Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11396g6.14ON55055026650.0
Kwal_56.223876.14ON54355321380.0
SAKL0E01012g6.14ON54453319120.0
KLLA0D00979g6.14ON56147317870.0
TDEL0G045506.14ON56447717020.0
Smik_5.276.14ON60847316970.0
Skud_5.296.14ON60847516680.0
YEL060C (PRB1)6.14ON63547916700.0
Suva_5.76.14ON66448016680.0
TBLA0A073006.14ON57347316440.0
NCAS0F002206.14ON69543715960.0
ACR012C6.14ON54148215690.0
ZYRO0C07942g6.14ON54852515600.0
NDAI0K028806.14ON70448015540.0
Ecym_30186.14ON57548015180.0
CAGL0B03619g6.14ON46848614860.0
Kpol_1032.56.14ON68047615040.0
KAFR0L003606.14ON50243214360.0
KNAG0E009206.14ON53146914150.0
Kpol_1045.756.14ON47745113450.0
TPHA0M002306.14ON58547513111e-175
Smik_15.1726.14ON47842712771e-172
Suva_15.1786.14ON47642812511e-168
Skud_15.1646.14ON48242812441e-167
YOR003W (YSP3)6.14ON47842712401e-166
CAGL0E02651g6.14ON48543011361e-150
KAFR0B065506.14ON45642710121e-132
NCAS0D026306.14ON4514329281e-119
KNAG0F02970singletonON4204058691e-111
NDAI0I022806.14ON4824388321e-105
CAGL0L13266gsingletonON5794527073e-85
NCAS0D043906.313ON4924454892e-54
ZYRO0D08822g6.313ON4904054831e-53
Kpol_1018.56.313ON4654454794e-53
Suva_3.846.313ON5273534801e-52
TDEL0A072806.313ON4363044722e-52
Smik_3.1496.313ON4913524752e-52
SAKL0A02002g6.313ON4793664733e-52
Kpol_1028.616.313ON5183284745e-52
Skud_3.1246.313ON5403534748e-52
TBLA0F039706.313ON7343234811e-51
KLTH0A06094g6.313ON4963484657e-51
YCR045C (RRT12)6.313ON4913524639e-51
CAGL0L10802g6.313ON5173634632e-50
KNAG0I024706.313ON4754064568e-50
Ecym_21056.313ON6103164401e-46
KAFR0J024506.313ON4783904322e-46
AAR069W6.313ON7683034432e-46
Kwal_23.61836.313ON4933524262e-45
NDAI0I005606.313ON4834194173e-44
TPHA0D037606.313ON6073594102e-42
KLLA0F06028g6.313ON5083603963e-41
TBLA0A067006.313ON4973553542e-35
Kwal_33.133721.78ON3772883296e-33
KLTH0F02288g1.78ON3803153112e-30
Kpol_2000.691.78ON3863022962e-28
ZYRO0F16764g1.78ON3863172546e-23
TDEL0C062301.78ON3642932262e-19
TPHA0B045201.78ON3882772202e-18
TBLA0A054101.78ON3822691953e-15
Skud_14.1012.6ON81969840.14
YNL238W (KEX2)2.6ON81466810.36
NCAS0F004905.85ON98765800.38
Suva_14.1062.6ON80966800.42
TPHA0P017902.6ON79960790.52
SAKL0G00440g2.6ON83665790.58
ZYRO0F15598g2.6ON79065790.63
Smik_14.972.6ON81466780.74
NDAI0F038902.6ON83368771.1
KAFR0A080402.6ON76665761.1
NDAI0D026205.85ON98749761.2
KNAG0F007702.6ON82665761.2
ZYRO0B08140g5.85ON98452761.5
CAGL0J07546g2.6ON78960751.5
NCAS0A008802.6ON83368742.1
Kpol_1050.725.85ON98935742.1
Ecym_64862.6ON78165733.0
TDEL0G010905.85ON98346714.9
Kpol_1015.82.6ON84365715.1
TBLA0B001302.6ON84261707.3
TBLA0D027108.481ON58236698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11396g
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...  1031   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   828   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   741   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   692   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   660   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   658   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   647   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   647   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   647   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   637   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   619   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   608   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   605   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   603   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   589   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   577   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   583   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   557   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   549   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   522   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   509   e-175
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   496   e-172
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   486   e-168
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   483   e-167
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   482   e-166
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   442   e-150
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   394   e-132
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     362   e-119
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              339   e-111
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   325   e-105
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   276   3e-85
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   192   2e-54
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   190   1e-53
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   189   4e-53
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   189   1e-52
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   186   2e-52
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   187   2e-52
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   186   3e-52
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   187   5e-52
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   187   8e-52
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   189   1e-51
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   183   7e-51
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   182   9e-51
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   182   2e-50
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   180   8e-50
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   174   1e-46
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   171   2e-46
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   175   2e-46
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   168   2e-45
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    165   3e-44
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   162   2e-42
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   157   3e-41
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   140   2e-35
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   131   6e-33
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   124   2e-30
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   118   2e-28
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   102   6e-23
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    92   2e-19
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    89   2e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    80   3e-15
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    37   0.14 
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    36   0.36 
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    35   0.38 
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    35   0.42 
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    35   0.52 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.58 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.63 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    35   0.74 
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    34   1.1  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    34   1.1  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    34   1.2  
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    34   1.2  
ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly...    34   1.5  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    33   1.5  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    33   2.1  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    33   2.1  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    33   3.0  
TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.8...    32   4.9  
Kpol_1015.8 s1015 complement(19725..20576,20692..20940,20990..20...    32   5.1  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    32   7.3  
TBLA0D02710 Chr4 (669879..671627) [1749 bp, 582 aa] {ON} Anc_8.4...    31   8.1  

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score = 1031 bits (2665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/550 (92%), Positives = 508/550 (92%)

Query: 1   MKLQTXXXXXXXXXXXXXXXXPDLEEASNTVALKVKDVITAGESIVSSFSKQMTKDAASK 60
           MKLQT                PDLEEASNTVALKVKDVITAGESIVSSFSKQMTKDAASK
Sbjct: 1   MKLQTALPVAVVASVGAALVLPDLEEASNTVALKVKDVITAGESIVSSFSKQMTKDAASK 60

Query: 61  XXXXXXXXXXXXXXKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEF 120
                         KYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEF
Sbjct: 61  GESVELSPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEF 120

Query: 121 FTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPL 180
           FTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPL
Sbjct: 121 FTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPL 180

Query: 181 VDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTG 240
           VDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTG
Sbjct: 181 VDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTG 240

Query: 241 VNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 300
           VNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYG            LRSN
Sbjct: 241 VNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 300

Query: 301 GSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH 360
           GSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH
Sbjct: 301 GSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH 360

Query: 361 FAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG 420
           FAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG
Sbjct: 361 FAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG 420

Query: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV 480
           SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV
Sbjct: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV 480

Query: 481 LGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEI 540
           LGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEI
Sbjct: 481 LGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEI 540

Query: 541 REVFDHMNII 550
           REVFDHMNII
Sbjct: 541 REVFDHMNII 550

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/553 (73%), Positives = 449/553 (81%), Gaps = 13/553 (2%)

Query: 1   MKLQTXXXXXXXXXXXXXXXXPDLEEASNTVALKVKDVITA-GESIVSSFSKQMTKDAAS 59
           MKLQT                P++EEAS    + V++   + GESI+SSFSK++TK AA 
Sbjct: 1   MKLQTTLPVAMVAALASALVLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAAE 60

Query: 60  KXXXXXXXXXXXXXXKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHE 119
                           Y AIPHRYIVVFK  + PEEVDFH ++VSEAH QSV KL++   
Sbjct: 61  SGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDA 120

Query: 120 FFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNP 179
           FF +T          +D +    A +REGGI DSFDV+G+L GYIGYFT EIVDFIRMNP
Sbjct: 121 FFEAT----------MDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNP 170

Query: 180 LVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDT 239
           LV FVEQDS+V+A EF TQNGAPWGLSRISHREKLNLGSFNKYLYDD AGKGVTSYVIDT
Sbjct: 171 LVAFVEQDSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDT 230

Query: 240 GVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 299
           G+N+DHKDFEGRA+WGKT+PTNDLDQDGNGHGTHCAGTIASKHYG            LRS
Sbjct: 231 GINIDHKDFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRS 290

Query: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359
           NGSGSMSDVVKGVEFAAKSHQDAVK+NKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI
Sbjct: 291 NGSGSMSDVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 350

Query: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 419
           HFAVAAGNENQDACNSSPA+AENA+TVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI
Sbjct: 351 HFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 410

Query: 420 GSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKN 479
           GS+TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKN
Sbjct: 411 GSETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKN 470

Query: 480 VLGDIPDDTVNYLIFNGGGEGLDDFWGK--ESVVDEVEDTISSEIESFIDALEEKTDVLY 537
            LGD+P+DTVNYLI+NGGG+ LDDFW K  E  V + +D  +SE ES IDALEEKTD LY
Sbjct: 471 ALGDLPEDTVNYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALEEKTDGLY 530

Query: 538 EEIREVFDHMNII 550
           EEIRE+F+ +NII
Sbjct: 531 EEIREIFEGLNII 543

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/533 (67%), Positives = 436/533 (81%), Gaps = 15/533 (2%)

Query: 22  PDLEEASNTVALKVKDVITAGESIVSSFSKQMTKDAASKXXXXXXXXXXXXXXKYLAIPH 81
           P+++++S  V+  VK++ +  + +++SF+K++T+ AA K                  IPH
Sbjct: 23  PEVDKSSKDVS--VKEINSDSQEVLASFAKEITRAAAEKGEEVKLAPLVSSPQPANIIPH 80

Query: 82  RYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSF 141
           RYI+VFK++ +PEE+ FHK+I+SEAH +SVAKL+S   FF +T+   +        +   
Sbjct: 81  RYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKGSAD--------EYGI 132

Query: 142 SAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGA 201
           +A++ EGGIQ+SFD++ +L GYIGYFTDE+VDFIRMN  V+F+E+DS+VFA EF TQNGA
Sbjct: 133 AAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSLVFASEFDTQNGA 192

Query: 202 PWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTN 261
           PWGLSRISHRE+LNLGSFNKYLYDDDAGKGVTSYVIDTG+NV+HKDF GRA WGKT+P N
Sbjct: 193 PWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFNGRAVWGKTVPQN 252

Query: 262 DLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQD 321
           D D DGNGHGTHCAGTIAS+HYG            LRSNGSG+MSDVVKGVEFAA+SHQ+
Sbjct: 253 DEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVVKGVEFAAQSHQE 312

Query: 322 AVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAE 381
           A K+NKKGFKGSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SPA+AE
Sbjct: 313 ASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAE 372

Query: 382 NAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGL 441
           NA+TVGASTL+DDRAYFSNWGKCVDIFAPGLNVLSTYIGS+TATATLSGTSMASPHVAGL
Sbjct: 373 NAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGL 432

Query: 442 LTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGL 501
           LTYFLSLQPDSDSE+F A+ GITP+QLKKKLIAYSTK+VL ++P+DT NYLI+NGGG+ L
Sbjct: 433 LTYFLSLQPDSDSEFFQAS-GITPAQLKKKLIAYSTKDVLYELPEDTPNYLIYNGGGQDL 491

Query: 502 DDFWGK--ESVVDE--VEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
            DFWGK  E V +E  ++D    ++   I++ + KTD+L+EE+R VFD +NII
Sbjct: 492 SDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSVFDKLNII 544

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/473 (69%), Positives = 393/473 (83%), Gaps = 9/473 (1%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYI+VFK++ S +EV FH+++VS  H +++  L     FFT+T    E  +F +   
Sbjct: 97  IPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSG--EHSEFGV--- 151

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
               A + EGGIQDSFD++G L+GY+GYFT E++DFIR +PLV+FVE+DS+VF+  F TQ
Sbjct: 152 ---KAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQ 208

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHREKLNLGSFNKYLYDDDAGKGVT+YV+DTGVNV+HKDF+GRA WGKTI
Sbjct: 209 NSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTI 268

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P +D D DGNGHGTHCAGTI S HYG            LRSNGSG+MSDVVKGVE+ A++
Sbjct: 269 PKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEA 328

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H+ AV+E KKGFKGSTANMSLGGGKSPALD+AVNAAVKAG+HFAVAAGNENQDACN+SPA
Sbjct: 329 HKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPA 388

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           +AENA+TVGASTL+D+RAYFSNWGKCVDIF PGLN+LSTYIGSDTATATLSGTSMA+PHV
Sbjct: 389 AAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHV 448

Query: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498
            GLLTYFLSLQPD+DSEYFHAAGGITPSQLKKKLI +STKNVL D+P+DTVNYLI+NGGG
Sbjct: 449 VGLLTYFLSLQPDADSEYFHAAGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGG 508

Query: 499 EGLDDFWGKE-SVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           + LDD WGK+ S+  E        +ES I++L+ KTD +++++R++ D  NII
Sbjct: 509 QDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/477 (68%), Positives = 376/477 (78%), Gaps = 26/477 (5%)

