLP-DSDIIFNYSSDYEGLRKLPDPIENRIDYKPP 233
           SD  SA NL +D++E ++ + +    +P   D+I +Y  D   + KLP PI  R++Y+PP
Sbjct: 210 SDAISAVNLFQDIAENVSLIEQNSWAVPYADDVIVDYEQDVADIAKLPAPITERVEYRPP 269

Query: 234 IXXXXXXXXXXXVRDYLGYYSKGPLVTRIDE--VGENKTY--------YSYFLNFSAEQM 283
           +           ++  L + S   L TR ++   GE +T         Y   LN++ E++
Sbjct: 270 LSKLPKIMLVSFLKTALNFKSDA-LETRCNDEYSGEPETSAVQMGDVCYDSILNYTCEEV 328

Query: 284 KTIKQKLKSRLPG-CTMTPFLQACWLTSMYKSGRV------FSKSMREWFFDVVITMNTA 336
             I+ ++K  + G CT+TPF+QA +  +M++S ++      F + M EW  D+    +T 
Sbjct: 329 AVIRDRIKHNVHGKCTVTPFIQAAFFVAMHQSRKLLGQKQGFKEWMSEWGVDMATPSSTR 388

Query: 337 QMLPDDPELRSMYKYGSNVGGTRYNYLISSFNVG-EDKDAFWSLVDYYQGVFNSAMEKKH 395
           + LP+DPE+R MYKYGSNVGG  Y Y+IS   V  E+ + FWSLV+YY  +  ++     
Sbjct: 389 RYLPEDPEVRDMYKYGSNVGGIHYLYMISGMKVEREETEKFWSLVEYYHDILLASHSNGD 448

Query: 396 YLFPLGALMLDSLREKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFA 455
               LG LMLD + +K N+DK+I D+ L + R GVI+SN GYF Q      Y+V DLVF 
Sbjct: 449 QTVGLGTLMLDVIVDKKNVDKLIRDEYLYQKRGGVIMSNAGYFHQDP-AQAYHVTDLVFG 507

Query: 456 QSLGSLRHTFVCNSCTTDVGGMNI 479
           Q  G+L+ +F  N  +T++GGMN+
Sbjct: 508 QRPGALKFSFGVNVVSTNIGGMNL 531

>Skud_7.507 Chr7 complement(822986..824593) [1608 bp, 535 aa] {ON}
           YGR177C (REAL)
          Length = 535

 Score =  390 bits (1001), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 196/512 (38%), Positives = 306/512 (59%), Gaps = 15/512 (2%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L  RGHAR +GHLENYF+I  RQ +Y+NF++Y EL+K  + + L  ALR +  + PIL H
Sbjct: 15  LINRGHARRMGHLENYFAILCRQNMYSNFTVYAELNKGVNKRHLQLALRLLLQKYPILAH 74

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            V+PK +P    YY+S+E+L +P  QH+ ++++ ++ + D++MN Q EY   + +   +F
Sbjct: 75  TVIPKKYPGQEAYYSSEEYLNKPFPQHDFIKVISHLEVDDLIMNNQPEYKDAIDKISRQF 134

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESN---LWRKFIYITNHCSSDG 180
            ++  + +  + ++IA I IP  DP +PNWRL+C P   ++    W  F+Y++NHC SDG
Sbjct: 135 EKDDYKVTSSLIELIAPIVIPLCDPKRPNWRLICLPSRNTSGVETWTNFVYVSNHCGSDG 194

Query: 181 RSAANLMRDLSEQLNHVPET-------LPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPP 233
            S  N  +DL+     + E        + + ++I NY  DY  + K P PI +RIDY+P 
Sbjct: 195 ISGTNFFQDLALLFTAIEEKGFDYEEQITEDNVIINYDEDYNEIAKFPIPITDRIDYRPA 254

Query: 234 IXXXXXXXXXXXVRDYLGYYS--KGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLK 291
           +           + ++  + +  K  +  R +        Y++ L+FS E+ + I+ ++K
Sbjct: 255 LTSMPSFFLKNFIYEHCTFKTSNKSTVTARHNLSTRANASYNHLLHFSTEETEQIRAEIK 314

Query: 292 SRL-PGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYK 350
             +  GCT+TPF+QAC+  ++Y+  ++F+KS  E+ FDV +  ++ + LP + ELR  YK
Sbjct: 315 KNVHDGCTITPFIQACFFVALYRYDKLFTKSFFEYGFDVALPSSSRRFLPKEEELRDTYK 374

Query: 351 YGSNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLR 409
           YGSNVGGT Y YLISSFN+ E D D FWSLV YY   F  + +   +L  LG L LD + 
Sbjct: 375 YGSNVGGTHYAYLISSFNIPEGDTDKFWSLVGYYHDCFLKSYDNGDHLIGLGTLQLDFIV 434

