Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11352g6.15ON26823811941e-167
Kwal_56.223996.15ON2742418881e-120
SAKL0E01056g6.15ON2691837871e-105
ZYRO0C07920g6.15ON2931797631e-101
KAFR0A050606.15ON2692147551e-100
KLLA0D01023g6.15ON2682167541e-100
ACR011C6.15ON2532277482e-99
NCAS0D026606.15ON2611847241e-95
NDAI0I022506.15ON2712267241e-95
CAGL0E02673g6.15ON2631797092e-93
TDEL0G045406.15ON2452376961e-91
Kpol_1045.746.15ON2572246952e-91
Ecym_30196.15ON2661896927e-91
Suva_15.1796.15ON2592226857e-90
Smik_15.1736.15ON2512236786e-89
KNAG0F028806.15ON2691946798e-89
Skud_15.1656.15ON2571746726e-88
YOR004W (UTP23)6.15ON2541936674e-87
TPHA0J002806.15ON2711946415e-83
TBLA0A072906.15ON2591936023e-77
Kwal_55.200895.392ON1891431794e-15
KLTH0E02860g5.392ON1891431784e-15
ZYRO0A06754g5.392ON1891461724e-14
KNAG0C052705.392ON1891431714e-14
CAGL0M01056g5.392ON1891431715e-14
AEL102W5.392ON1891431697e-14
SAKL0G07766g5.392ON1891431672e-13
KAFR0D042805.392ON1891431662e-13
NDAI0C045505.392ON1891431662e-13
Ecym_74695.392ON1891431662e-13
TPHA0D023105.392ON1891431663e-13
Kpol_1055.185.392ON1891431653e-13
NCAS0F030905.392ON1891431644e-13
TDEL0E023305.392ON1891461644e-13
Suva_2.5095.392ON1891431635e-13
Skud_4.6065.392ON1891431636e-13
TBLA0H017505.392ON1891431627e-13
YDR339C (FCF1)5.392ON1891431627e-13
Smik_4.5995.392ON1891431627e-13
KLLA0A07018g5.392ON1891431541e-11
KNAG0I005401.426ON33574683.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11352g
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   464   e-167
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   346   e-120
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   307   e-105
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   298   e-101
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   295   e-100
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   295   e-100
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   292   2e-99
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   283   1e-95
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   283   1e-95
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   277   2e-93
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   272   1e-91
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   272   2e-91
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   271   7e-91
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   268   7e-90
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   265   6e-89
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   266   8e-89
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   263   6e-88
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   261   4e-87
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   251   5e-83
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   236   3e-77
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    74   4e-15
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    73   4e-15
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    71   4e-14
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    70   4e-14
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    70   5e-14
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    70   7e-14
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    69   2e-13
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    69   2e-13
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    69   2e-13
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    69   2e-13
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    69   3e-13
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    68   3e-13
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    68   4e-13
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    68   4e-13
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    67   5e-13
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    67   6e-13
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    67   7e-13
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    67   7e-13
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    67   7e-13
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    64   1e-11
KNAG0I00540 Chr9 (91365..92372) [1008 bp, 335 aa] {ON} Anc_1.426...    31   3.0  

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  464 bits (1194), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/238 (94%), Positives = 226/238 (94%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDESPPSDKISVTDAEPVD 238
           AEEEGGKTDNGTEVS            LSIKKKKTVPDSKDESPPSDKISVTDAEPVD
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSDKISVTDAEPVD 238

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  346 bits (888), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 171/241 (70%), Positives = 190/241 (78%), Gaps = 6/241 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTH+A+FDLVKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQAIYET +Q+AIELAKSFERRRCNHPPKEAKPP+ECLQSVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           +Q+  IR  LR+VPGVPL++MNRSVMVMEPLSKAS + SR QE+EKLFKGLNDPK+AGLP
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 181 AEEEGGKTD------NGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDESPPSDKISVTDA 234
             E+            G                LSIKKKKT    K+   P++  S T  
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKEPVNPAENTSATLT 240

Query: 235 E 235
           E
Sbjct: 241 E 241

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  307 bits (787), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 165/183 (90%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFREPYQVLVDDQIV  T+++SFDL KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+Y TK+Q AIE+AK++ERRRCNHPPKE+K  +EC++SVV+ NG NKHRYVVA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           +QD  IR+KLR+VPGVPLIYMNRSVMVMEPLS+AS   S+ +E+EKLFKGLNDPK+AGL 
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 181 AEE 183
            +E
Sbjct: 181 HDE 183

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 161/179 (89%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSY+KQMLVYN+ F+FREPYQVL+DDQ+V D  ++ +DLV GL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+Y TKNQDAIEL KSFERRRCNHPPKEAKPP EC+QSVV+VNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179
           SQD ++R+KLR+VPGVPLI+M+RSVMVMEPLS+AS   +   E+EKL KGLNDPK AGL
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGL 179

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  295 bits (755), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/214 (65%), Positives = 172/214 (80%), Gaps = 1/214 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD++IV  +  ++FDLVKGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+YET++Q+AI++AK FERRRCNHPPKE K PIEC+ SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD  IR++LR+VPGVPL++++RSVM+MEPLS  S   S   E+EKL+KGLNDPKYAGL 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 181 A-EEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKK 213
             EEE  +T    E +            LS++KK
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  295 bits (754), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/216 (65%), Positives = 165/216 (76%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQMLVYNH FKFR+PYQVLVDDQ+V +T  +SFD VKGLQRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+Q++Y+T NQ AI+  K FERRRCNH PKE K  +ECL SVV VNG NKHRYVVA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           +QD  IR++LR++PGVPL+YMNRSVMVMEPLS AS   SR  E++KL+KGLNDPK+AG+ 
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTV 216
            +E         E              LS+KKKKT 
Sbjct: 181 RDENDEAGAENQENKPKKRKGPKEPNPLSMKKKKTT 216

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  292 bits (748), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 170/227 (74%), Gaps = 5/227 (2%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFREPYQVLVDDQIV +T+++SFDL+KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+Q +Y+TKNQDAI   K +ERRRCNH  KE K PIECLQSVV+VNG N+HRY+VA
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD +IR+ LR+VPGVPL+Y+NR+VMVMEPLS  S   SR  EK+KLFKGLNDPKY G+ 
Sbjct: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDESPPSD 227
                                      LS+KK+K     K+E P SD
Sbjct: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKV----KEEQPTSD 222

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  283 bits (724), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 157/184 (85%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQ+LVD+QIV D   +++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+YE  +Q+AIELA+ FERRRCNH PK+ K PIEC++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           +QD +IR+KLRQVPGVPL++++R+VM+MEPLS AS   S+ +E EKL+KGLNDPKY G+ 
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGVK 180

Query: 181 AEEE 184
              E
Sbjct: 181 TAAE 184

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  283 bits (724), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 139/226 (61%), Positives = 172/226 (76%), Gaps = 3/226 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFR PYQVLVD+QIV D   +++DL KGL+ TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+YE  NQDAIELA+ FERRRCNH PKE K  IEC++SVV++NG NKHRYVVA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD + R+KLRQVPGVPLI+++R+VM+MEPLS  S   SR +E EKL+KGLNDPK+ G+ 
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 181 A--EEEGGKTDNGTEVSXXXXXXX-XXXXXLSIKKKKTVPDSKDES 223
           +  ++E  K    T+               LS+KKKKT  +S +E+
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKTASNSMNEN 226

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  277 bits (709), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 128/179 (71%), Positives = 150/179 (83%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH FKFREPYQVL+DDQIV D+  + +DLVK L+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+YETKN+ AI+L K FERRRC H P EA  P EC+ +VV V G NKHRYVVA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179
            QD  IR+ LR+VPGVPL++++RSVM+MEPLS AS   SR +E+ KLF+GLNDPKYAGL
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL 179