Query: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137
           A PHRYIVV K + SPEE+  H + ++++ LQSV +L     FF++              
Sbjct: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSA-------------- 154

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
                     GGIQDSFDV+GLL GY+GYFTD +V+ IR +P+VDFVE DS V A EF T
Sbjct: 155 ----QGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDT 210

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           QNGAPWGLSRISHRE+LNLGSFNKYL+DD+AGKGVTSYVIDTG+NV H+DFEGRA WGKT
Sbjct: 211 QNGAPWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKT 270

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IPTND D DGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGVEFAA+
Sbjct: 271 IPTNDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQ 330

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
           SHQ AVK+ KKGFKGSTANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQDACN+SP
Sbjct: 331 SHQKAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSP 390

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           A+AE AVTVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIGSD ATATLSGTSMASPH
Sbjct: 391 AAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPH 450

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNG 496
           VAGLLTYFLSLQPDSDS++F A   G+TP QLKKKLIAYSTK++L D+P+DT N LI+NG
Sbjct: 451 VAGLLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNG 510

Query: 497 GGEGLDDFW---GKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           GG GL  FW    K+      +DT   +++   D L  KTD L++++R+V D +NII
Sbjct: 511 GGHGLKGFWDGHDKQEANTRFQDT---DLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/473 (68%), Positives = 374/473 (79%), Gaps = 17/473 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYIVVFK+ +  EEV+FHK+ V +A LQSV  L +   FFTST      RD      
Sbjct: 152 IPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTST------RD------ 199

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
            ++ + +  GGIQDSF++  + +GYIGYFT EI+D IR NPLVDFVE+DSVV A EF TQ
Sbjct: 200 -TYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDTQ 258

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDTGVN++HKDFE RA WGKTI
Sbjct: 259 NSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTI 318

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVKGVE+AAK+
Sbjct: 319 PLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKA 378

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           HQ   +E KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQDACN+SPA
Sbjct: 379 HQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPA 438

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASPHV
Sbjct: 439 SADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 498

Query: 439 AGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           AGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK++L DIP+DT N+LI+NGG
Sbjct: 499 AGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNGG 558

Query: 498 GEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G+ L  FW                ++ FI +   KTD+L+E++R+V D +NII
Sbjct: 559 GQDLSAFWNDTKKSHPSGSKHELNMDEFIGS---KTDLLFEQVRDVLDKLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/475 (67%), Positives = 374/475 (78%), Gaps = 21/475 (4%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYI+VFK+ +  E  DFHK+ V +A LQSV  L +   FF ST      RD  L   
Sbjct: 152 IPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFIST------RDSSL--- 202

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
               + +  GGIQDSF++  + +GYIGYFT EI+D IR NPLVDFVE+DSVV A +F TQ
Sbjct: 203 ----STSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATDFDTQ 258

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDTGVNV+HKDFE RA WGKTI
Sbjct: 259 NSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI 318

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVKGVE+AA++
Sbjct: 319 PLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAARA 378

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           HQ   +E KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQDACN+SPA
Sbjct: 379 HQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPA 438

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SA+ A+TVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIGSD ATATLSGTSMASPHV
Sbjct: 439 SADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHV 498

Query: 439 AGLLTYFLSLQPDSDSEYFHAA-GGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           AGLLTYFLSLQP SDSE+F      +TP QLK KLI YSTK++L D+P+DT N LI+NGG
Sbjct: 499 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNALIYNGG 558

Query: 498 GEGLDDFWG--KESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G+ L  FW   K+S     +  ++  ++ FI +   KTD+++E++R+V D +NII
Sbjct: 559 GQDLSAFWNDTKKSHSSRFKQELN--MDEFIGS---KTDLIFEQVRDVLDKLNII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/479 (67%), Positives = 369/479 (77%), Gaps = 29/479 (6%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYI+VFK+    EE+DFHK+ V +A LQSV  L +   FF ST      +D  L   
Sbjct: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFIST------KDTSL--- 229

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
               + +  GGIQDSF++  L +GYIGYFT EIVD IR NPLVDFVE+DS+V A EF TQ
Sbjct: 230 ----STSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQ 285

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDTGVN++HKDFE RA WGKTI
Sbjct: 286 NSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTI 345

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVKGVE+AAK+
Sbjct: 346 PLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKA 405

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           HQ   +E KKGFKGSTANMSLGGGKSPALD+AVNAAV+ GIHFAVAAGNENQDACN+SPA
Sbjct: 406 HQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPA 465

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASPHV
Sbjct: 466 SADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHV 525

Query: 439 AGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           AGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK++L DIP+DT N LI+NGG
Sbjct: 526 AGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGG 585

Query: 498 GEGLDDFWGKESVVDEVEDTISSEIESFIDALE------EKTDVLYEEIREVFDHMNII 550
           G+ L  FW          DT  S    F   L        KTD++++++R++ D +NII
Sbjct: 586 GQDLSAFW---------NDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/480 (67%), Positives = 377/480 (78%), Gaps = 30/480 (6%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYI+VFK+++ PEE  FH++ V +A LQSV  L +   FF ST      RD  L   
Sbjct: 207 IPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFIST------RDAAL--- 257

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
               + +  GGIQDSF++  L +GYIGYFT EIVD IR NPLVDFVE+DSVV A +F TQ
Sbjct: 258 ----SSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEATDFDTQ 313

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+R+SHRE+LNLGSFNKYLYDDDAG+GVTSYVIDTGVNV+HKDFE RA WGKTI
Sbjct: 314 NSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAIWGKTI 373

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE+AAK+
Sbjct: 374 PLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVEYAAKA 433

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           HQ   +E KKGFKGSTANMSLGGGKSPALD+AVNAAV+AGIHFAVAAGNENQDACN+SPA
Sbjct: 434 HQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSPA 493

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SA+ A+TVGASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASPHV
Sbjct: 494 SADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHV 553

Query: 439 AGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           AGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK++L DIPDDT N LI+NGG
Sbjct: 554 AGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNALIYNGG 613

Query: 498 GEGLDDFWGKESVVDEVEDTISS-------EIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G+ L  FW      ++ + + SS        ++ FI +   KTD+++E++R+V D +NII
Sbjct: 614 GQDLSAFW------NDTKKSHSSSGFKQELNLDEFIGS---KTDLIFEQVRDVLDKLNII 664

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/473 (65%), Positives = 370/473 (78%), Gaps = 25/473 (5%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IPHRYI+ FK++++PEE+DFH+Q ++E   QS+A+L   H +F S E         LD Q
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEG--------LDLQ 176

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
           +          I DSF+++ LL GYIGYFTD+++DFIR+NPLV FVEQDS V   EF TQ
Sbjct: 177 QP---------IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQ 227

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           NGAPWGL+RISHRE+LNLGSFNKYL+DD AG+GVT+YVIDTGVNV+H DFEGRASWGKTI
Sbjct: 228 NGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTI 287

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGVE+A  S
Sbjct: 288 PNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATAS 347

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H   VK  K GFKGSTANMSLGGGKSP+LD+AVNAAVKAGIHFAVAAGNENQDACN+SPA
Sbjct: 348 HLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPA 407

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASPHV
Sbjct: 408 SAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHV 467

Query: 439 AGLLTYFLSLQPDSDSEYFHA-AGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           AGLL+YFLSLQP+ DSE+  +  GGITP+QLKK+LI+Y TK++L DIP+ T N L+FNG 
Sbjct: 468 AGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGA 527

Query: 498 GEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G+ L DFW     + +  D  S+E+   +D +    DVLY++   +F  MN++
Sbjct: 528 GQDLSDFWN----ISKPADLESNEVYKNLDLV---GDVLYDQFTGIFKKMNLL 573

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/437 (68%), Positives = 351/437 (80%), Gaps = 15/437 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYIVVFK+++ PEEVDFHK+++++  L+S AKL    +FF+++   +ED        
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASA--IEDESI----- 151

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
                   +GGI  +F++S LL GY+GYFTDE+++ IRMNPLV++VE+DS+V A EF  Q
Sbjct: 152 -------NQGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQ 204

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHRE+LNLGSFNKYLYDDDAGKGVT YVIDTG+N +H DF  RA WGKTI
Sbjct: 205 NNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTI 264

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTHCAGTIAS HYG            LRSNGSGSMSDV+KGVEFAA+S
Sbjct: 265 PLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAES 324

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H  A KE KKGFKGSTANMSLGGGKSP LD+AVNAAV AGIHFAVAAGNENQDACN+SPA
Sbjct: 325 HIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPA 384

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
           SAE A+TVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIG D ATATLSGTSMASPHV
Sbjct: 385 SAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHV 444

Query: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498
           AGLLTYFLSLQP SDSE+F     +TP+Q+KKKLI YS+K+VL D+P+ T N LIFNG G
Sbjct: 445 AGLLTYFLSLQPGSDSEFFDPT-ELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAG 503

Query: 499 EGLDDFWGKESVVDEVE 515
             LDD W K+S  ++++
Sbjct: 504 GNLDDLWNKKSQEEDIK 520

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/482 (61%), Positives = 363/482 (75%), Gaps = 19/482 (3%)

Query: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137
           AIPH+YIVVF++ +S EE  FH ++V  AH +SVA+L+  H FF ST    E+ +F +  
Sbjct: 70  AIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG--ENNEFGIAA 127

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
            R+      EGGI+  F +   L GY+GYFT+++V  +R NP V FVE+DS+VFA +F T
Sbjct: 128 TRA------EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           QNGAPWGL+R+SHREKLN GSFNKYLYDD++G+GVTSYVIDTG+N+DH DFE RA WGKT
Sbjct: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKT 241

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IP ND D DGNGHGTHCAGTIASK YG            LRSNG+GSMSDV++GVE+A K
Sbjct: 242 IPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVK 301

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
           +H+ A ++  KGFKGSTANMSLGGG+S ALD+AV+AAV AGIHFAVAAGNENQDACN+SP
Sbjct: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSP 361

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           A+++ A+TVGASTLADDRAYFSNWG+CVD+FAPG+N+LSTYIGSDTA ATLSGTSMASPH
Sbjct: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPH 421

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           VAGLLTYFLSLQPD DSE F     I+P  LKKK+I + TK+ L  +P  T N LI+NGG
Sbjct: 422 VAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480

Query: 498 GEGLDDFWG---------KESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMN 548
           G  L DFWG         K +  D+ E+ + S+++  I  LE  TD ++   R + D MN
Sbjct: 481 GADLSDFWGNKPKKVSGPKFTYADD-EEAMGSDLDRLIHELESSTDAMFSGFRTILDRMN 539

Query: 549 II 550
           II
Sbjct: 540 II 541

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/525 (57%), Positives = 379/525 (72%), Gaps = 26/525 (4%)

Query: 37  DVITAGESIV-SSFSKQMTKDAASKXXXXXXXXXXXXXXKYLAIP--------HRYIVVF 87
           D +  GES+V +SF K  +KD  +                 L +P        +RYI++F
Sbjct: 39  DDVNNGESVVATSFEKGPSKDELAVFASKLTQEVQDRFAP-LVVPEDTLGVLENRYIILF 97

Query: 88  KQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTRE 147
           K+ ++P+E+ FH++++ + HLQ V++L   H FF   E    D  ++          +  
Sbjct: 98  KKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFF---EGIRLDGVYD----------SPL 144

Query: 148 GGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSR 207
           GGI  +FD++G+L GY GYF  +++D IRM+PL++ VEQDSVV+ Q+  T+NGAPWGL+R
Sbjct: 145 GGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLAR 204

Query: 208 ISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDG 267
           ISHRE+LNLGS+NKYLYD+  G GVTSYVIDTGVNV H  F GRA WGKTIP  DLD+DG
Sbjct: 205 ISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDG 264

Query: 268 NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKENK 327
           NGHGTHCAGTI S  YG            LRSNGSGSMSDV+KGVE+AA+ HQ+AVK+ K
Sbjct: 265 NGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKK 324

Query: 328 KGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVG 387
            GFKGSTANMSLGGGKSP+LD AVNAAV AG++FAVAAGNE+QDACN+SPASA   +TVG
Sbjct: 325 PGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVG 384

Query: 388 ASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLS 447
           ASTL+DDRAYFSN+GKCVD+FAPGLN+LSTYIGSD++TATLSGTSMASPHVAGLL YFLS
Sbjct: 385 ASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLS 444

Query: 448 LQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGK 507
           LQP SDSE F A   I+P QLKKKL+A+STK+VL DIP  T N LI+NGGG  L  FWG 
Sbjct: 445 LQPGSDSE-FDAGSSISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGS 503

Query: 508 ESVVDEVE--DTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           + V  E+E  + +  E+   +D L  KTD ++ +IR + D ++II
Sbjct: 504 KEVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/480 (62%), Positives = 365/480 (76%), Gaps = 22/480 (4%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           +P++YI+VFK +++ +E+ +HK+++SE   QS ++L   H FF ST              
Sbjct: 239 LPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHST-------------S 285

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
                  R GGI  SF+++ +L+GY GYFT E++D IR+NPLV +VE+DS+V   EF TQ
Sbjct: 286 EEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQ 345