Query: 410 EKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNS 469
           +  N+D++I+   L K R G I+SN G  +Q   T  YYV+DL+F+QS G+LR  F  N 
Sbjct: 435 QNKNLDELIVSSYLNKQRGGAIISNTGLVRQDT-TKPYYVQDLIFSQSAGALRFAFGLNV 493

Query: 470 CTTDVGGMNIVACAAQGSVASEHDWADVCELF 501
           C+T+V GMN+   A QG++    +W   C++F
Sbjct: 494 CSTNVNGMNMDVSAVQGTLRDRGEWESFCKVF 525

>NCAS0A06920 Chr1 (1373157..1374713) [1557 bp, 518 aa] {ON}
           Anc_5.184
          Length = 518

 Score =  385 bits (990), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 203/503 (40%), Positives = 300/503 (59%), Gaps = 15/503 (2%)

Query: 2   DSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPIL 61
           D L ERGHAR +GHLENYF++ QRQKLY NFS+Y EL+K      L  ALRSI  +NPIL
Sbjct: 17  DELIERGHARRMGHLENYFALLQRQKLYTNFSIYGELNKEVKDVDLTRALRSIIFKNPIL 76

Query: 62  VHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIE 121
            H ++PK +P+   +Y S+E+L  P  +H+ +++L  + LSDI++NEQEE+  +V + + 
Sbjct: 77  AHTIVPKKYPDQEPFYQSEEYLNAPYPEHDFIKVLPKLSLSDILINEQEEFREIVDDILT 136

Query: 122 EFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDGR 181
           +F +  G  +  I   +A + IP  DP +PNWRL            KF YI+NHC+SD  
Sbjct: 137 QFKEANGVITPDIMKAVAYVIIPICDPSRPNWRLFRLSP------TKFFYISNHCTSDAI 190

Query: 182 SAANLMRDLSEQLNHVPETLPDSDI-IFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           S  N+ +D+  +L+   E     D+ IFNY  D+E   K+  PI + I+Y+P +      
Sbjct: 191 SGVNIFQDICTELSQNDEEPFRDDLQIFNYEEDWESFHKIYIPITDIIEYRPALTSLPKI 250

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300
                V+ +L Y +    +T  ++ G    +    + F+ +++ +I++ +K     CT T
Sbjct: 251 IASALVKGFLNYRNWPTELTSTNDKG--IPFDFNIITFTNDEVNSIRETVKKY--NCTFT 306

Query: 301 PFLQACWLTSMYKSGRVFS-KSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTR 359
           PFLQACW  +M+ +G++F   S REW  DV I  N+ + L D+ EL+ +YKYGSNVGG  
Sbjct: 307 PFLQACWFVAMFNNGKIFHMDSWREWGLDVAIPSNSRRFLADE-ELKDIYKYGSNVGGLH 365

Query: 360 YNYLISSFNVG-EDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVI 418
           Y +LISSFN+  ++K+ FW LV YYQ  +  + E   +   LG LM+D L ++ N+DKVI
Sbjct: 366 YTHLISSFNIQLDEKEKFWDLVQYYQDGYTKSYENGDHFSGLGLLMMDGLVKRQNIDKVI 425

Query: 419 MDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMN 478
             D L K R GV+ SN G+F Q + T  Y+V DL+F QS G+++ +F  N  TT++GGMN
Sbjct: 426 SSDYLHKTRAGVLFSNAGFFPQDR-TQAYHVNDLLFTQSQGAMKFSFGLNIATTNIGGMN 484

Query: 479 IVACAAQGSVASEHDWADVCELF 501
           I    AQG+   E    D+ + F
Sbjct: 485 IAINVAQGTFDDEEGIIDLSQDF 507

>TPHA0E03170 Chr5 complement(670756..672360) [1605 bp, 534 aa] {ON}
           Anc_5.184 YGR177C
          Length = 534

 Score =  386 bits (991), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 200/512 (39%), Positives = 307/512 (59%), Gaps = 12/512 (2%)

Query: 2   DSLKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPIL 61
           + L ERGHAR +GHL++YF+I QRQKLY NF++YCEL++  +  QL++A R + LQ P L
Sbjct: 17  EELIERGHARRMGHLQDYFAIIQRQKLYNNFNIYCELNEKVNKVQLSHAFREMFLQYPAL 76

Query: 62  VHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIE 121
           +  ++PK +P H  YY S+E+L++P   H+ +R+L+ V ++DI+MNEQ+EY ++ ++  +
Sbjct: 77  IEYIVPKFYPKHEAYYRSEEYLSKPCPIHDYIRVLNEVNINDIIMNEQDEYKSITTKISD 136

Query: 122 EFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNL-WRKFIYITNHCSSDG 180
            F +N  ++S +I ++++ I+I   DP KPNWR++C P   S+  W+ FI ++NH  SDG
Sbjct: 137 IFVKNDYKFSNEISEMVSTIKIAICDPKKPNWRIICLPSKTSSTEWKDFILVSNHFDSDG 196

