Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11374gna 1ON20520510851e-152
Kwal_56.22396na 1ON2102241861e-16
CAGL0L05918g8.128ON34340691.7
Kpol_365.75.386ON122457682.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11374g
         (205 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11374g Chr3 complement(935901..936518) [618 bp, 205 aa] {O...   422   e-152
Kwal_56.22396 s56 (110070..110702) [633 bp, 210 aa] {ON} [contig...    76   1e-16
CAGL0L05918g Chr12 (660823..661854) [1032 bp, 343 aa] {ON} simil...    31   1.7  
Kpol_365.7 s365 (14027..17701) [3675 bp, 1224 aa] {ON} (14027..1...    31   2.7  

>KLTH0C11374g Chr3 complement(935901..936518) [618 bp, 205 aa] {ON}
           conserved hypothetical protein
          Length = 205

 Score =  422 bits (1085), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%)

Query: 1   MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG 60
           MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG
Sbjct: 1   MIPYPTRDTDDFSLTDFRSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAHARREPSWG 60

Query: 61  TLEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDSTLLDTGDKIVARQKA 120
           TLEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDSTLLDTGDKIVARQKA
Sbjct: 61  TLEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDSTLLDTGDKIVARQKA 120

Query: 121 DVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPLTLKAPMIHQGDTLKKILLTFAL 180
           DVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPLTLKAPMIHQGDTLKKILLTFAL
Sbjct: 121 DVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPLTLKAPMIHQGDTLKKILLTFAL 180

Query: 181 LITVLTFESMSSKLINIIKASTGLS 205
           LITVLTFESMSSKLINIIKASTGLS
Sbjct: 181 LITVLTFESMSSKLINIIKASTGLS 205

>Kwal_56.22396 s56 (110070..110702) [633 bp, 210 aa] {ON} [contig
           185] FULL
          Length = 210

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 108/224 (48%), Gaps = 33/224 (14%)

Query: 1   MIPYPTRDTDDFSLTDF--------RSRGSGGGQKQAKYVAETEISAPVRRELKPKAIAH 52
           MIPYPTRD+DDFSLTDF        R R  G  + +   V  T+I    R+   P     
Sbjct: 1   MIPYPTRDSDDFSLTDFRPAENRRRRGRSMGDSRAEPARVQRTQI----RKISNPY---- 52

Query: 53  ARREPSWGT---LEGGTAPVETNIYLRSLAHESDEPNLAAERKRSKGDTFAINDDST--L 107
              E S GT   L+  + P+E   Y R+   +  EP +A  R+ +   T +  DD +  L
Sbjct: 53  ---EDSVGTRRHLQVSSLPLEVPSYARAKIGKKLEP-VAVPREYALHSTSSREDDESTLL 108

Query: 108 LDTGDKIVARQ-KADVRTECVQQWRSTDVIHANRFLPQKRQLQVTSKRSAPL-----TLK 161
           +D+GDKI  RQ +  +  E V    S  V+    F P  + ++  ++    +      L 
Sbjct: 109 VDSGDKISTRQERKQMPVEAVVHQFSQPVVPLE-FAPVMQPVEQIAETFFSMGADKNALS 167

Query: 162 APMIHQGDTLKKILLTFALLITVLTFESMSSKLINIIKASTGLS 205
             M   G ++ KI+   AL + VL F+S+SS+LI  IK  +GL+
Sbjct: 168 TVMFSGGGSI-KIIWILALAVAVLLFDSLSSRLIESIKEKSGLN 210

>CAGL0L05918g Chr12 (660823..661854) [1032 bp, 343 aa] {ON} similar
           to uniprot|P46946 Saccharomyces cerevisiae YGL175c SAE2
           meiotic recombination protein
          Length = 343

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 6   TRDTDDFSLTDFRSRGSGGGQKQAKYVAET---EISAPVR 42
           ++D+DDF LT F S+  G  +KQ+++   +   E S+P++
Sbjct: 82  SQDSDDFILTQFDSQDVGSAKKQSQFEKSSIKPEFSSPLK 121

>Kpol_365.7 s365 (14027..17701) [3675 bp, 1224 aa] {ON}
           (14027..17701) [3675 nt, 1225 aa]
          Length = 1224

 Score = 30.8 bits (68), Expect = 2.7,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 146 RQLQVTSKRSAPLTLKAPMIHQGDTLKKILLTFALLITVLTFESMSSKLINIIKAST 202
           R+LQV S +   L ++ P++     LKK +  FAL +T+L    + + L  II ++T
Sbjct: 539 RKLQVLSNQLIALNIRVPLL-----LKKQIQNFALFLTMLKDNVLFTLLEKIITSAT 590

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,886,813
Number of extensions: 836202
Number of successful extensions: 2163
Number of sequences better than 10.0: 11
Number of HSP's gapped: 2196
Number of HSP's successfully gapped: 11
Length of query: 205
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 101
Effective length of database: 41,556,135
Effective search space: 4197169635
Effective search space used: 4197169635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)