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGLSRISHRE+LNLGSFNKYLYDDDAGKGVT +VIDTG+NV+H DF  RA WGKTI
Sbjct: 346 NNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTI 405

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P+ND D DGNGHGTHCAGTIAS HYG            LRSNGSGSMSDV+KGVEFAA++
Sbjct: 406 PSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAET 465

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H +  K NKK +KGSTANMSLGGGKSP LD+AVNAAV+AGIHF+VAAGNENQDACNSSPA
Sbjct: 466 HLNNEK-NKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPA 524

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATATLSGTSMASPH 437
           SAENA+TVGASTL+DDRAYFSNWG+CVD+FAPGLN+LSTY+G  +  TATLSGTSMASPH
Sbjct: 525 SAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPH 584

Query: 438 VAGLLTYFLSLQPDSDSEYFHAA--GGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495
           VAGLLTYFLSLQPDS S +F++   G ITP QLKKKLIAYST ++L D+PD T N LI+N
Sbjct: 585 VAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYN 644

Query: 496 GGGEGLDDFWG---KESVVDEV--EDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G G  + D W    +E   +E   ED I+ E     D++  KTD+ +++IR VF+ MNII
Sbjct: 645 GAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFDQIRNVFEKMNII 704

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/480 (59%), Positives = 354/480 (73%), Gaps = 19/480 (3%)

Query: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137
           AIPHRYIV+FK  ++  +V  H+ +V+ AH++++A+L+  H FF +TE           +
Sbjct: 108 AIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGM---------H 158

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
               SA++ EGGI++ F+++G L GY GYFTD ++D IR + LV  +EQDS+V A +F T
Sbjct: 159 HEGISARSVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFET 218

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           Q GAPWGL+R+SHRE+LNLGSFNKYLYDD+AGKGVT+YVIDTG+N+DH +FEGRA WGKT
Sbjct: 219 QTGAPWGLARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKT 278

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IP+ND D DGNGHGTHCAGTIASK YG            LR+NG+G+MSDV++GVE+   
Sbjct: 279 IPSNDADYDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVA 338

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
            H+ A       FKGSTANMSLGGGKS AL++AV+AAV AGIHFAVAAGNENQDACN+SP
Sbjct: 339 EHRKA--SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSP 396

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           AS++  +TV ASTL+DDRAYFSNWG CVDIFAPGLN+LSTYIGSDTA ATLSGTSMASPH
Sbjct: 397 ASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPH 456

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           VAGLL YFLSLQPDS SEY+     I+P  LKKK++AY +KN+L ++P  T N LIFNGG
Sbjct: 457 VAGLLAYFLSLQPDSGSEYY-TGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGG 515

Query: 498 GEGLDDFWGKESVVDEVEDTISS-------EIESFIDALEEKTDVLYEEIREVFDHMNII 550
           G  LD FW  +    E E   SS       E ES +D L   +  L+ EIR   D +++I
Sbjct: 516 GGSLDSFWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/486 (60%), Positives = 357/486 (73%), Gaps = 33/486 (6%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           +PH+YIVV K+ +SPE V      VS AH  ++  L   H+FF    NFV          
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFF----NFVNAEGLP---- 53

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
                    GGI+D F+++ L  G IGYF + +V  +  + +V+FVE+DSVV A  F TQ
Sbjct: 54  --------RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQ 105

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHR++LNLG+FNKYLYD+  G+GVT+YVIDTG+NV H +F+GRA WGKTI
Sbjct: 106 NNAPWGLARISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTI 165

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P NDLD DGNGHGTHCAGTIASKHYG            L+S+GSG+MSDV+KGVE+AA++
Sbjct: 166 PLNDLDIDGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQA 225

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H    K NKK FKGSTANMSLGGGKSPALDMAVNAAV AGIHFAVAAGNENQDACN+SPA
Sbjct: 226 HLKESKNNKK-FKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPA 284

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATATLSGTSMASPH 437
           SAE A+TVGASTL+DDRAYFSNWGKCVDIFAPGLN+LSTYIG ++  TA+LSGTSMASPH
Sbjct: 285 SAEKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPH 344

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAG-GITPSQLKKKLIAYSTKNVLGDIPD-DTVNYLIFN 495
           VAGLLTYFLSLQPDSDSE++ A+  G+TP+QLKKKLIAYSTKNVL D+PD D+ N LI+N
Sbjct: 345 VAGLLTYFLSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYN 404

Query: 496 GGGEGLDDFWGK----ESVVDEVEDTISSEIESFIDALEE-------KTDVLYEEIREVF 544
           G G  L  FW      E   +  E  I++E+   +D+L +        TD L+ ++R + 
Sbjct: 405 GAGGDLGVFWNSTSADEQSAEHPEQRIAAELG--LDSLAKMVGDRHAATDSLFGQVRNLL 462

Query: 545 DHMNII 550
           D MNII
Sbjct: 463 DKMNII 468

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/476 (59%), Positives = 361/476 (75%), Gaps = 29/476 (6%)

Query: 77  LAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELD 136
           L IP++YI+VFK+++S +++  HK +++ A  Q  +  + T                   
Sbjct: 230 LVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDET------------------- 270

Query: 137 YQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFG 196
                 + +  GGI+++F+V+ L  GYIG+F +++V FIR++P+VDFVEQDS+V A E  
Sbjct: 271 ------SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVD 324

Query: 197 TQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGK 256
           TQN APWGL+RISHR+ LNLGS+NKYLYDD AG+GVT+YVIDTG+N+ HK+F GRA WGK
Sbjct: 325 TQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGK 384

Query: 257 TIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAA 316
           TIP ND D DGNGHGTHCAGTIASK+YG            LRS+GSG+MSDV+KGVE+AA
Sbjct: 385 TIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAA 444

Query: 317 KSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSS 376
            SHQ A++E KKGFKGSTANMSLGGGKS +LD+AV+AAVK+GIHFAVAAGNENQDACNSS
Sbjct: 445 FSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSS 504

Query: 377 PASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASP 436
           PA++ENA+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGSD ATATLSGTSMASP
Sbjct: 505 PAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASP 564

Query: 437 HVAGLLTYFLSLQPDSDSEYFHA-AGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495
           HVAGLL+YFLS+QPD+DSE+F + +  I+P+QLKKKLIAYSTKN+  D+P+ T N L++N
Sbjct: 565 HVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN 624

Query: 496 GGGEGLDDFW--GKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNI 549
             G  + DFW    ES  +  E     E+E  +D+ +   D     I++VF+ M++
Sbjct: 625 -AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/432 (63%), Positives = 328/432 (75%), Gaps = 15/432 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IPHRYI+VFK  +S E++ FHK++++  HLQ  +           + +F E    + D  
Sbjct: 58  IPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAF---------SNDFTEY--LQTDIN 106

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
              S +   GGI   FD+S LL+GYI Y +DE++ FIR+NPL+ F+E D++V   +F TQ
Sbjct: 107 VPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQ 166

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           N APWGL+RISHRE LNL +FNKYLYDDDAGK V +YVIDTGV+V+H +F  RA WGKTI
Sbjct: 167 NNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTI 226

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND D DGNGHGTH AGTI S+HYG            LRSNGSGSMSDVVKGVEFA  S
Sbjct: 227 PLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSS 286

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H + +K N+K  KGS ANMSLGGGKSPALD+AVNAAVKAGIHFAVAAGNENQ+ACNSSPA
Sbjct: 287 HLERMK-NEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPA 345

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-DTATATLSGTSMASPH 437
           SAE AVTVGAST++D+RAYFSNWG+CVDIFAPGLN+LSTYIG+ D  TATLSGTSMASPH
Sbjct: 346 SAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPH 405

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           VAGLL Y+LSLQP+  SE+  +   I+ SQLKKKLI Y+TK+VL D+P+ T N LI+NGG
Sbjct: 406 VAGLLAYYLSLQPEKSSEF--STRAISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGG 463

Query: 498 GEGLDDFWGKES 509
           G+ L DFW  ++
Sbjct: 464 GQDLSDFWNLQN 475

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/469 (57%), Positives = 332/469 (70%), Gaps = 34/469 (7%)

Query: 82  RYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSF 141
           +YI++FK+ ++ E++  HKQ++ +  L++                               
Sbjct: 97  KYIILFKEGVTAEQISAHKQLLQQVLLET----------------------------SDV 128

Query: 142 SAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGA 201
           SAQ     + DSFD+ G+L+GY+   +  +++ +R +P V  VEQDS V   EF TQN A
Sbjct: 129 SAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNA 188

Query: 202 PWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTN 261
           PWGL+RISHR+ L+LGSFNKYLYDD AG+GV SY+IDTG+NV HK+FEGRA WGKTIP N
Sbjct: 189 PWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDN 248

Query: 262 DLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQD 321
           D D+DGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+ GVEFAAK H  
Sbjct: 249 DFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHAS 308

Query: 322 AVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAE 381
             K N K FKGSTANMSLGGGKSP+LD  V+AAVK G+HF+VAAGNENQDACN+SPA++E
Sbjct: 309 KAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASE 368

Query: 382 NAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGL 441
            A+TVGASTL+DDRAYFSNWG CVDIFAPGLN+LSTY GSD ATATLSGTSMASPHVAGL
Sbjct: 369 RAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGL 428

Query: 442 LTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGL 501
           LTYFLSLQP+  S+ F  +  ITP QLKKKL+ YSTK VL D+P+DT N LI+NGGG  L
Sbjct: 429 LTYFLSLQPEKSSQ-FGTSAQITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADL 487

Query: 502 DDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEEIREVFDHMNII 550
            DFWG     D+ + +         D +   +D ++E++R +F  +NI 
Sbjct: 488 SDFWG-----DKGKKSHKPLFAHEYDNVWASSDAMFEQVRAMFGKLNIF 531

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/451 (57%), Positives = 318/451 (70%), Gaps = 18/451 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFT-STENFVEDRDFELDY 137
           IP+ YIVVF + ++  E+  H + +S+  LQSV  L   HEFFT ST + V         
Sbjct: 35  IPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL--- 91

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
                     GG++D F +   L GY G FTDE+V+F+R++PLV F+E+DS+V   E  T
Sbjct: 92  ----------GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATT 141

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           Q  APWGL+RISHR +LNL +FNKYLYDD  GKGV +YVIDTG+N+ + DF GRA WGKT
Sbjct: 142 QYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKT 201

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IP  + + DGNGHGTH AGTIAS HYG            LRSNG+GSMSDV+KGVE+   
Sbjct: 202 IPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVG 261

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
           +HQ  V     GFKGS ANMSLGGGKS +LD+AVNAAV AG+HFAVAAGNENQDACN+SP
Sbjct: 262 AHQRDV--GTAGFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSP 319

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           A+AE A+TVGASTL+D RAYFSNWG+CV IFAPGLN+LSTYIGS  ATATLSGTSMASPH
Sbjct: 320 AAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPH 379

Query: 438 VAGLLTYFLSLQPDSDSEYFH--AAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495
           +AGL+ YFLSLQP   S+++    A  ITP QLKKK++A+ TKN L D+P +T N + +N
Sbjct: 380 IAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYN 439

Query: 496 GGGEGLDDFWGKESVVDEVEDTISSEIESFI 526
           G G+ L+DFW     V   +  + +E   FI
Sbjct: 440 GAGKSLEDFWNANDYVKNYQSLVITEQLQFI 470

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  509 bits (1311), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 268/475 (56%), Positives = 339/475 (71%), Gaps = 32/475 (6%)

Query: 82  RYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSF 141
           RYI+VFK+ +  E+VD H +++S     ++ +  S  +   +       RD    + R  
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMS-----ALFRRLSEEQRPAAAPGASALRD---GFDR-- 184

Query: 142 SAQTREGGIQDSFDVSGLLTGYIGYF-TDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNG 200
                   + D+F+V+G  +GYI    + +IVDFIR+NPLVD+VE+DSVV + +  TQN 
Sbjct: 185 --------VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNN 235

Query: 201 APWGLSRISHREKLNLGSFNKYLY-DDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIP 259
           APWGL+RISHRE LNLG+FNKYLY  + AGKGVT+YV+DTG++V H +F  RA WGKTIP
Sbjct: 236 APWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIP 295

Query: 260 TNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSH 319
            ND D DGNGHGTHCAGTI S+HYG            LRS+GSG+MSDV+KGVE+ A  H
Sbjct: 296 INDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEH 355

Query: 320 QDAVKENKK----GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNS 375
              ++E++K     +KG+TANMSLGGGKSPALD AVNAAVKAG+HFAVAAGNENQDACNS
Sbjct: 356 TKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNS 415

Query: 376 SPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMAS 435
           SPA+AENA+TVGASTL+DDRAYFSN+GKCVDIFAPGLN+LSTYIG++ ATATLSGTSMAS
Sbjct: 416 SPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMAS 475

Query: 436 PHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFN 495
           PHVAGLLTY LSLQPD  SE++     +TP Q+KKK+I Y+TKN L D+P DT N LI+N
Sbjct: 476 PHVAGLLTYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN 535