Query: 181 RSAANLMRDLSEQLNHVPETLPDSDI------IFNYSSDYEGLRKLPDPIENRIDYKPPI 234
            SA N   DL+  L+       D+ +      I NYS DY+ + KLP PI  RI Y P +
Sbjct: 197 TSAVNFFEDLTNILSKQANVENDTIVIGNDINIINYSKDYKLISKLPIPITERISYTPTL 256

Query: 235 XXXXXXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRL 294
                       +  L Y S G   T  + V E+   Y Y +NFS+E++  +K+ +K+ L
Sbjct: 257 SSIPKFIVGNICKTKLQYTSDGG-DTPAEFVSEDPLTYDYLINFSSEEVAKMKKTIKNCL 315

Query: 295 -PGCTMTPFLQACWLTSMYKSGRVFS-KSMREWFFDVVITMNTAQMLPDDPELRSMYKYG 352
               T+TPF+QAC+  +MYK  ++ +  +  +W  D  +  N  ++LPDDPE R +Y+YG
Sbjct: 316 YNSVTLTPFIQACFFVAMYKYNKILNLNNWWQWGVDCALATNARRLLPDDPETRDLYRYG 375

Query: 353 SNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREK 411
           SNVGGT Y  LIS FN+ E + D F+ LVDYY   + ++      L   G L  D +   
Sbjct: 376 SNVGGTHYFNLISQFNINEFEYDKFFKLVDYYHKNYQNSYRNGDELVGFGVLFSDLIINN 435

Query: 412 SNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCT 471
           +NMDK I DD     R G++ SNVGY + +  T   +V +++F+QS G ++ TF  N  +
Sbjct: 436 TNMDKTIKDDYTNHKRGGLLFSNVGY-RNEDLTKKVHVNNIIFSQSPGCMKFTFGLNLIS 494

Query: 472 TDVGGMNIVACAAQGSVASEHDWADVCELFKE 503
           TD  GMNI+    +GSV S  ++ D C  F++
Sbjct: 495 TDKCGMNILMNGVRGSVKSRENFEDFCRFFRK 526

>NDAI0D01980 Chr4 (468576..470192) [1617 bp, 538 aa] {ON} Anc_5.184
          Length = 538

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 206/521 (39%), Positives = 317/521 (60%), Gaps = 26/521 (4%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L ERGHAR +GHLENYF++ QRQ+LY NF +Y E ++P S  QL  +LR I  ++PIL H
Sbjct: 25  LIERGHARRMGHLENYFALLQRQELYTNFQIYGEFNEPVSDSQLRESLREILFKHPILAH 84

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMN-EQEEYGTVVSEAIEE 122
            ++PK  P+  ++Y S+++L  P   H+ +R+L  + LSDI++N +QEEY  ++   + E
Sbjct: 85  TIIPKDQPDFRKWYQSEKYLNTPYPLHDFIRILPELKLSDILINKQQEEYSDILPGILNE 144

Query: 123 FSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDGRS 182
           F ++  + +  +    + +R+P  DP +PNWRLL          R+FIY++NHC SD  S
Sbjct: 145 F-ESEKKITSSLLSRASCLRVPIYDPKRPNWRLLRLSP------RQFIYVSNHCCSDAIS 197

Query: 183 AANLMRDLSEQLNHV--------PETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPI 234
             NL +D++E L+           +   D++ IFNY+SD++   KL DPI ++I+Y+P +
Sbjct: 198 GVNLFQDIAEHLSSSSTSSSFPREDDKNDNNTIFNYNSDWKFFNKLYDPITDKIEYRPKV 257

Query: 235 XXXXXXXXXXXVRDYLGYYSKGPLVT-RIDEVGE--NKTYYSYFLNFSAEQMKTIKQKLK 291
                      V+ YL Y++   L T R+D+     +K +    L F+ E++ TI+ K+K
Sbjct: 258 KALPKFACSIFVKSYLSYFNWNGLPTMRVDQPLPLLHKQFQFQLLEFTNEELNTIRDKIK 317

Query: 292 SRLPGCTMTPFLQACWLTSMYKSGRVFS-KSMREWFFDVVITMNTAQML--PDDPELRSM 348
           +   GCT TPFLQACW  +MYK G+VF+ KS +EW  D+ +  ++ + L   DD  L+ M
Sbjct: 318 TM--GCTFTPFLQACWFIAMYKCGKVFNLKSWKEWAIDIAVPSSSRRFLIEEDDNSLKEM 375

Query: 349 YKYGSNVGGTRYNYLISSFNVGE-DKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDS 407
           YKYGSNVGG  Y+YLISSFN+   + D F+ LV YYQ  ++ + E   +L  LG +M+D 
Sbjct: 376 YKYGSNVGGFHYSYLISSFNIDRSENDKFFELVQYYQDGYSKSYENGDHLIGLGIMMMDG 435