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  272 bits (696), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 173/237 (72%), Gaps = 17/237 (7%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAK+YRKQMLVYNH FKFREPYQVLVD+QIV D H ++FDLVKGLQRTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+YET  Q AIELAK+FERRRCNHPPKE KPPIECL+S+V VNG+NKHRYVVA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD   R+ LR+ PGVPL++  RSVMVMEPLS AS   S A E EKL KGLNDP+ AG+ 
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDESPPSDKISVTDAEPV 237
            E         T+              LS+KK+KT  +SK E   +      D EPV
Sbjct: 181 TENPQTSIKKRTK----------QPNPLSVKKRKT--ESKGEPKAAQ-----DTEPV 220

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  272 bits (695), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 132/224 (58%), Positives = 172/224 (76%), Gaps = 8/224 (3%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQ+RAKSYRKQMLVYNH FKFREPYQ +VDDQ+V D  ++ FD++KGL+RTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+Y+T NQ+AI +AK FERRRCNHPPK+ K P+EC++S+V + G+NKHRYVVA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKY-AGL 179
           SQD  IR+KLR++PGVP+++++R+VM++EPLS AS   S   EK+KL+KGLND K+ AGL
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 180 --PAEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKD 221
             P  E+  KT    +              LS+KK+K+ P S +
Sbjct: 181 DEPKSEKSEKTSESKK-----NKGPKQPNPLSMKKRKSKPASNE 219

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  271 bits (692), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 154/189 (81%), Gaps = 1/189 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFR+PYQVLVDDQ+V +T+++SFDL+KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+Q +YE+KNQ AI  AK +ERRRCNH  KE K P EC++SVV +NG N HRYVVA
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYVVA 119

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           +QD  IR+ LR+VPGVPLIYMNRSVMVMEPLS  S   S+  E EKL KGLNDPKYAG P
Sbjct: 120 TQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTP 179

Query: 181 AEEEGGKTD 189
              E    D
Sbjct: 180 NNTEDASVD 188

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  268 bits (685), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 164/222 (73%), Gaps = 3/222 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++FDL  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV+VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   SR  E++KL+KGLNDP      
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEKAE 180

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDE 222
           A  +G + ++                 LS+KKKK    S DE
Sbjct: 181 AISKGSEKES---TPKKRKAGPKAPNPLSMKKKKKTGPSDDE 219

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  265 bits (678), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 131/223 (58%), Positives = 165/223 (73%), Gaps = 3/223 (1%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P +C++SVV +NG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD  +R+KLR VPGVPLI++ RSVMVMEPLS AS   S+  E+ KL+KGLNDP    + 
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 181 AEEEGGKTDNGTEVSXXXXXXXXXXXXLSIKKKKTVPDSKDES 223
              EG   ++   V+            LS+KKKK    + DE+
Sbjct: 181 EISEGSGKES---VTKKRKFGPKAPNPLSVKKKKKAYSTSDEA 220

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  266 bits (679), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 152/194 (78%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVYNH F+FREPYQV++DD+IV     + FDL K LQRT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCC+QA+Y T N+ AI++AK +ERRRCNHPPK+ K P EC++SVV + G NKHRY+VA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
            Q+  +R+KLR+VPGVPLI+++R+VM+MEPLS AS   S+  E++KLF GLND K AG+ 
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 181 AEEEGGKTDNGTEV 194
           A E     D G E 
Sbjct: 181 AAETEKVEDKGKEA 194

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  263 bits (672), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 147/174 (84%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V +   ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQA+YET+N+ AI+LAK FERRRCNH  K+ K P EC++SVV VNG NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDP 174
           SQD  +R+KLR VPGVPLI++ RSVM+MEPLS AS   S+  E++KLFKGLNDP
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDP 174

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  261 bits (667), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 123/193 (63%), Positives = 154/193 (79%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60
           MRQKRAKSYRKQ+LVY+H FKFREPYQVLVD+Q+V + + ++F+L  GL+RTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120
           ITQCCIQA+YET+N  AI LAK FERRRCNH  K+ K P EC++SVV+++G NKHRYVVA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180
           SQD  +R+KLR VPGVPLI++ RSVMVMEPLS AS   S+  E++KL+KGLNDP    L 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 181 AEEEGGKTDNGTE 193
              +G   ++ T+
Sbjct: 181 ESGDGSGKESITK 193