Query: 496 GGGEGLDDFWGKESVVDEVE-DTISSEIESFIDALEEKTDVLYEEIREVFDHMNI 549
           GG     DFW   +     +  T    + SF+D++++  +  +      FD+MNI
Sbjct: 536 GGFNST-DFWASAAAPQSHKVKTNRYSLGSFLDSIQDSNNHWFN-----FDNMNI 584

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  496 bits (1277), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 237/427 (55%), Positives = 308/427 (72%), Gaps = 15/427 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP+RYIVVF +++S + ++ H+++V EAH  SV+KL              ED  F     
Sbjct: 67  IPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKL-------------AEDDVFLEVVS 113

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
            S +   + GGI  SFD++GL  GY GYFTDEI++ +  +PL+ F+EQ+S V       Q
Sbjct: 114 SSIAPDLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQ 173

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
             APWGL RISHREK   G   +YLY+D AG+GVTSYV+DTG++ +H+DFEGRA WG  I
Sbjct: 174 KDAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVI 233

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND   D NGHGTHCAG I SKHYG            LRSNG G++SDV+KG+E+ A+ 
Sbjct: 234 PGNDEASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVARE 293

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H ++ ++  K FKGSTAN+SLG  KS A++MAV+AAV +G+HFA+AAGNEN+DAC SSPA
Sbjct: 294 HIESSRKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPA 353

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
            A+ ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PHV
Sbjct: 354 GAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHV 413

Query: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498
           AG+L+YFLSLQP  DSEYF  A  ++P +LK+K++ +ST  VLGDI D+T N LI+NGGG
Sbjct: 414 AGMLSYFLSLQPAPDSEYFDNA--LSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGG 471

Query: 499 EGLDDFW 505
           + LDD W
Sbjct: 472 KILDDLW 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 229/428 (53%), Positives = 307/428 (71%), Gaps = 17/428 (3%)

Query: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137
           ++P+RYI+ F ++ S   ++ HK+++ E   +SV+KL     FF ST             
Sbjct: 66  SLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST------------- 112

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
             S  +  + GGI   FD++GL  GY GYFT+E++  +  +P++ F+EQ+S V       
Sbjct: 113 --SAPSDLQFGGIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTF 170

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           Q  APWGL RISHREK   G   +YLY+D AG+GVTSYV+DTG++++H+DFEGRA WG  
Sbjct: 171 QEEAPWGLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAV 230

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IP ND   D NGHGTHCAG I S+H+G            LRSNG G++SDV+KG+E+  K
Sbjct: 231 IPDNDEASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVK 290

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
            H D+ K+    FKGSTAN+SLG  KSPA++MAVNAAV++G+HFA+AAGNE++DAC SSP
Sbjct: 291 DHIDSSKKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSP 350

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           A AE ++TVGAST +DDRA+FS+WG CVD+FAPG+N+LSTYIGS  A+ +LSGTSMA+PH
Sbjct: 351 AGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPH 410

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           VAG+L+YFLSLQP SDSE+F +   ++P QLK+K+I +ST+ VLGD+ +DT N LI+NGG
Sbjct: 411 VAGILSYFLSLQPSSDSEFFDST--VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGG 468

Query: 498 GEGLDDFW 505
           G  LD+FW
Sbjct: 469 GRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  483 bits (1244), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/428 (52%), Positives = 304/428 (71%), Gaps = 15/428 (3%)

Query: 78  AIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDY 137
           ++P+RYI+VF ++++   ++ H Q++ +A   SV+K+              ED  F    
Sbjct: 68  SLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKI-------------TEDDSFLRTV 114

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
             S S   + GGI  SFD++GL  GY GYFTDE+++ +  +PLV F+E +S V       
Sbjct: 115 SASASPNPQFGGIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSR 174

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKT 257
           Q  APWGL RISHRE+   G   +YLY+D AG GVTSYV+DTG++ +H+DFEGRA WG  
Sbjct: 175 QEDAPWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAV 234

Query: 258 IPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
           IP ND   D NGHGTHCAG I S+H+G            LRSNG G++SDV+KG+E+ AK
Sbjct: 235 IPENDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAK 294

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSP 377
           +H  + K+    FKGSTAN+SLG  KSPA++MAVNAAV  G+HFA+AAGNE++DAC SSP
Sbjct: 295 NHIASSKKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSP 354

Query: 378 ASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPH 437
           A AE ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMA+PH
Sbjct: 355 AGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPH 414

Query: 438 VAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGG 497
           VAG+L+Y LSLQP  DSE+F+    ++P QLK+K++ +ST+ VLGD+ ++T N L++NGG
Sbjct: 415 VAGILSYLLSLQPAQDSEFFYDT--VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGG 472

Query: 498 GEGLDDFW 505
           G+ LD+FW
Sbjct: 473 GKKLDEFW 480

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  482 bits (1240), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 234/427 (54%), Positives = 307/427 (71%), Gaps = 15/427 (3%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           +P+RY++VF +++S +++  H Q+V + H  SV KL              E+  F     
Sbjct: 67  LPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKL-------------TENDAFWRVIS 113

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
            S S++++ GGI + FD++GL  GY GYFTDEI+  I  +P++ FVEQ++ V       Q
Sbjct: 114 SSVSSKSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQ 173

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
             APWGL R+SHREK   G   +YLY+D AGKGVTSYV+DTG++ +H+DFEGRA WG  I
Sbjct: 174 EEAPWGLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVI 233

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
           P ND   D NGHGTHCAG I SKH+G            LRSNG G++SDV+KG+E+  K 
Sbjct: 234 PANDEASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKE 293

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H ++ K+  K FKGSTAN+SLG  KS A++MAVNAAV +G+HFA+AAGNE++DAC SSPA
Sbjct: 294 HIESSKKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPA 353

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
            AE ++TVGAST +DDRA+FSNWG CVD+FAPG+N++STYIGS  AT +LSGTSMASPHV
Sbjct: 354 GAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHV 413

Query: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498
           AG+L+YFLSLQP  DSE+F+ A   +P +LK+K++ +ST+ VLGDI DDT N LI+NGGG
Sbjct: 414 AGILSYFLSLQPAPDSEFFNDAP--SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGG 471

Query: 499 EGLDDFW 505
           + LD FW
Sbjct: 472 KKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  442 bits (1136), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 290/430 (67%), Gaps = 17/430 (3%)

Query: 77  LAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELD 136
           + IP+RYIV+FK  ++ +E+  H   + E +  S+               F++D DF   
Sbjct: 72  MIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI---------------FLQDSDFGKA 116

Query: 137 YQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFG 196
            Q +    TR  G+Q  F +   +TGYIGYFT+    FI  +PLV+ VE DS+V    + 
Sbjct: 117 TQYN-DISTRGIGLQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYK 175

Query: 197 TQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGK 256
            Q   PWGL RIS REKL +     Y YDD  GK   ++VIDTG+ VDH+DFEGRASWGK
Sbjct: 176 MQEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGK 235

Query: 257 TIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAA 316
           TI  ND D D NGHGTHCAGTIASKHYG            LRS+GSGSMSDV++GVE+  
Sbjct: 236 TIVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTV 295

Query: 317 KSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSS 376
           +++ D +K+ K   KG+  NMSLG  KS AL+ A++AA  AGI FAVAAGNE+ DACNSS
Sbjct: 296 EAYND-LKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSS 354

Query: 377 PASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASP 436
           PASA + +TVG STL+DD A+FSN+G+CVDIFAPG+N++STYIGS  AT +LSGTSM+SP
Sbjct: 355 PASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSP 414

Query: 437 HVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNG 496
           HVAG+L Y+LSLQPD  S+++H    I+P  LKKK++ Y+T   L  +P +TVN L++NG
Sbjct: 415 HVAGVLAYYLSLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNG 474

Query: 497 GGEGLDDFWG 506
           GG+ L  FWG
Sbjct: 475 GGKNLSKFWG 484

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  394 bits (1012), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/427 (46%), Positives = 265/427 (62%), Gaps = 33/427 (7%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           I  +YIV+FK +    E + H                     F   +NF++   +E D +
Sbjct: 60  IKDQYIVIFKNSAMMAEKELH---------------------FKQLKNFIKTYSYEWDEK 98

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
               +        + F +   L+GYI     E +  +R +P+V  +E DS V A +   Q
Sbjct: 99  DDHKSNL------NIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQ 152

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
              PWGLSRIS R ++ +G    Y YDD     VT+YV+DTG+ + H+ F GRA WGKTI
Sbjct: 153 EDTPWGLSRISQRPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTI 212

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
             ND+D+D +GHGTH AG IAS  +G            LRSNG G MSDV+KG+EF    
Sbjct: 213 VPNDVDEDNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDD 272

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H     +NK   KGS  N+SLG  KSPAL +A++AA+   IHFAVAAGNEN DAC +SPA
Sbjct: 273 HS----KNKNYSKGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPA 328

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHV 438
            A  A+TVGAS  +D+RA+FSNWG+CVD+FAPG+NV+STYIGSD AT +LSGTS A+P+ 
Sbjct: 329 DARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYT 388

Query: 439 AGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGG 498
           AGL+ Y+LSLQPD DS YF   G +TPS+LK+K++A+ +K+VL ++P++T N +I+NG G
Sbjct: 389 AGLIAYYLSLQPDKDSGYF--TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAG 446

Query: 499 EGLDDFW 505
             L  FW
Sbjct: 447 RNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  362 bits (928), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 188/432 (43%), Positives = 262/432 (60%), Gaps = 40/432 (9%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSV-AKLESTHEFFTSTENFVEDRDFELDY 137
           IP++YIV+FK + +         I  E HL ++ + L +T   +T               
Sbjct: 53  IPNQYIVLFKSDTT--------DIQRETHLATLNSWLLNTDPQYT--------------- 89

Query: 138 QRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGT 197
                       I  SF ++  L GY     ++++  +  +P++  +EQDS V A     
Sbjct: 90  ------------ILHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQK 137

Query: 198 QNGAPWGLSRISHREKLNLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDFEGRASWGK 256
           Q  +PWGL+RIS RE+L L     Y YDD  A      Y++DTG+N +H +F+GRA WG 
Sbjct: 138 QIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGA 197

Query: 257 TI-PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFA 315
              P     +D NGHGTHCAG I S  YG            L + G G MS V++G+E+ 
Sbjct: 198 VFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYV 257

Query: 316 AKSH-QDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACN 374
            + H QD  K+++ GFKGS  N+SLG GKSPAL   + AAVK G+HFAVAAGNE+ DAC+
Sbjct: 258 TQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACS 317

Query: 375 SSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS-DTATATLSGTSM 433
           +SPA + +A+TVGAS+ +DDR +FSNWG CVD+FAPG+N++STYIG  +  T +LSGTSM
Sbjct: 318 TSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSM 377

Query: 434 ASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLI 493
           ++P V GL+ YFLSLQPD+ S+++      TP QLK K+I++ST+ VL +IP+ T N ++
Sbjct: 378 SAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIV 437

Query: 494 FNGGGEGLDDFW 505
           +NGGG  L DFW
Sbjct: 438 YNGGGHSLKDFW 449

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  339 bits (869), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 177/405 (43%), Positives = 250/405 (61%), Gaps = 20/405 (4%)

Query: 106 AHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQ-----------DSF 154
           A +  +A L   H FF S ++ + + +F + ++     +  E G+            + F
Sbjct: 19  AAVPPLADLSGEHRFFMSGKSTILN-EFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQF 77

Query: 155 DVSGLLTGY-IGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREK 213
            ++  L G+ +  F    V F+   P V+ VE +S V+A     Q   PWGL R+S R++
Sbjct: 78  HIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDR 137

Query: 214 LNLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGT 272
           + +G    Y YD   + K V  Y++DTG+ VDH++FEGRA WGKTI  ND D+D NGHGT
Sbjct: 138 VRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGT 197

Query: 273 HCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKG 332
           HCAG +    YG            L + G G MSDV++G+EFA   H   +  N+   +G
Sbjct: 198 HCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEH---LTRNQDEVRG 254

Query: 333 STANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLA 392
           S  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC SSPA+ +  VTVG ST +
Sbjct: 255 SIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFS 314

Query: 393 DDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATATLSGTSMASPHVAGLLTYFLSLQPD 451
           DDRA+FSNWG C+D+FAPG+NV S+Y+G +   T +LSGTS ++PHVAGL+ Y LSL+PD
Sbjct: 315 DDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPD 374

Query: 452 SDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNG 496
           + S+ FH A    P+QLK+KL++ +T+  L ++PDDT N +IFNG
Sbjct: 375 TKSQ-FHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  325 bits (832), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/438 (42%), Positives = 265/438 (60%), Gaps = 36/438 (8%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           IP +YIV+F+ + +  ++   +Q +S       + +E  ++ +   +N          Y 
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLS-------SLIEEDNQKYNVNDN----------YS 105