Query: 408 LREKSNMDKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVC 467
           + ++ N+DK+I DD L + R GV+ SN G+F Q  E+  Y+V DLVF Q+ GS++ +F  
Sbjct: 436 IVQRKNIDKMIKDDYLNQTRAGVLFSNAGFFPQ-DESKKYHVTDLVFNQAQGSMKFSFGL 494

Query: 468 NSCTTDVGGMNIVACAAQGSVASEHDWADVCELFKEQTLAL 508
           N  +T+V G+ I    A+G+     D+A +C  FK   ++ 
Sbjct: 495 NIASTNVNGLKISVNVAEGTFDETADFAHLCNEFKANIVSF 535

>KAFR0D01730 Chr4 complement(345374..346978) [1605 bp, 534 aa] {ON}
           Anc_5.184 YGR177C
          Length = 534

 Score =  377 bits (969), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 195/502 (38%), Positives = 310/502 (61%), Gaps = 19/502 (3%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVH 63
           L +RGHAR +GHLENYF++ QRQ+LY+NF++Y +++K  S   L +ALR + L+N +L H
Sbjct: 39  LIDRGHARRMGHLENYFAMLQRQELYSNFAVYLKMNKSVSRNDLKHALREVILENSVLAH 98

Query: 64  QVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEF 123
            ++PK++P+H  +Y S+++L  P  +H+ M++L ++ L DI++N+Q EY  VV+  I++F
Sbjct: 99  TIVPKYYPDHEAFYKSEKYLNVPYPKHDFMKILPSLSLEDIIINDQSEYTEVVNSIIDQF 158

Query: 124 SQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDGRSA 183
            ++ G+ + K+ +I+++I IP  D  +PNWRLLC P+  ++ +  F+YI+NHC SDG S 
Sbjct: 159 VKDNGKITNKLSEIVSNICIPIYDQSRPNWRLLCLPDN-TDEYSNFVYISNHCCSDGTSG 217

Query: 184 ANLMRDLSEQLN--HVPE-TLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
            NL +DL + LN    PE T PDS +I+NY  D++ + KLP  I +R+DY+P +      
Sbjct: 218 INLFQDLVKSLNGKKSPEMTSPDS-LIYNYEKDFDKISKLPAAITDRVDYRPALWKLPQF 276

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPGCTMT 300
                 + +  Y S  P+ T+I+      ++++  LNF+ +++  I+  +K     CTMT
Sbjct: 277 MLSTLGKVFFSYKSPAPVSTKINMSKPQPSFHN-ILNFTPDELNKIRIAIKKN--ACTMT 333

Query: 301 PFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRY 360
            FLQ C   ++ + G   ++   E+ FD+ +  NT + LP++  + S YKYGSNVGG  Y
Sbjct: 334 SFLQTCLFITLKEHGIFANRKWNEFGFDITVPSNTRKDLPEEL-VTSQYKYGSNVGGLHY 392

Query: 361 NYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIMD 420
           ++LISSF + E+   FW L  YY  V   A     +L PLG +MLD +  K N+D +I D
Sbjct: 393 SFLISSF-IAEN---FWKLCSYYSAVLKQA----DFLRPLGTIMLDFVVNKQNIDSMISD 444

Query: 421 DLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNIV 480
             L K R G+ILSNVGYF+Q    D   + DL+  Q++G L  ++  N C+T++GGMNI 
Sbjct: 445 SYLNKKRGGIILSNVGYFEQND--DECEILDLMLMQNVGGLNFSYAVNICSTNLGGMNIC 502

Query: 481 ACAAQGSVASEHDWADVCELFK 502
               +G++    D+   C+  K
Sbjct: 503 LSIVEGTLKDRDDFNAFCDELK 524

>KNAG0H02650 Chr8 (492038..493672) [1635 bp, 544 aa] {ON} Anc_5.184
           YGR177C
          Length = 544

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/513 (38%), Positives = 292/513 (56%), Gaps = 28/513 (5%)

Query: 4   LKERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAY--ALRSICLQNPIL 61
           L ERGHAR +GHLENYF++ QRQ LY+NFS+Y + ++    +  A+  AL+ I  +NPIL
Sbjct: 32  LIERGHARRMGHLENYFALLQRQDLYSNFSIYGQFNRSIDVRSKAFLAALKDIFCKNPIL 91

Query: 62  VHQVLPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIE 121
           VH ++PK +P   EYY S+E+L +P  +H+ +++L  + L  +++N QE    VVSE I 
Sbjct: 92  VHTIVPKRYPYEEEYYRSEEYLNEPFPEHDYIKVLPRLSLESVILNFQETQQQVVSEIIA 151

Query: 122 EFSQNGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFP-------EGESNLWRKFIYITN 174
           ++ ++  Q    + ++++ IRIP  DP KPNW L+C P       + E   + K IY++N
Sbjct: 152 QYRRDDYQVKNVLTELVSQIRIPICDPGKPNWGLICLPMKVDDEKKEEGVRFGKVIYVSN 211