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  251 bits (641), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 157/194 (80%), Gaps = 1/194 (0%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAE-VKP 59
           MRQKRAKSY+KQM+VYNH FKFREPYQ+LVD+QIV D+  ++++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVV 119
           MITQCC+Q +Y T NQ+ I+ AK FERRRCNH  K+ K P+EC++S+V+++G NKHRYVV
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 120 ASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGL 179
           A+Q+  +R+KLR+VPGVP+++++RSVM+MEP+S +S   +R  E+ KL+KGLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSMA 180

Query: 180 PAEEEGGKTDNGTE 193
           P  +EG     GT+
Sbjct: 181 PTPKEGTPDTEGTQ 194

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  236 bits (602), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 147/193 (76%), Gaps = 8/193 (4%)

Query: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAE--VK 58
           MRQKRAKSY+KQ++VYNH FKFREPYQV++DD +V +T RA ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYV 118
           PMITQCCI A+Y++++Q++I + K+FERRRCNH  KE   P EC+ S+V VNG NKHRY+
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 119 VASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAG 178
           VA+QD  +R+KLR++PGVPLI+  RSVMVMEPLS AS +++   E +KL  GLN  K   
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177

Query: 179 LPAEEEGGKTDNG 191
             A  EGG+ +NG
Sbjct: 178 --ASVEGGQ-ENG 187

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   DLV+G+  TL A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D ++++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKL 185

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 73.2 bits (178), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 80/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+  TL A+  PMIT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 70.9 bits (172), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 79/146 (54%), Gaps = 13/146 (8%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   R PYQVL+D   +  + +   D+VKG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C H    A    +CL     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD---DCL-----VNRVMQHKCYIVATNDAPLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPLSKA 154
           ++R++PG+PL+ +     V+E L  A
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDA 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 70.5 bits (171), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 70.5 bits (171), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+VKG+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 69.7 bits (169), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A+ LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D ++++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD---DCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C I  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD---DCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 77/143 (53%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L +  N   R PYQVL+D   +  + +   D++KG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A+ LA+    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D++KG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A+ LA+    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   DLVKG+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A+ LA+    +R  C+H    A    +C+     VN   +H+ ++VA+ D  +++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD---DCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.8 bits (164), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 78/146 (53%), Gaps = 13/146 (8%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   DLV+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPLSKA 154
           ++R++PG+PL+ +      +E L  A
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     V+   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.4 bits (163), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     V+   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +C+     VN   +H+ Y+VA+ D  +++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD---DCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     V+   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 79/143 (55%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+V+G+   L A+  P+IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +CL     V+   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCL-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R++PG+PL+ +     V+E L
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 78/143 (54%), Gaps = 13/143 (9%)

Query: 14  LVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPMITQCCIQAIYET- 72
           L + +N   + PYQVL+D   +  + +   D+VKG+   L A+   +IT C +  + +  
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 73  -KNQDAIELAKS--FERRRCNHPPKEAKPPIECLQSVVSVNGNNKHR-YVVASQDPSIRK 128
            K + A++LA+    +R  C+H    A    +C+     V+   +H+ Y+VA+ D  +++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD---DCI-----VHRVLQHKCYIVATNDAGLKQ 162

Query: 129 KLRQVPGVPLIYMNRSVMVMEPL 151
           ++R+VPG+PL+ +     V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>KNAG0I00540 Chr9 (91365..92372) [1008 bp, 335 aa] {ON} Anc_1.426
           YNR003C
          Length = 335

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 128 KKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKE------KLFKGLNDPKYAGLPA 181
           K L  V GVP +Y  + +  + PL K+ GD     ++       KL K  N+ K+  + A
Sbjct: 31  KMLGSVAGVPKMYTQKELQTLLPLVKSLGDLMMIVQELLDHNLIKLVKQNNELKFQAVDA 90

Query: 182 EEEGGKTDNGTEVS 195
            E   KT   +E S
Sbjct: 91  SEAAKKTAMSSEES 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,057,465
Number of extensions: 982842
Number of successful extensions: 1726
Number of sequences better than 10.0: 50
Number of HSP's gapped: 1737
Number of HSP's successfully gapped: 50
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)