Query: 139 RSFSAQTREGGIQDSFDVSGLLT-GYIGYFTDEIVDFI-RMNPLVDFVEQDSVVFAQEFG 196
           +  S        Q S D  G++    I  F +++ + I     ++  +E+DS V   +F 
Sbjct: 106 KVLSR------FQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFT 159

Query: 197 TQNGAPWGLSRISHREKLNLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDFEGRASWG 255
           TQ  + WGLSRIS R  L L     Y YDD+ +GKGV  Y++DTG+N +H +FEGRASWG
Sbjct: 160 TQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWG 219

Query: 256 KTIPTNDLD-QDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEF 314
            ++P  +   +D NGHGTHCAG I SK YG            L   G GSMSDV+ G+EF
Sbjct: 220 VSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEF 279

Query: 315 AAKSHQDAVKENKKG------FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 368
            A SH +              FKGS  N+SLG  KSP+LD+A+ +A K GIH  VAAGNE
Sbjct: 280 VANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNE 339

Query: 369 NQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG-SDTATAT 427
           ++DAC +SPA +   +TVGAS+ +DDRA+FSNWG CVD+FAPG+N+ STYIG ++  T +
Sbjct: 340 DEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLS 399

Query: 428 LSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDD 487
           LSG+SM+SP V+GL  Y+LSLQPD  S++  +   +TP QLK+K+I +ST  +L ++P D
Sbjct: 400 LSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSL--MTPDQLKRKIIDFSTNGMLKELPLD 457

Query: 488 TVNYLIFNGGGEGLDDFW 505
           T N L++NGGG+ L  FW
Sbjct: 458 TANKLVYNGGGKDLSGFW 475

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  276 bits (707), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 158/452 (34%), Positives = 243/452 (53%), Gaps = 24/452 (5%)

Query: 79  IPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQ 138
           +P+RYIV+FK      E+  H Q V++  L+    L     FF  T     D++F  +  
Sbjct: 69  VPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTR----DKEFSTE-- 122

Query: 139 RSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQ 198
                    GG+  +FD+     GY+GYFTDE+V+FIR   +VD+VE DS++   +  T 
Sbjct: 123 -------ELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDKETD 175

Query: 199 NGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           + + W L+RISHR KL L +FN+Y +D + G+ + +Y++DTGV   H  +  R   G  I
Sbjct: 176 SNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRGIVI 235

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
             N+ ++D NGHGT  AG +  +  G            L   G G++S+++KG+ F    
Sbjct: 236 TPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFVNHH 295

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
           H   +++N  G  G+    S+ G KS +L+ A +  V +GIH  V AG +  +ACNSSPA
Sbjct: 296 HPQRIEKN--GVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNSSPA 353

Query: 379 SAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSD----TATATLSGTSMA 434
           S+   +TV   ++ D+     NWG CVDI+ PG  V +TY   +    T   +++G+S A
Sbjct: 354 SSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGSSAA 413

Query: 435 SPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDDTVNYLIF 494
           +  VAGLL YF SLQP   +        +TP +LK++LI + TK  L ++   + N + F
Sbjct: 414 AAQVAGLLAYFASLQPGLGTPDVIP---LTPEELKERLIDFGTKGKLTNLERMSPNIIAF 470

Query: 495 NGGGEGLDDFW--GKESVVDEVEDTISSEIES 524
           NG G  LD F+  G E V    ++   S++ +
Sbjct: 471 NGAGGNLDSFFNDGSEIVPTATKNVDPSDVPT 502

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  192 bits (489), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 210/445 (47%), Gaps = 85/445 (19%)

Query: 98  FHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVS 157
             + I    +L S+ + +S   F  ST          +   RS     R+  I  +F + 
Sbjct: 17  LQEPIYGREYLVSLKQNDSIQSFMDST----------ITRGRSVKEYLRDK-IGKTFSI- 64

Query: 158 GLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQE----------------------- 194
           G   G+    TD++++ I+ NPLV  V  +  V A E                       
Sbjct: 65  GSFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQKGKC 124

Query: 195 -FGTQNGAPWGLSRISHREKLN---------LGSFNKYLYDDDA-GKGVTSYVIDTGVNV 243
               Q GAP  L+R+S R++L          L S  KY YD  + G  V +Y+ID+G+ +
Sbjct: 125 SVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAYIIDSGIYL 183

Query: 244 DHKDFEGRASWGKTIPTNDLDQDG----NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 299
           +H++F GRA     IP  DL  +G    NGHGTH AG + SK YG            L  
Sbjct: 184 EHEEFNGRA-----IPGIDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNR 238

Query: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359
            G GS++ V+ G+EFA K  Q+  K+ +       AN+SLG  ++  L+ A+ AA+ AG+
Sbjct: 239 LGQGSLAMVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGL 293

Query: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVL 415
              VAAGN N +AC  SPASA  A+TVGA    DDR    A FSNWG+C+DIFAPG+ + 
Sbjct: 294 VVVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIK 350

Query: 416 STYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAY 475
           S  I  D    T SGTSMASP VAGL    L               G++  ++K  ++  
Sbjct: 351 SLSIFKDKEDVTYSGTSMASPTVAGLAALTLD-------------QGVSAEEVKDYILEM 397

Query: 476 STKNVLGD----IPDDTVNYLIFNG 496
            T NV           T N + FNG
Sbjct: 398 GTDNVFHRRSLLFKPGTPNKICFNG 422

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  190 bits (483), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 190/405 (46%), Gaps = 71/405 (17%)

Query: 168 TDEIVDFIRMNPLV-------DFVEQDSVVFAQEF--------------------GTQNG 200
           + ++V+ IR NPLV        F   D V+  QE                       Q  
Sbjct: 69  SQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGE 128

Query: 201 APWGLSRISHREKLNLG---------SFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGR 251
           AP  L+R+S R  L            SFN Y Y    G+ + +Y+IDTG+  +HKDF GR
Sbjct: 129 APRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGR 188

Query: 252 ASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKG 311
           A +G+   T +   D NGHGTH AG + S ++G            L + G G+++ V+  
Sbjct: 189 AIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISA 247

Query: 312 VEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQD 371
           VEFA    + +      G KG  AN+SLG  ++  ++ A+ AA +AG+   VAAGN N +
Sbjct: 248 VEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNIN 301

Query: 372 ACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTATAT 427
           AC +SPASA  A+TVGA    DDR    A FSNWG CVDIFA G+ V S           
Sbjct: 302 ACWNSPASAPEAITVGA---FDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIA 358

Query: 428 LSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDIPDD 487
            SGTSMASP V GL+   L               G+ P  +K KL+  +T ++L      
Sbjct: 359 FSGTSMASPSVTGLVAILLD-------------KGVEPENIKAKLVELATHDLL------ 399

Query: 488 TVNYLIFNGGGEGLDDFWGKESVVDEVEDTISS--EIESFIDALE 530
               L F  G      F G E   DE +D +    ++ES +  L+
Sbjct: 400 QRRTLFFKPGTPNRIAFNGMEREDDEYDDAVYPIVDLESLVQELQ 444

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  189 bits (479), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 147/445 (33%), Positives = 213/445 (47%), Gaps = 84/445 (18%)

Query: 102 IVSEAHLQSVAKLESTHEFFTSTENFVEDRDFELDYQRSFSAQTRE---GGIQDSFDVSG 158
           IV E +L  + K ES   F  ST              +S S Q ++     I++ F   G
Sbjct: 17  IVGEEYLIKLKKSESIQSFLKST--------------KSQSLQIKDDIKNHIRERFTF-G 61

Query: 159 LLTGYIGYFTDEIVDFIRMNPLVDFV--------------EQDSVVFAQEFGTQNGAPWG 204
                +    +++++ ++ NP +  +                + + ++ +   Q  AP  
Sbjct: 62  AFRALVIDLPNDMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRH 121

Query: 205 LSRISHREKL-----NLGSF-NKYLYDDDA---GKGVTSYVIDTGVNVDHKDFEGRASWG 255
           LSR+S R +L     N+  + N + Y  DA   G  V +Y+IDTG+  +H +FEGR  + 
Sbjct: 122 LSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFA 181

Query: 256 KTIPTNDLDQDG----NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKG 311
                 DL Q+G    NGHGTH AG + SK +G            L   G G +S ++K 
Sbjct: 182 I-----DLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKA 236

Query: 312 VEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQD 371
           +EF  +  +++V       K   AN+S G  ++  +D A+  A  AGI   VAAGN N D
Sbjct: 237 LEFTIRHCKESVD------KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNID 290

Query: 372 ACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNV--LSTYIGSDTAT 425
           AC +SPAS+++ +TVGA    DDR    A FSNWG CVD+FAPG+ V  LS   GSD   
Sbjct: 291 ACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD--V 345

Query: 426 ATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD-- 483
             LSGTSMASP V+G+    L               G+ P  +K K+I  STKN+     
Sbjct: 346 LLLSGTSMASPSVSGIAAILLD-------------KGLNPKFVKSKIIESSTKNIFHQGT 392

Query: 484 --IPDDTVNYLIFNGGGEGLDDFWG 506
             I  +T N ++FNG  +  D F G
Sbjct: 393 IMIKPNTPNLIVFNGIEKMDDSFEG 417

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  189 bits (480), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 182/353 (51%), Gaps = 32/353 (9%)

Query: 192 AQEFGTQNGAPWGLSRISHREKLNL---------GSFNKYLYDDDAGKGVTSYVIDTGVN 242
           AQ    Q  AP  L+RIS   +L             FN Y  D+  G+GV +Y++DTG++
Sbjct: 155 AQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIH 214

Query: 243 VDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS 302
            +H +FE R   G  + T +   D NGHGTH AG + S+ +G            L  +GS
Sbjct: 215 AEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGS 273

Query: 303 GSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFA 362
           G  S+V+ G+EF     +   K ++   K   AN+SLG  +SP ++MAV  A++ GI F 
Sbjct: 274 GEASNVLSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFV 330

Query: 363 VAAGNENQDACNSSPASAENAVTVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS 421
            AAGN N DA  +SPASAEN +TVGA     D  A FSNWG CV+IFAPG+ + S    +
Sbjct: 331 AAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLN 390

Query: 422 DTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVL 481
           D  +  LSGTSM++P V G+    LS              GI P  + +++   ST+NV 
Sbjct: 391 DNESLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPELIAQEIEYLSTRNVF 437

Query: 482 GD----IPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE 530
                     T N +++N G + LDD +  E+      + I+ E+E +   L+
Sbjct: 438 HRRTLFFKPSTPNQILYN-GVDKLDDPYDDETFPRLNVEAIAKELEEYNATLQ 489

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  186 bits (472), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/304 (40%), Positives = 161/304 (52%), Gaps = 37/304 (12%)

Query: 170 EIVDFIRMNPLV-------DFVEQDSVVF------AQEFGTQNGAPWGLSRISHREKLNL 216
           ++VD IR +PLV        FV  D   F      ++    Q GAP  LSR+S R +L  
Sbjct: 73  DLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPY 132

Query: 217 ----------GSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQD 266
                     GSFN Y  +   G G+ +Y+IDTG+  +H +F GRA +G+ + T +   D
Sbjct: 133 DFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGD 191

Query: 267 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKEN 326
           GNGHGTH AG + S  YG            L + G G+++ V+  +EFA    + +    
Sbjct: 192 GNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSS---- 247

Query: 327 KKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTV 386
            +G KG   N+SLG  ++  ++ AV AA +AGI   VAAGN N +AC +SPASA  A+TV
Sbjct: 248 -EG-KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITV 305

Query: 387 GASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLL 442
           GA    DDR    A FSNWG CVDIFAPG+ V S            SGTSMASP + GL 
Sbjct: 306 GA---FDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLA 362

Query: 443 TYFL 446
              L
Sbjct: 363 AILL 366

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  187 bits (475), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/352 (36%), Positives = 179/352 (50%), Gaps = 32/352 (9%)

Query: 193 QEFGTQNGAPWGLSRISHREKLNL---------GSFNKYLYDDDAGKGVTSYVIDTGVNV 243
           Q    Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTG+  
Sbjct: 120 QNITYQSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFA 179

Query: 244 DHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 303
           DH +FE R   G  + T +   D NGHGTH AG + SK YG            L  +GSG
Sbjct: 180 DHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSG 238

Query: 304 SMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 363
             S+V+ G+EF     +   + ++   K   AN+SLG  +SP ++MAV  A++ GI F  
Sbjct: 239 EASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVA 295

Query: 364 AAGNENQDACNSSPASAENAVTVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSD 422
           AAGN N DA  +SPASAEN +TVGA     D  A FSNWG CV+IFAPG+ + S    + 
Sbjct: 296 AAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNF 355

Query: 423 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLG 482
             T  LSGTSM++P V G+    LS              GI P  + ++L   ST+NV  
Sbjct: 356 NDTLVLSGTSMSTPIVTGVAAVLLS-------------KGIEPEMIAQELEYLSTRNVFH 402

Query: 483 D----IPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE 530
                    T N +++N G + LDD +  E+      + I+ E+E +   L+
Sbjct: 403 RRTLFFKPSTPNQILYN-GVDKLDDRYDDETFPRLNIEAIARELEEYNATLQ 453