Query: 175 HCSSDGRSAANLMRDLSEQLNHVP-ETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPP 233
           HC +D  +  NL +D+   LN    E++ D   IF+YS D+  + K+P PI +RIDY+P 
Sbjct: 212 HCCADAMTGINLFQDIIANLNRATDESVSDDTTIFDYSVDHSAISKIPIPITDRIDYRPA 271

Query: 234 IXXXXXXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSR 293
           +           ++ Y  Y S  P   RI E  +N  ++S  +NF +EQM  I+  ++++
Sbjct: 272 LSSLPKFMVSTMLKKYFDYRSNAPETKRISE--QNANWHS-IVNFPSEQMDVIRTAVRTQ 328

Query: 294 LPGCTMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGS 353
             GC++T FLQ C   ++  SG   ++   E  FD+ +  +T ++LP D      YKYGS
Sbjct: 329 --GCSVTAFLQTCLSVALQNSGVFQNRRYSELGFDISVPSDTRRILPGDLAA-DQYKYGS 385

Query: 354 NVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSN 413
           NV G  Y+Y I SF   E    FW L  YY GV   A     YL  LG +MLD + +K N
Sbjct: 386 NVAGLHYSYFIPSFQETE----FWPLTQYYTGVLRGA----DYLIGLGTIMLDFVYKKQN 437

Query: 414 MDKVIMDDLLGKPRQGVILSNVGYF----QQKKETDGYYVRDLVFAQSLGSLRHTFVCNS 469
           +DK+I +  LG  R G+ILSNVG       +  + D + +RDL F Q +G L  ++V N 
Sbjct: 438 IDKLISESYLGNRRGGIILSNVGALVTGGAEATKADRWTLRDLKFVQDVGVLNFSYVVNV 497

Query: 470 CTTDVGGMNIVACAAQGSVASEHDWADVCELFK 502
            +T  GGMN+    AQGS+ S   +  VC  F+
Sbjct: 498 VSTPAGGMNVCLSCAQGSLPSRAQFDAVCAEFQ 530

>KLLA0F15202g Chr6 (1401627..1403180) [1554 bp, 517 aa] {ON} similar
           to uniprot|P53296 Saccharomyces cerevisiae YGR177C ATF2
           Alcohol acetyltransferase may play a role in steroid
           detoxification forms volatile esters during fermentation
           which is important in brewing
          Length = 517

 Score =  322 bits (825), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/510 (33%), Positives = 286/510 (56%), Gaps = 11/510 (2%)

Query: 6   ERGHARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQV 65
           ERGHAR  G++E    +  RQKLY+NF ++ EL    S  QLA+ALR++ L+ PIL   +
Sbjct: 12  ERGHARRAGYVEEVLLMEHRQKLYSNFVVHGELKSAASELQLAHALRALFLRYPILATTI 71

Query: 66  LPKHWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQ 125
           +P++W     YY S+ F  +P L  + + ++D + L D++MN+Q E+    +E + ++  
Sbjct: 72  IPEYWNEKETYYTSEAFYNKPGLAEDYVSVVDQLKLEDVIMNKQPEHSKFYNEILNQWEH 131

Query: 126 NGGQYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGE----SNLWRKFIYITNHCSSDGR 181
           +G +Y   +  +++       DP KP++RL+  P  +    +  ++  +YITNH +SDG 
Sbjct: 132 DGFKYGDDLSVVVSQYTFSCWDPTKPHFRLVLLPSADDKKGARGFKDILYITNHVTSDGT 191

Query: 182 SAANLMRDLSEQLNHVPET-LPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXX 240
           S ANL+ DLS +L     T L   + + +Y  DYE L KLPDPIE ++ Y          
Sbjct: 192 SGANLLEDLSIELGKFSGTNLQQLEYLLHYGRDYEQLPKLPDPIEEKVSYGVNPSFIASF 251

Query: 241 XXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSRLPG-CTM 299
                 +  L      P+   ID      ++ ++ +      M+ ++ ++K +L G  T+
Sbjct: 252 LLSQMGKKLLTKKWDQPITRPID--ASPASHMAHIIKIDPTGMQKMRARVKDKLNGKATL 309

Query: 300 TPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTR 359
           TPF+QACW  S Y++G    +   E+F ++ + MNT Q LP+DPE+R  ++YG+ VGGT 
Sbjct: 310 TPFMQACWFVSCYEAGLFDDRKWNEFFINMAVPMNTRQYLPEDPEVRDRFRYGTVVGGTN 369

Query: 360 YNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKSNMDKVIM 419
           +N+LISSFN+  ++  FW L +YYQ  F    E+       G L  D + + +N+DK+I 
Sbjct: 370 FNFLISSFNITSNQQ-FWDLTEYYQQWFTKTREEGLATKTFGTLFADFVSKSNNLDKLIK 428