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  186 bits (473), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 180/366 (49%), Gaps = 51/366 (13%)

Query: 158 GLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVV------------FAQEFGTQNGAPWGL 205
           G   G+   F  + V+ ++ NPLV  V  +SV             +++ +  Q  AP  L
Sbjct: 59  GKFEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHL 118

Query: 206 SRISHREKLNLGS-------FNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           +R+S R  L           FN Y      G  V +Y+IDTG+   HKD  GRA +G  +
Sbjct: 119 ARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADM 178

Query: 259 PTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKS 318
              +   D NGHGTH AG + S+ +G            L + G G+++ V+  +EF+   
Sbjct: 179 -VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFS--- 234

Query: 319 HQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPA 378
               V   KK      AN+SLG  ++  L+ AV AAV++G+   VAAGN N +AC +SPA
Sbjct: 235 ----VNHCKKSGMLCVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPA 290

Query: 379 SAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMA 434
           SA +A+TVGA    DDR    A FSNWG CVD+FA G+ V+S            SGTSMA
Sbjct: 291 SAISAITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMA 347

Query: 435 SPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD----IPDDTVN 490
           SP VAGL    L    DS         GI P  +K+K+I  +T+NV           T N
Sbjct: 348 SPSVAGLAAVLL----DS---------GIDPPDIKQKIIDLATENVFQKRTLVFKPGTPN 394

Query: 491 YLIFNG 496
            + FNG
Sbjct: 395 RIAFNG 400

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  187 bits (474), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 172/328 (52%), Gaps = 43/328 (13%)

Query: 197 TQNGAPWGLSRISHREKL--------NLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKD 247
            Q GAP  L RIS R +L            F  Y Y+D   G  + +Y++DTG+  +H D
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 248 FEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 307
           FE R   G  + T +   D NGHGTH AG + SK +G            L   GSG+++ 
Sbjct: 213 FENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 308 VVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGN 367
           V+ G++FA   H   ++E +   K   ANMSLG  ++  ++ A++ A KAG+   VAAGN
Sbjct: 272 VLSGIQFAV-DHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGN 328

Query: 368 ENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNV--LSTYIGS 421
            N  AC +SPASA+NA+TVGA    DDR    AYFSNWG CVDIFAPG+ +  LS    S
Sbjct: 329 SNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPES 385

Query: 422 DTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVL 481
                T SGTSMASP VAGL    L               G+ P  +K KL+  STK+V 
Sbjct: 386 HHKHVTHSGTSMASPVVAGLAAILLD-------------KGVEPFDVKDKLLHLSTKDVF 432

Query: 482 GDI----PDDTVNYLIFNGGGEGLDDFW 505
             +       T N + +N    G++DF+
Sbjct: 433 NKLTLFFKYGTPNKIAYN----GIEDFF 456

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  187 bits (474), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 181/353 (51%), Gaps = 32/353 (9%)

Query: 192 AQEFGTQNGAPWGLSRISHREKLNL---------GSFNKYLYDDDAGKGVTSYVIDTGVN 242
           AQ    Q+ AP  L+RIS   +L             FN Y  DD  G+ V +Y++DTG+ 
Sbjct: 168 AQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIF 227

Query: 243 VDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS 302
            DH +FE R   G  + T +   D NGHGTH AG + SK YG            L  +GS
Sbjct: 228 SDHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGS 286

Query: 303 GSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFA 362
           G  S+V+ G+EF     +   + ++   K   AN+SLG  +SP ++MAV  A++ GI F 
Sbjct: 287 GEASNVLSGLEFIV---EHCTRVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFV 343

Query: 363 VAAGNENQDACNSSPASAENAVTVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGS 421
            AAGN N DA  +SPASAEN +TVGA     D  A FSNWG CV+IFAPG+ + S    +
Sbjct: 344 AAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLN 403

Query: 422 DTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVL 481
              T  LSGTSM++P V G+    LS              GI P+ + +++   ST+NV 
Sbjct: 404 YEDTLILSGTSMSTPIVTGVAAVLLS-------------KGIEPALIAQEIEYLSTRNVF 450

Query: 482 GD----IPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE 530
                     T N +++N G + LDD +  E+      + I+ E+E +   L+
Sbjct: 451 HRRTLFFKPSTANQILYN-GVDKLDDPYNDETFPRLNIEAIAKELEEYNATLQ 502

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  189 bits (481), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/323 (39%), Positives = 168/323 (52%), Gaps = 45/323 (13%)

Query: 194 EFGTQNGAPWGLSRISHREKL-----NLGSFNK---YLYDD-DAGKGVTSYVIDTGVNVD 244
           +F  Q GAP  L+RIS R+KL     N   F +   Y YDD D G+GV +YVIDTG+  +
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 245 HKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 304
           HKDFE R  +G  + T +   D NGHGTH AG I SK YG            +   GS  
Sbjct: 343 HKDFEDRVEFGTDL-TGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQ 401

Query: 305 MSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVA 364
           +S +++ +E+        V +     K    NMSLG      ++ AV +A+  G+ F VA
Sbjct: 402 LSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 365 AGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIG 420
           AGN N DAC SSP S++NA+TVGA    DDR    A FSNWG+CVDIFA G+ V S    
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV 480
                   SGTSMASP V G ++  LS              G+ P+ ++++++  STK  
Sbjct: 514 VPYKYIKYSGTSMASPIVCGFVSILLS-------------QGVKPNDVQEEMVKLSTK-- 558

Query: 481 LGDIPDD-------TVNYLIFNG 496
            GD           T N ++FNG
Sbjct: 559 -GDFTRRSLIFKPFTSNRILFNG 580

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  183 bits (465), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 129/348 (37%), Positives = 179/348 (51%), Gaps = 45/348 (12%)

Query: 198 QNGAPWGLSRISHR-------EKLNLGSFN-KYLYDDD-AGKGVTSYVIDTGVNVDHKDF 248
           Q  AP  L+RIS R       E +++ + N  Y YDD+ +G  V +YVIDTG+  +H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 249 EGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 308
           EGRA +G  +   +   D NGHGTH AG I S+ +G            L + G G+++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 309 VKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 368
           +  +EF        V   +K  +G  AN+SLG  ++  L+ AV AA++AG+   VAAGN 
Sbjct: 254 ISAIEFT-------VNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 369 NQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTA 424
           N +AC SSPAS+ +A+TVGA    DDR    A FSNWG CVDIFAPG+ + S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 425 TATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDI 484
               SGTSMASP V+G++   L    DS         GI P  +K +LI  +T +V    
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL----DS---------GIHPFDIKTELIDLATDSVFHK- 409

Query: 485 PDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTI--SSEIESFIDALE 530
                  L+F  G      F G +   D  ED +  S +I+  +  L+
Sbjct: 410 -----RTLLFKPGTPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKDLQ 452

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  182 bits (463), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 128/352 (36%), Positives = 177/352 (50%), Gaps = 32/352 (9%)

Query: 193 QEFGTQNGAPWGLSRISHREKLNL---------GSFNKYLYDDDAGKGVTSYVIDTGVNV 243
           Q    Q  AP  L+RIS   +L             FN Y   D  G+ V +Y++DTG+  
Sbjct: 120 QNITYQPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFA 179

Query: 244 DHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 303
           DH +FE R   G  + T +   D NGHGTH AG + SK YG            L  +GSG
Sbjct: 180 DHPEFEDRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSG 238

Query: 304 SMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 363
             S+V+ G+EF     +   K ++   K   AN+SLG  +SP ++MAV  A++ GI F  
Sbjct: 239 EASNVLSGLEFIV---EHCTKVSRPQGKKCVANLSLGSFRSPIINMAVEGAIEEGIVFVA 295

Query: 364 AAGNENQDACNSSPASAENAVTVGA-STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSD 422
           AAGN N DA  +SPASAEN +TVGA     D  A FSNWG CV+IFAPG+ + S    + 
Sbjct: 296 AAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNY 355

Query: 423 TATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLG 482
             T  LSGTSM++P V G+    LS              GI P  + +++   ST+NV  
Sbjct: 356 NDTLILSGTSMSTPIVTGVAAILLS-------------KGIEPEMIAQEIEYLSTRNVFH 402

Query: 483 D----IPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE 530
                    T N +++N G + LDD +  E+      + I+ E+E +   L+
Sbjct: 403 RRTLFFKPSTPNQILYN-GVDKLDDPYDDETFPRLNIEAIAKELEEYNATLQ 453

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  182 bits (463), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 171/363 (47%), Gaps = 61/363 (16%)

Query: 182 DFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNL---------GSFNKYLYDDDAGKGV 232
           D  + +  + ++   TQ+ AP  L+R+S R +L             FN Y Y    G+ V
Sbjct: 144 DMPQVNGKLLSRYIKTQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSV 203

Query: 233 TSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXX 292
            +YV+D+GV +DH DFEGRA +G     +    D NGHGTH AG I SK YG        
Sbjct: 204 NAYVLDSGVMIDHCDFEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNII 263

Query: 293 XXXXLRSNGSGSMSDVVKGVEFAAK-----------------------SHQDAVKENKKG 329
               L S GSG++  V+ G+EF +                        SH D V+     
Sbjct: 264 DVKVLDSVGSGTLDTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVES---- 319

Query: 330 FKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGAS 389
            K    N+SLG  +S  ++ A+   +K GI   VAAGN N +AC +SPAS  + +TVGA 
Sbjct: 320 -KRCVINLSLGTFRSTIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA- 377

Query: 390 TLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYF 445
              DDR    A FSNWG CVDIFAPG+ V S            +GTSMA+P V GL+   
Sbjct: 378 --FDDRIDSIAKFSNWGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALL 435

Query: 446 LSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD----IPDDTVNYLIFNGGGEGL 501
           L               GI P+Q+KK+L   +T N+           T N + FNG     
Sbjct: 436 LD-------------SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDD 482

Query: 502 DDF 504
           DD+
Sbjct: 483 DDY 485

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  180 bits (456), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 142/406 (34%), Positives = 200/406 (49%), Gaps = 51/406 (12%)

Query: 148 GGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQE------------F 195
           G I   F + G L G     + +++D I+ +P V  V  + +V A E             
Sbjct: 50  GKINKRFQI-GELKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 196 GTQNGAPWGLSRISHREKLNLGSFNK--------YLYDDDA-GKGVTSYVIDTGVNVDHK 246
             Q GAP  L+RIS R +L     NK        Y YD  A G    +Y++DTGV  DHK
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 247 DFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 306
           +FE R  +G T  T + + D NGHGTH AG + SK +G            L + G+G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 307 DVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAG 366
            ++  +EFA +  Q+   E+ +       NMSLG  KS  L+ A+N   K GI   VAAG
Sbjct: 228 SILSALEFAVQDCQE--HEDSQ----CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 367 NENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSD 422
           N N +AC +SP+SA  A+TVGA    DDR    A FSNWG CVDIFAPG+NV S      
Sbjct: 282 NFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDW 338

Query: 423 TATATLSGTSMASPHVAGLLTYFL--SLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV 480
            +    SGTSMASP V G++   L   + P+   +Y       T    KK+ + +     
Sbjct: 339 PSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA--TDGVFKKRTLVFKP--- 393

Query: 481 LGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVE-DTISSEIESF 525
                  T N +++NG  +  DD +  +    +VE D +  E+E++
Sbjct: 394 ------GTPNSVLYNGNKKH-DDEYEDDLQYPQVELDDLVQELENY 432

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 123/316 (38%), Positives = 164/316 (51%), Gaps = 42/316 (13%)

Query: 198 QNGAPWGLSRISHREKLNLGS-------FNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEG 250
           Q+GAP  L+R   R  L   +       FN Y   +  G+ V  Y++D+G++  H +FEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 251 RASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 310
           RA +G    TN+   D NGHGTH AG + SK YG            +  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 311 GVEFAAKSHQDAVKENKKGFKGSTANMSLGG---GKSPALDMAVNAAVKAGIHFAVAAGN 367
           GVEFA K  Q + K+         ANMSLGG   G S ALD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKK-------CVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 368 ENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDT 423
             + AC  SPA  + A+TVGA    DDR    A FSN+GKCVDIFAPG+ V S       
Sbjct: 441 SKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYN 497

Query: 424 ATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD 483
               L+GTSM++P  AG++   L               G+    +K++LI  STK V   
Sbjct: 498 TVRVLNGTSMSAPITAGVVAVLLDQ-------------GVKHEDVKERLIDLSTKGVFHR 544

Query: 484 ---IPDDTVNYLIFNG 496
              +   T +  +FNG
Sbjct: 545 RRLVSSRTPDRTLFNG 560

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  171 bits (432), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 137/390 (35%), Positives = 194/390 (49%), Gaps = 61/390 (15%)

Query: 170 EIVDFIRMNPLV-DFVEQDSVVF------------AQEFGT---QNGAPWGLSRISHREK 213
           +I++ ++ NPLV D V   +++F             QE+ +   Q+ AP  L+RIS R+K
Sbjct: 77  KIMEKLKQNPLVADIVP--NILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDK 134