Query: 420 DDLLGKPRQGVILSNVGYFQQK-KETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMN 478
            D++ + R   +LSNVGY  QK +E++ + ++DL+F+Q+   +   F     +TD+GGM+
Sbjct: 429 QDMMHQRRAFALLSNVGYRPQKAQESNPFQLQDLIFSQAACEMPFVFSLCCVSTDIGGMS 488

Query: 479 IVACAAQGSVASEHDWADVCELFKEQTLAL 508
           +     + S+ S+  W  +C++F++    L
Sbjct: 489 LTLTCCEESI-SQQQWHKICQVFEKNLTTL 517

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 49/95 (51%), Gaps = 20/95 (21%)

Query: 351 YGSNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSA-------MEKKHYLFPLGAL 403
           YGS+  G +      SFN+  D D   + +D+   + +S+        EK H    +  L
Sbjct: 620 YGSSNTGNKV-----SFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNH----IRRL 670

Query: 404 MLDSLREKSNMDKVIMDDLLGKPRQGV--ILSNVG 436
           +L+SLRE  NMDK+ +   L KPR+ V  +LS +G
Sbjct: 671 LLESLREADNMDKICIK--LQKPRKEVEELLSEIG 703

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 17/135 (12%)

Query: 350 KYG-SNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLD-- 406
           +YG + V G   ++ + SF  G D   FWS +DY     NS  +   Y+  L    L+  
Sbjct: 266 RYGFTYVQGAADDHELWSF--GLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLEYQ 323

Query: 407 -SLREKSNM-------DKVIMDDLLGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSL 458
            S+++K N+       DK+  +  LGK  QG+ ++     + +KE   +Y + ++F+ S+
Sbjct: 324 LSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINE----KLEKELKVHYEKVIIFSNSV 379

Query: 459 GSLRHTFVCNSCTTD 473
               H        TD
Sbjct: 380 AIAAHADSVEESRTD 394

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 432 LSNVGYFQQKKETDGYYVRDLVFAQSLGSLRHTFVCNSCTTDVGGMNI 479
           ++N+G    + + D ++V D +F  S  SL   F C   +TD GGMN+
Sbjct: 404 VTNLGRVSFETKNDNFFVEDALFGGS-QSLTTIFTCYVISTDFGGMNL 450

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 102/494 (20%), Positives = 179/494 (36%), Gaps = 89/494 (18%)

Query: 11  RPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQVLPKHW 70
           R L  LE +F    R  L++ F +  +L++     Q+A+ALRS    +P L HQ +    
Sbjct: 5   RKLSSLERFFYDRSRLNLHSCFFLGLQLNQLPDKHQIAHALRSTIANHPKL-HQNVAIDP 63

Query: 71  PNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQNGGQY 130
            +++ Y                ++ +D +   D+V                E+    G  
Sbjct: 64  EDNIPY----------------IKNVDTIKFDDVV----------------EYVSWDGFD 91

Query: 131 SKKIFDIIADIRIPYGDPLKPNWRLLCFP--------------EGESNL--WRKFIYITN 174
              I  I      PY    KP W++L +               +G S +  W+ F+   +
Sbjct: 92  DNTICHIFQTYNFPYNIE-KPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFM---S 147

Query: 175 HCSSDGRSAANLMRDLSEQLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRI-DYKPP 233
             SSD R   +L+ +L+      P    DS +  N+ + +     L   I   I  + P 
Sbjct: 148 SLSSDARDDFDLLYELTGD----PMVQEDSHVYENWPTSWSS--TLTKAIAGVIFKFMPS 201

Query: 234 IXXXXXXXXXXXVRDYLGYYSKGPLVTRIDEVGENKTYYSYFLNFSAEQMKTIKQKLKSR 293
           +              + GY     L+T      ++ + Y    N     ++     L   
Sbjct: 202 VITSVGKDQLR----FNGYSFPDSLLTH---KPDDDSSYEIRNNNRQLNLQVQPDHLNGI 254

Query: 294 LPGC-----TMTPFLQACWLTSMYKSGRVFSKSMREWFFDVVITMNTAQMLPDDPEL-RS 347
           +  C     ++T F+ A  L SM    ++           + I MNT     D  ++  +
Sbjct: 255 ISACKSHQVSLTSFITA--LISMSLQLKIEDGDYSGSKIMIDIPMNTRGACADVLDIPDT 312

Query: 348 MYKYGSNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDS 407
               G+ V G    Y     N+GE ++  W +    Q    +A+ K+     L  +    
Sbjct: 313 SVTMGNFVAGLNVEY-----NLGESEE-LWQIARTVQ----AALNKQTKTDILETVNKVR 362