Query: 214 LNL---------GSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLD 264
           L            SFN Y   +  G  V +Y++D+GV+ +  DFEGR  +G    T D +
Sbjct: 135 LPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDF-TGDGE 193

Query: 265 QDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVK 324
            D NGHGTH AG + SK YG            L   G G++  V+  +EFA     +  +
Sbjct: 194 GDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE 253

Query: 325 ENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAV 384
                 K   AN+SLG  K+  ++ A+ AA + G+   VAAGN N +AC +SPASAE A+
Sbjct: 254 ------KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAI 307

Query: 385 TVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAG 440
           TVGA    DDR    A FSNWG CVDI+APG+ V S          + SGTSMASP V G
Sbjct: 308 TVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCG 364

Query: 441 LLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD----IPDDTVNYLIFNG 496
            +   L               GI    +K  LI  +T +V          +T N ++FN 
Sbjct: 365 QVAILLD-------------KGIPNDDIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFN- 410

Query: 497 GGEGLDDFWGKESVVDEVE-DTISSEIESF 525
           G E  DD + KE +  +V+ D +  E+ ++
Sbjct: 411 GIEKEDDQY-KEYIYPQVDLDILVEELNNY 439

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  175 bits (443), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 158/303 (52%), Gaps = 39/303 (12%)

Query: 193 QEFGTQNGAPWGLSRISHREKLNLG-------SFNKYLYDDDAGKGVTSYVIDTGVNVDH 245
            ++  Q  AP  L+R   R  L          +FN Y  ++  G+GV  YV+D+G+   H
Sbjct: 423 HQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSH 482

Query: 246 KDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSM 305
            +F+GRA +G    T +   D NGHGTH AG + S+ +G            +  +G GS 
Sbjct: 483 PEFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGST 541

Query: 306 SDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGG---GKSPALDMAVNAAVKAGIHFA 362
           S+++ GVEFA       VK  ++  K   ANMSLGG   G S ALD AV AA++ G+ F 
Sbjct: 542 SNIIAGVEFA-------VKHCQQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFV 593

Query: 363 VAAGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTY 418
           VAAGN  + AC  SPA  + A+TVGA    DDR    A FSN+GKCVDIFAPG+ V S  
Sbjct: 594 VAAGNSKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVASLS 650

Query: 419 IGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTK 478
                    L+GTSM++P  AG++   L               GI P ++K  L++ STK
Sbjct: 651 NSPSNTMRVLNGTSMSAPITAGVVAVLLDQ-------------GIEPHEVKDHLLSISTK 697

Query: 479 NVL 481
            + 
Sbjct: 698 GLF 700

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  168 bits (426), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/352 (36%), Positives = 177/352 (50%), Gaps = 45/352 (12%)

Query: 194 EFGTQNGAPWGLSRISHREKLNLGSFN--------KYLYDDD-AGKGVTSYVIDTGVNVD 244
           +F  Q  AP  L+RIS R  L     N         Y YDD   G  V +YVIDTG+  +
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 245 HKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 304
           H+ F+GRA +G  +   +   D NGHGTH AG I S+ YG            L + G G+
Sbjct: 189 HRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 305 MSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVA 364
           ++ V+  +EF        V   +K  +G  AN+SLG  ++  L+ AV AA++AG+   VA
Sbjct: 248 LTSVISAIEFT-------VNHCRKSKRGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVA 300

Query: 365 AGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIG 420
           AGN N +AC SSPAS+ +A++VGA    DDR    A FSNWG CVD+FAPG+ + S    
Sbjct: 301 AGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFSNWGNCVDLFAPGVKIASLSNI 357

Query: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNV 480
               +   SGTSMASP V G++   L    DS         GI P  +K++LI  +T +V
Sbjct: 358 PPFKSVAYSGTSMASPLVTGMVAVLL----DS---------GIHPFDIKEELINTATDSV 404

Query: 481 LGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISS--EIESFIDALE 530
                      L+F  G      F G E   D  ED +    +I+  +  LE
Sbjct: 405 FHK------RALLFKPGTPNRVAFTGVEKEDDIFEDAVYPGVDIDQLVKDLE 450

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 137/419 (32%), Positives = 203/419 (48%), Gaps = 62/419 (14%)

Query: 148 GGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLV-----------------------DFV 184
           G I  +F   G   G     T ++V  I+ NPLV                       D +
Sbjct: 54  GKISKTFSF-GSFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 185 EQDSVVFAQE---FGTQNGAPWGLSRISHREKLNLGSFNKYLYDDD---------AGKGV 232
           +Q   +F +       QNGAP  L+R+S R  L     +K  Y+D           G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 233 TSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXX 292
            +Y+ID+G++++ ++FEGRA+ G  + T +   D NGHGTH AG + SK YG        
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTLV 231

Query: 293 XXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVN 352
               L   GSGS+  V+  +EF   +H    K  K       AN+SLG    P L+ A+ 
Sbjct: 232 EVKALDRQGSGSLITVISALEFVV-NHCGKSKSKK-----CVANLSLGAFMMPLLNEAIK 285

Query: 353 AAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIF 408
           A V +G+   VAAGN N DAC  SPAS ++A+TVGA    DDR    A FSNWG CVDIF
Sbjct: 286 ATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDIF 342

Query: 409 APGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQL 468
           APG+ + S  I  +  +   SGTSMASP VAG+++  L    +++    +     T    
Sbjct: 343 APGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILLDQGVENEDIRDYLFELATDDVF 402

Query: 469 KKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVE-DTISSEIESFI 526
           +K+ + +  +         T N + FNG  +  +DF  ++ +  E+  D +  E+++++
Sbjct: 403 QKRTLLFKPR---------TPNRITFNGISKKDEDF--EDGIFPEINVDVLLDELQNYV 450

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  162 bits (410), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 176/359 (49%), Gaps = 39/359 (10%)

Query: 198 QNGAPWGLSRISHREKL--------NLGSFNKYLYDDD-AGKGVTSYVIDTGVNVDHKDF 248
           Q GAP  L ++S R +L            F  Y YD    G     Y+IDTGV  +HK+F
Sbjct: 150 QFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEF 209

Query: 249 EGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 308
             R  +G      +   D NGHGTH AG I SK +G            L   G G+++ V
Sbjct: 210 GNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTSV 268

Query: 309 VKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNE 368
           ++G+EFA  + +  +K+   G K    NMSLG  ++P ++ A+  A  +GI   VAAGN 
Sbjct: 269 LEGIEFAVNNCK--LKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGNN 325

Query: 369 NQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTYIGSDTA 424
           N  AC +SPAS+  A+TVGA    DDR    A FSNWG+CVDIFAPG+ + S        
Sbjct: 326 NFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLEN 382

Query: 425 TATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGDI 484
               SGTSMASP VAGL+   +               G    ++K+KLI  S+K++   +
Sbjct: 383 GVIHSGTSMASPIVAGLVAILME-------------KGYKCDEIKQKLIDDSSKSIFSKL 429

Query: 485 ----PDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEE 539
                  T N +I+NG  E ++    KE++    E   S E ++  D  +   +   EE
Sbjct: 430 TLFFKYGTPNRVIYNGIEEVIN--VNKENIRQREETDESKEYDTIEDIDDSANETKTEE 486

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  157 bits (396), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 130/360 (36%), Positives = 184/360 (51%), Gaps = 51/360 (14%)

Query: 191 FAQEFGTQNGAPWGLSRISHREKLNL------GSFNKYLYDDD-AGKGVTSYVIDTGVNV 243
           F+ +F +Q+ AP  L+RIS R +L +       S  KY Y ++  G+GV  YV+D+GVN 
Sbjct: 147 FSDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNH 206

Query: 244 DHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 303
           DH DFEGRA  G    T +   D  GHGTH AG I SK YG            L S G G
Sbjct: 207 DHPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKG 265

Query: 304 SMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGG-GKSPALDMAVNAAVKAGIHFA 362
           +++++++G+E+    +Q   K+ K        NMSLG  G    LD AV+A ++ G+   
Sbjct: 266 TVTNIIEGLEYVV--NQCIGKKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVV 318

Query: 363 VAAGNENQDACNSSPASAENAVTVGASTLADDR----AYFSNWGKCVDIFAPGLNVLSTY 418
           VA GN   +AC  SPA    A+TV A    DDR    A FSNWG C+DI+APG+NV S  
Sbjct: 319 VAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS 375

Query: 419 IGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTK 478
                 T  LSGTSMASP VAG    +L               G  P++++K L   +T+
Sbjct: 376 -NKGRGTFVLSGTSMASPIVAGAAAIYLD-------------QGADPAEVRKILSKTATR 421

Query: 479 NVLGD----IPDDTVNYLIFNGGGEGLDDF-WGKESVVDEVEDTISSEIESFIDALEEKT 533
            V       +   T N +++ G  +  D+F +    ++DE++         F+D L++ T
Sbjct: 422 GVFKKRAIAVRPRTPNKVLYTGNNQEDDEFAYAVYPMIDEIK---------FMDQLKQAT 472

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  140 bits (354), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 166/355 (46%), Gaps = 33/355 (9%)

Query: 194 EFGTQNGAPWGLSRISHREKLNLGS---FNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEG 250
           ++ TQ  AP  LSR S   KL   S   +N Y   D  G  VT YV+D+G+ +DH +FEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 251 RASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 310
           R        T+    D  GHGT  AG I SK YG            L + G G++  +++
Sbjct: 201 RILEAYDF-TDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 311 GVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 370
           G++F  K      +EN  G      N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFITKH----CEENTNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 371 DACNSSPASAENAVTVGASTLADDR-AYFSNWGKCVDIFAPGLNVLSTYIGSDTATATLS 429
           +AC  +PA ++   TVG+    DD  A FSNWG+CVD+ APG+ V +    +   +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 430 GTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNVLGD-----I 484
           GTS+++P V GL    LS              G+    L  ++    ++++L +     +
Sbjct: 374 GTSVSTPIVTGLAAILLS-------------KGVPKENLYDEIRKMGSRDLLRNKEFSRL 420

Query: 485 PDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEE 539
           P  T N LI N G +  DD +  ++ +DE     +    +F+D L +K  + + +
Sbjct: 421 P-GTPN-LIVNIGPQKEDDVYPDDAYIDEERRYTTP--ATFVDTLNQKKRIHFTD 471

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  131 bits (329), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 149/288 (51%), Gaps = 12/288 (4%)

Query: 165 GYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLY 224
           G F   +++ +  +  +  +  D ++   E+  Q  AP  L+R+S +  L  GS   Y+Y
Sbjct: 60  GDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQKSTLR-GSDGTYIY 118

Query: 225 DDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQ-DGNGHGTHCAGTIASKHY 283
             + G GV  Y++DTG++  H + EGR      + +N +   D +GHGT  AG I S  +
Sbjct: 119 HSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHGHGTAVAGVIGSATF 178

Query: 284 GXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGK 343
           G              S G+ ++  V++ +E A+K    +V +     + S   +     K
Sbjct: 179 GSAKKCNLFDVRVADSTGNATLIGVIRALEHASK--LASVTQ-----RPSVVVIPFTMRK 231

Query: 344 SPALDMAVNAAVK-AGIHFAVAAGNENQDACNSSPASAENAVTVGA--STLADDRAYFSN 400
           +  L+ A+ A ++   +   VA GN NQ+AC+SSPASA  A+T+G+   T  D  A F+N
Sbjct: 232 NVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGSIDVTKGDSLAPFTN 291

Query: 401 WGKCVDIFAPGLNVLSTYIGSDTATATLSGTSMASPHVAGLLTYFLSL 448
           +G C+D FA G+N+ S   G   +    SGTS+++   +G++ Y++SL
Sbjct: 292 YGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  124 bits (311), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 161/315 (51%), Gaps = 19/315 (6%)

Query: 143 AQTREGGIQDSFDVSGLLTGYIGYFTDEIV-DFIRMNPLVDFVEQDSVVFAQEFGTQNGA 201
           A T  GG   +  +        G F  +++ DF R   +V  +  D  +   E+  Q  A
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHA 96

Query: 202 PWGLSRISHREKLNLGSFN---KYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTI 258
           P  L+R+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  FEGR       
Sbjct: 97  PNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADF 156

Query: 259 PTNDLDQ-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAK 317
            ++ +   D +GHGT  AG I S  +G              S G  S+  V++ +E A+K
Sbjct: 157 SSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK 216

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVK-AGIHFAVAAGNENQDACNSS 376
               AV +     + S   + L   ++  L+ AV A V+   I   VAAGNEN+ AC+ S
Sbjct: 217 --LAAVTK-----RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVS 269

Query: 377 PASAENAVTVGASTLA--DDRAYFSNWGKCVDIFAPGLNVLSTYIGSD-TATATLSGTSM 433
           PA A  A+T+G+  +A  D  A F+N+ +CVD+F  G++V +  +G D ++   LSGTS+
Sbjct: 270 PAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSI 327

Query: 434 ASPHVAGLLTYFLSL 448
           ++   +GL+ Y++S+
Sbjct: 328 SAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  118 bits (296), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 91/302 (30%), Positives = 152/302 (50%), Gaps = 24/302 (7%)