Query: 408 LREKSNMDKVIMDDLLGKPRQGVI-LSNVGY--FQQKKETDGYYVRDLVFAQSLGSLRHT 464
           L + ++  + I   +      G   ++N+G+  F   +   GY V D VF +  G L   
Sbjct: 363 LLDVADTTEFIRQKVKATGPSGTFEVTNLGFQEFADAQSNHGYLVEDAVFNEPQG-LSDI 421

Query: 465 FVCNSCTTDVGGMN 478
           F C   +T  GG+N
Sbjct: 422 FTCCIISTPRGGLN 435

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 17/126 (13%)

Query: 350 KYG-SNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLD-- 406
           +YG + V G   ++ + SF  G D + FWS VDY      S  +   Y+  L A  L+  
Sbjct: 250 RYGFTYVQGAADDHELWSF--GLDSEMFWSHVDYLGDTDKSDDQLHDYITDLVAKKLENQ 307

Query: 407 -SLREKSNMDK------VIMDDL-LGKPRQGVILSNVGYFQQKKETDGYYVRDLVFAQSL 458
            S+++K ++D+      +I +++ LGK  QG+ +S     + K+E    Y + +VF+ S+
Sbjct: 308 LSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTIS----VKLKQELKLRYDKVIVFSDSV 363

Query: 459 GSLRHT 464
                T
Sbjct: 364 AITEDT 369

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 102/493 (20%), Positives = 180/493 (36%), Gaps = 93/493 (18%)

Query: 13  LGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQVLPKHWPN 72
           L  LE +F    +  L++ F +  +L++  S  ++  A+++   + P L   V+ K    
Sbjct: 4   LSGLEKFFYSRSKLGLHSCFLVAVQLNQSPSRSEICGAIKATVEECPHLYSDVVTKGELP 63

Query: 73  HLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQNGGQYSK 132
            LE   +++ L +  L++ D  LLD  + + I    +  YG+                  
Sbjct: 64  SLEPI-NEQILLEQVLEYTDYGLLDEDICNKIFREVEFTYGS------------------ 104

Query: 133 KIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDGRSAANLMRDLSE 192
                        G PL   W++L       N  R  +  T+H   DG S     +    
Sbjct: 105 -------------GKPL---WKVLVL-----NDRRTLVLCTDHVILDGLSTVAFWKKFLG 143

Query: 193 QLNHVPETLPDSDIIFNYSSDYEGLRKLPDPIENRIDYKPPIXXXXXXXXXXXVRDYLGY 252
            LN    T   S+++F  S     + + P       D  P             V  +L +
Sbjct: 144 SLNATASTSLVSEVVFEPSVHNSVVPQHP------YDRIPVTFFETMARALVQVLVFLAF 197

Query: 253 YSKGPLVTRIDEVGENKTY-----YSYFLNFSAE--QMKTIKQKLKSRLPGCTMTPFLQA 305
             K  L+T +      K Y     Y +  ++ A    ++   + LK  +P   +   L  
Sbjct: 198 L-KIDLITTLFVPPLQKQYLKFKNYQFTRDYLAADGSVRNDNRLLKIVIPPQKLQNLLAL 256

Query: 306 CWLTSMYKSGRVFS------KSMREWFFD-----VVITMNTAQMLPDD--PELRSMYKYG 352
           C   ++  S  + +      K +    FD     + I MNT   +      E +S+ ++G
Sbjct: 257 CKGHNVSLSSLILAIMANSLKHVDSSQFDGTRAKISIPMNTRPFIEKTLLAEPKSI-EFG 315

Query: 353 SNVGGTRYNYLISSFNVGEDKDAFWSLVDYYQGVFNSAMEKKHYLFPLGALMLDSLREKS 412
           + + G    Y +S      D    W    +++   + A+++       G++M   L    
Sbjct: 316 NFIVGGELEYDLS------DAGDLWQTAAHFR--HDLAVQRNVR----GSIMSTRL---- 359

Query: 413 NMDKVIMDDLLGK------PRQGVILSNVGYFQ-QKKETDGYYVRDLVFAQSLGSLRHTF 465
            +D V +D L+        P     L+N+G       E D Y+V D  F    G L   F
Sbjct: 360 -LDLVEVDHLMSVKASERYPSSTFELTNLGLQSFGCSENDKYFVVDSSFHNPQG-LSEVF 417

Query: 466 VCNSCTTDVGGMN 478
            C +  T VGG+N
Sbjct: 418 SCAAVATPVGGLN 430

>SAKL0E06710g Chr5 (548443..550347) [1905 bp, 634 aa] {ON} similar
           to uniprot|Q07528 Saccharomyces cerevisiae YDL113C ATG20
           Protein required for transport of aminopeptidase I
           (Lap4p) through the cytoplasm-to-vacuole targeting
           pathway binds phosphatidylinositol-3-phosphate involved
           in localization of membranes to the preautophagosome
           potential Cdc28p substrate
          Length = 634

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 6/103 (5%)

Query: 324 EWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRYNYLISSFNVGEDKDAFWSLVDYY 383
           E    +++ +    ++P  PE +S+  YG ++ G++ NYL+ S   G   D   S+++  
Sbjct: 197 ESLRKILVKLFPMTLIPPIPEKQSITSYGKSITGSKSNYLLPSEGAG-SVDLSLSVIN-- 253

Query: 384 QGVFNSAMEK--KHYLFPLGALMLDSLREKSNMDKVIMDDLLG 424
            G  N+  EK  +H +  L + +   L+ +      I+ D L 
Sbjct: 254 -GSVNTNDEKLIRHRIRMLTSFLNRLLKNEEITKTSIITDFLN 295

>KAFR0C04300 Chr3 complement(849932..855478) [5547 bp, 1848 aa] {ON}
            Anc_1.337 YBR275C
          Length = 1848

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 44   PKQLAYA---LRSICLQ-NPILVHQVLPKHWPNHLEYYASDEFLA 84
            P  L Y    L S C++ NPIL+  +LPK+  N  +++++DE LA
Sbjct: 984  PTLLEYGHKELVSDCVKKNPILIESLLPKYPDNLSDFFSADEILA 1028

>Kpol_1032.83 s1032 (178927..180960) [2034 bp, 677 aa] {ON}
           (178927..180960) [2034 nt, 678 aa]
          Length = 677

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 38/87 (43%), Gaps = 6/87 (6%)

Query: 94  RLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQNGGQYSKKIFDIIAD-----IRIPYGDP 148
           RLL NVL  DIV      YG+ +++ + EF+     Y ++I   + D         YG  
Sbjct: 550 RLLLNVLSKDIVNMSCNAYGSHIADKLWEFTAKLTVYKERIAQALVDETEKVKNSTYGRQ 609

Query: 149 LKPNWRLLCFPEGESNLWRKFIYITNH 175
           +  NW L  +     + W+K I    H
Sbjct: 610 VWKNWSLELYVRKRWD-WKKLIKEQEH 635

>TDEL0A03870 Chr1 (687098..689011) [1914 bp, 637 aa] {ON} Anc_5.523
           YDR419W
          Length = 637

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 44/87 (50%), Gaps = 10/87 (11%)

Query: 24  QRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQVLP-KHWPNHLEY------ 76
           + +K++  F+ YC+L++  S  ++   +  +CLQ  +   Q+LP K   N ++       
Sbjct: 134 ESRKIFKIFTEYCDLAEKASVDEVFLDIARLCLQKLMGSEQILPGKENHNTIQLMQQMFK 193

Query: 77  ---YASDEFLAQPTLQHEDMRLLDNVL 100
              Y SD FL     + ++++ + N+L
Sbjct: 194 DGTYDSDAFLPPVPEELKELKFVGNLL 220

>ADL293W Chr4 (187231..188964) [1734 bp, 577 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL113C
          Length = 577

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 26/49 (53%)

Query: 324 EWFFDVVITMNTAQMLPDDPELRSMYKYGSNVGGTRYNYLISSFNVGED 372
           E    ++I +    ++P  PE +S+  YG ++ G+  NY++ S   G D
Sbjct: 136 ESLRKILIKLFPMTLIPPIPEKQSLTSYGKSIAGSNANYVLPSEAAGCD 184

>NDAI0D02360 Chr4 (545485..546897) [1413 bp, 470 aa] {ON} Anc_5.119
           YGR212W
          Length = 470

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 71/191 (37%), Gaps = 37/191 (19%)

Query: 9   HARPLGHLENYFSITQRQKLYANFSMYCELSKPCSPKQLAYALRSICLQNPILVHQVLPK 68
           + R L  LEN+F       L++ F +   L+   + KQL  AL+      P L HQ + K
Sbjct: 3   NPRELSSLENFFYHRSEVNLHSCFYLALLLNALPAKKQLYKALQDTIATYPQL-HQNITK 61

Query: 69  HWPNHLEYYASDEFLAQPTLQHEDMRLLDNVLLSDIVMNEQEEYGTVVSEAIEEFSQNGG 128
           +          DE+L    ++   +   D V               V  E  EE      
Sbjct: 62  N--------KEDEYLYVEDIKKTPIEFEDVVEF-------------VAWEKFEE------ 94

Query: 129 QYSKKIFDIIADIRIPYGDPLKPNWRLLCFPEGESNLWRKFIYITNHCSSDGRSAANLMR 188
              K+I  I       Y +  +P W++L  P   +     FI + +H   DG SA  +  
Sbjct: 95  ---KEINSIFQTYNFHYRND-RPLWKILVVPSLNT-----FILLLDHALFDGISAVKIWE 145

Query: 189 DLSEQLNHVPE 199
              E+LN   E
Sbjct: 146 TFMEKLNKSSE 156

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,372,898
Number of extensions: 2431921
Number of successful extensions: 6042
Number of sequences better than 10.0: 38
Number of HSP's gapped: 6112
Number of HSP's successfully gapped: 38
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)