Query: 162 GYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISH---REKLNLGS 218
           G+ G F DE++  +  +P V  +  D +++ QE+  QN AP  L+R+S+     +++  +
Sbjct: 63  GFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGVSNSRVSAKN 122

Query: 219 FNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLD---QDGNGHGTHCA 275
            N +++   AG GV  Y++D+G++  H  F  R    K I   D      D +GHGT  A
Sbjct: 123 ENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HISKLIDLTDNPIPVGDPHGHGTAIA 181

Query: 276 GTIASKHYGXXXXXXXXXXXXLRSNGSG-SMSDVVKGVEFAAKSHQDAVKENKKGFKGST 334
           G + S  +G            + +  +G  +S ++K +EF  ++H  A        + S 
Sbjct: 182 GLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT------MRPSV 234

Query: 335 ANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADD 394
           A +     K+  L+ A+  ++   I   V AGN++  ACN SPASA N+ ++ +    D 
Sbjct: 235 AVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQSILSVGSLDY 293

Query: 395 R-----AYFSNWGKCVDIFAPG--LNVLSTYIGSD-TATATLSGTSMASPHVAGLLTYFL 446
           R     A FSN+G+CVD+F  G  ++ L     SD    + +SGTSM+    AG + Y++
Sbjct: 294 RSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAIAAGTVGYYM 353

Query: 447 SL 448
           SL
Sbjct: 354 SL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  102 bits (254), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 88/317 (27%), Positives = 145/317 (45%), Gaps = 32/317 (10%)

Query: 150 IQDSFDVSGLLTGYIGYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRIS 209
           I D F++ G    + G F+  I+  +  +P V  + +D  +  QE   QN AP  L  +S
Sbjct: 45  ITDIFEL-GSFRAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLS 103

Query: 210 HREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEGRASWGKTIPTNDLDQ---- 265
               L   S   ++Y  + G GV  Y++DTG+++ H +     S    +   DL Q    
Sbjct: 104 SISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNL----SKLNILRMADLTQSPVP 156

Query: 266 ---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDA 322
              D  GHGT  AG IAS+ +G              SNG   +S +++ +    + H + 
Sbjct: 157 QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTLTQR-HIEG 215

Query: 323 VKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASA-- 380
            K            + +  G +P L  A+ A+    +   + AGN  QDA N SPA+   
Sbjct: 216 TKRPSV----VVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSPANVNP 270

Query: 381 --ENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNV-------LSTYIGSDTATATLSGT 431
             +N + VG+  + ++   F+N+G  VD+F  G  +       L +   S++ T  +SGT
Sbjct: 271 KPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGT 330

Query: 432 SMASPHVAGLLTYFLSL 448
           S +S   AG++ Y++SL
Sbjct: 331 SASSAITAGVIGYYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/293 (27%), Positives = 135/293 (46%), Gaps = 27/293 (9%)

Query: 165 GYFTDEIVDFIRMNPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLY 224
           G F+ E ++++  +  V  + +D  +  QE+  Q G+P  LS++S       GSF    +
Sbjct: 58  GEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT---F 109

Query: 225 DDDAGKGVTSYVIDTGVNVDHKDFEGRASW------GKTIPTNDLDQDGNGHGTHCAGTI 278
           D  +G  V  YV DTG++  H   +              +P      D +GHGT  AG I
Sbjct: 110 DPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG---ADPHGHGTMMAGLI 166

Query: 279 ASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMS 338
           AS+ +G               +G   +S ++KG+  A+ +H    K         T    
Sbjct: 167 ASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAHARFTKRPSVFVLPMTI--- 222

Query: 339 LGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYF 398
             G K+  LD  + A  K  I   + AGN+  DAC+ SP +  N + +G+    +  A F
Sbjct: 223 --GKKNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADF 279

Query: 399 SNWGKCVDIFAPGLNVL---STYIGSDTATATLSGTSMASPHVAGLLTYFLSL 448
           SN+G CVD++  G ++L   ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 280 SNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 127/277 (45%), Gaps = 35/277 (12%)

Query: 193 QEFGTQNGAPWGLSRISHREKLNLGSF----NKYLYDDDAGKGVTSYVIDTGVNVDHKDF 248
           Q +  Q  AP  L R++ ++ +    +    N+Y++ D +G GV  Y++DTG+++ H  +
Sbjct: 92  QGYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIY 150

Query: 249 EGRASWG------KTIPTNDLDQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS 302
                          IP+ D     NGHGT  AG I S  +G            + +N  
Sbjct: 151 LQNNIHKLIDLTTSPIPSGDF----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTK 206

Query: 303 -GSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHF 361
             +MS V+  +    K  Q       K  + S   +     K+  L+ A+    K  I  
Sbjct: 207 HATMSRVLSALSLIEKHEQ-------KTMRPSIIVLPFQTEKNTILESAIENISKK-IPV 258

Query: 362 AVAAGNENQDACNSSPASAE---NAVTVGASTLADDRAY-----FSNWGKCVDIFAPGLN 413
            + AGN++Q+AC  SP   +   N + VG+   ++++ Y     FSN+G CVDI+  G++
Sbjct: 259 IIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVD 318

Query: 414 VLSTYIGSDTATATL---SGTSMASPHVAGLLTYFLS 447
           + +    S+     +   +GTS +   VAG++ Y++S
Sbjct: 319 ISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 119/269 (44%), Gaps = 26/269 (9%)

Query: 193 QEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTGVNVDHKDFEG-R 251
           QE   Q  AP  L+++   E  +    N+++YD  AG GV  Y+ DTG+  +       R
Sbjct: 92  QEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASR 147

Query: 252 ASWGKTIPTNDL-DQDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVVK 310
                 +P   + DQ+   HGT  +G I S  +G               NG   MS V+K
Sbjct: 148 IHDMPGMPGPPIRDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLK 207

Query: 311 GVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 370
           G+       Q  VK      + S  N S    K+  L+ A +   +  +  AVAAGN  Q
Sbjct: 208 GLNLV----QQHVKHTN---RPSVINFSYCTLKNAILNSAFDNFPR-DVPIAVAAGNYKQ 259

Query: 371 DACNSSPASAE---NAVTVGASTLADD---RAYFSNWGKCVDIFAPGLNVLSTYI----- 419
             C+ SP   +   + +  G+  + DD    + FSN+G CV  +APG  +L+  I     
Sbjct: 260 PGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSR 319

Query: 420 -GSDTATATLSGTSMASPHVAGLLTYFLS 447
             S      +SGTS +S   AG++ Y+++
Sbjct: 320 PNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 10/69 (14%)

Query: 221 KYLYDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGT 272
           K  Y++  G GV + ++D G++ +++D    F    SW       +P   L  D   HGT
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDD--YHGT 215

Query: 273 HCAGTIASK 281
            CAG IA+K
Sbjct: 216 RCAGEIAAK 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ +++D    F    SW       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 276 GTIASK 281
           G IA+K
Sbjct: 219 GEIAAK 224

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 299 SNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAG 358
           +N S S SDV +    +A    + +K+   G K     +   GG SP ++ AV A V+ G
Sbjct: 174 ANVSESSSDVSRDASLSAI---NMLKQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTG 230

Query: 359 IHFAV 363
           IHF  
Sbjct: 231 IHFGC 235

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ +++D    F    SW       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY--HGTRCA 218

Query: 276 GTIASK 281
           G IA+K
Sbjct: 219 GEIAAK 224

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 229 GKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCAGTIAS 280
           GKGV + ++D G++ + +D    F    SW     K +PT  L  D   HGT CAG IA+
Sbjct: 163 GKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPTPKLIDDY--HGTRCAGEIAA 220

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ +++D    F    SW       +P   L  D   HGT CA
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDD--YHGTRCA 242

Query: 276 GTIAS 280
           G IA+
Sbjct: 243 GEIAA 247

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ + +D    F    SW       +P   LD D   HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDY--HGTRCA 211

Query: 276 GTIAS 280
           G IA+
Sbjct: 212 GEIAA 216

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 10/66 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ +++D    F    SW       +P   L  D   HGT CA
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY--HGTRCA 218

Query: 276 GTIASK 281
           G IA+K
Sbjct: 219 GEIAAK 224

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 221 KYLYDDDAGKGVTSYVIDTGV---NVDHKD-FEGRASW----GKTIPTNDLDQDGNGHGT 272
           K  Y++  G+G+   ++D G+   N D KD F    SW       +P   L  D   HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADD--YHGT 229

Query: 273 HCAGTIAS 280
            CAG IA+
Sbjct: 230 RCAGEIAA 237

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y +  GKGV + V+D G++ ++ D    F    SW       +P   L  D   HGT CA
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADD--YHGTRCA 209

Query: 276 GTIAS 280
           G IA+
Sbjct: 210 GEIAA 214

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 315 AAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 363
           A+ S  + +K++  G K     +   GG SP ++ AV A V+ GIHF  
Sbjct: 187 ASTSAINLLKQSLAGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 235

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y +  G GV   ++D GV+ ++ D    F    SW      T+P   L  D   HGT CA
Sbjct: 165 YGNVTGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPKPRLADDY--HGTRCA 222

Query: 276 GTIAS 280
           G IA+
Sbjct: 223 GEIAA 227

>ZYRO0B08140g Chr2 (635368..638322) [2955 bp, 984 aa] {ON} highly
           similar to uniprot|P16861 Saccharomyces cerevisiae
           YGR240C PFK1 Alpha subunit of heterooctameric
           phosphofructokinase involved in glycolysis indispensable
           for anaerobic growth activated by fructose-2 6-
           bisphosphate and AMP mutation inhibits glucose induction
           of cell cycle-related genes
          Length = 984

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 4/52 (7%)

Query: 316 AKSHQDAVKENKKGFKGSTANMSLG----GGKSPALDMAVNAAVKAGIHFAV 363
           +K   +AVKE K     S     +     GG SP ++ AV A V+ GIHF  
Sbjct: 184 SKPDANAVKELKNSLARSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 235

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 10/60 (16%)

Query: 229 GKGVTSYVIDTGVNV---DHKD-FEGRASW----GKTIPTNDLDQDGNGHGTHCAGTIAS 280
           GKGV + +ID GV+    D KD F    SW     + +P   L  D   HGT CAG IA+
Sbjct: 170 GKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDN--HGTRCAGEIAA 227

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 10/68 (14%)

Query: 221 KYLYDDDAGKGVTSYVIDTGVNVDH----KDFEGRASW----GKTIPTNDLDQDGNGHGT 272
           +  Y++  G G+ + ++D GV+ D+     +F    SW       +P   L  D   HGT
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDD--YHGT 240

Query: 273 HCAGTIAS 280
            CAG IA+
Sbjct: 241 RCAGEIAA 248

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 329 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 363
           G K   A M+  GG SP ++ AV A V+AGIH+  
Sbjct: 204 GIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHYGC 237

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y++  G GV + ++D G++ + +D    F    SW       +P   L  D   HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPKPILGDD--NHGTRCA 211

Query: 276 GTIAS 280
           G IA+
Sbjct: 212 GEIAA 216

>TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.85
           YGR240C
          Length = 983

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 24/46 (52%)

Query: 318 SHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAV 363
           ++ + +++   G K     +   GG SP ++ AV A V+ GIHF  
Sbjct: 187 ANAEILRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 232

>Kpol_1015.8 s1015
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 bp, 843 aa] {ON}
           complement(19725..20576,20692..20940,20990..20998,
           21041..22462) [2532 nt, 844 aa]
          Length = 843

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 224 YDDDAGKGVTSYVIDTGVNVDHKD----FEGRASW----GKTIPTNDLDQDGNGHGTHCA 275
           Y+   GKGV   ++D G++ + +D    F    SW     + +P   L  D   HGT CA
Sbjct: 157 YEGITGKGVVVAIVDDGLDYESEDLKDNFCKEGSWDFNENQNLPKPLLYDD--YHGTRCA 214

Query: 276 GTIAS 280
           G IA+
Sbjct: 215 GEIAA 219

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 31.6 bits (70), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 228 AGKGVTSYVIDTGVNVDHKDFEGR----ASW----GKTIPTNDLDQDGNGHGTHCAGTIA 279
            GK VT  ++D GV+ +++D + +     SW        P   L  D   HGT CAG IA
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDD--YHGTRCAGEIA 223

Query: 280 S 280
           +
Sbjct: 224 A 224

>TBLA0D02710 Chr4 (669879..671627) [1749 bp, 582 aa] {ON} Anc_8.481
           YPL030W
          Length = 582

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%)

Query: 465 PSQLKKKLIAYSTKNVLGDIPDDTVNYLIFNGGGEG 500
           PS     ++AY  KN L   P   V  +I NGGG G
Sbjct: 530 PSTRNAAIVAYENKNALASFPTQEVYEVIQNGGGAG 565

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,357,587
Number of extensions: 2414082
Number of successful extensions: 5828
Number of sequences better than 10.0: 94
Number of HSP's gapped: 5803
Number of HSP's successfully gapped: 94
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)