Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11330g6.16ON94194148570.0
Kwal_56.224036.16ON94394338440.0
SAKL0E01078g6.16ON94896226820.0
ACR010C6.16ON94592624220.0
Ecym_30206.16ON94492823910.0
KLLA0D01045g6.16ON96597723860.0
TDEL0G045306.16ON95876122630.0
ZYRO0C07898g6.16ON97488821950.0
NDAI0D008706.16ON106998020900.0
NCAS0H008806.16ON100489720410.0
KAFR0L003706.16ON96389719580.0
TPHA0M002406.16ON93984919010.0
KNAG0M011306.16ON95094516730.0
Kpol_1032.66.16ON100463914131e-180
YEL061C (CIN8)6.16ON100067313841e-175
Smik_5.266.16ON100267113731e-174
Skud_5.286.16ON99866913651e-172
Suva_5.66.16ON99967413331e-168
TBLA0A072306.16ON109754912781e-159
CAGL0B03641g6.16ON98865812681e-158
Kpol_1045.736.16ON96288812541e-156
TPHA0J003006.16ON9829889511e-112
SAKL0F12298g7.387ON11126919351e-109
ACR228C7.387ON11297839311e-108
Ecym_46887.387ON11345489131e-106
Suva_2.547.387ON11107949121e-106
KAFR0L017107.387ON11515709031e-104
Skud_2.417.387ON11106988991e-104
ZYRO0B03234g7.387ON11384738871e-102
YBL063W (KIP1)7.387ON11116998791e-101
NCAS0E026407.387ON11024868721e-100
TDEL0C016007.387ON11054508652e-99
Smik_2.537.387ON11135998531e-97
NDAI0E043007.387ON11864568491e-96
TPHA0E008907.387ON12325498422e-95
TBLA0D006407.387ON11424477176e-79
SAKL0G05016g5.531ON5044554884e-52
SAKL0G18920g2.633ON6493594664e-48
Ecym_34152.633ON6623644648e-48
ADR145C2.633ON6353564407e-45
KLTH0G01606g3.528ON8196114333e-43
Kwal_47.186085.531ON4793674184e-43
KLTH0G03850g5.531ON4733484175e-43
KNAG0B005203.528ON7235744252e-42
Kpol_1013.78.678ON6203554193e-42
KAFR0H024108.678ON6584144194e-42
Kpol_1004.255.531ON5063744108e-42
KLLA0B00759g5.531ON4564414061e-41
KLLA0D05951g8.678ON6683494133e-41
Kwal_47.190933.528ON8193524156e-41
KAFR0F042103.528ON6723544108e-41
TDEL0A062408.678ON6374164052e-40
CAGL0D04994g3.479ON6923634054e-40
NDAI0I029603.528ON8683634032e-39
CAGL0I07029g3.528ON7053533993e-39
Skud_7.533.528ON8053534013e-39
ZYRO0E08668g3.528ON7783524003e-39
Suva_7.443.528ON8053793994e-39
TBLA0C049603.528ON8013563986e-39
ZYRO0D12650g5.531ON4783783841e-38
YGL216W (KIP3)3.528ON8053533951e-38
Smik_7.483.528ON8053533923e-38
TBLA0C053103.479ON6763473885e-38
SAKL0F01760g3.528ON8093513915e-38
Kpol_423.83.528ON8063523898e-38
TBLA0C039403.479ON7393623861e-37
AER441C3.528ON8183523872e-37
SAKL0H06490g8.678ON6574333795e-37
CAGL0M02189g8.678ON6723703795e-37
Kpol_505.393.479ON6923483796e-37
TDEL0F036403.479ON7043563789e-37
TPHA0D012708.678ON6963923781e-36
Ecym_12003.528ON8333513801e-36
NCAS0F034703.479ON6983563771e-36
TPHA0D032003.479ON7243523771e-36
NDAI0B057703.479ON7633543744e-36
SAKL0F03168g3.479ON7063573701e-35
KLLA0A01606g3.528ON7693533711e-35
NCAS0C013508.678ON6553583681e-35
Skud_16.4353.479ON7293553682e-35
ACR145W8.678ON6853833672e-35
KLTH0D11286g8.678ON6783623672e-35
TPHA0D034803.528ON8473543702e-35
ZYRO0F07414g8.678ON6543563627e-35
Kwal_26.88068.678ON7154273639e-35
Ecym_44073.479ON7113503621e-34
TDEL0D059603.528ON7333523621e-34
NCAS0E005503.528ON7843493593e-34
Smik_16.3883.479ON7293523574e-34
YPL155C (KIP2)8.678ON7063783541e-33
Ecym_23958.678ON6873893503e-33
Skud_16.1278.678ON7063753503e-33
NDAI0E02090singletonON6853723451e-32
Smik_6.3528.678ON7153803333e-31
Kpol_1050.1033.479ON6973683308e-31
Suva_16.1558.678ON7043793192e-29
TPHA0D041903.479ON6723433146e-29
Ecym_40665.531ON4781752911e-26
TDEL0B072702.633ON6443862932e-26
KNAG0A078803.479ON7641552925e-26
Kpol_1019.112.633ON6474402905e-26
KAFR0B065903.479ON7061592801e-24
KLTH0F14498g3.479ON7021672754e-24
Suva_16.4693.479ON7311472649e-23
ZYRO0B04290g3.479ON7311492594e-22
YPR141C (KAR3)3.479ON7291462551e-21
KLLA0B10956g3.479ON6901472532e-21
AGR253W3.479ON7091702505e-21
KNAG0J017208.678ON6252982291e-18
TBLA0C018808.678ON4681492224e-18
TPHA0N016502.633ON6824882221e-17
Kwal_55.21164singletonOFF5882381791e-12
Kwal_YGOB_55.211643.479ON6572381791e-12
Suva_11.1452.633ON6571291683e-11
YKL079W (SMY1)2.633ON6561211683e-11
Smik_11.1602.633ON6561301584e-10
TBLA0A008202.633ON8034191577e-10
CAGL0L05104g2.633ON6755501522e-09
Skud_11.1482.633ON6561211461e-08
NCAS0C052002.633ON5723261461e-08
KNAG0M025402.633ON5221271432e-08
TBLA0C008002.633ON6932451398e-08
NDAI0C004802.633ON5983751334e-07
NCAS0H031802.633ON6602811325e-07
ZYRO0E01078g2.633ON6681081236e-06
KAFR0C040202.633ON6671061112e-04
KNAG0H003602.633ON6811291084e-04
NCAS0C028308.401ON874131860.16
TPHA0A048705.131ON301170820.31
NCAS0A093301.295ON1227227810.66
SAKL0H10956g8.505ON444139800.75
KLTH0E13002g8.560ON823191771.8
KAFR0F041103.514ON75341762.5
TBLA0F027507.488ON1414229762.7
Ecym_82775.215ON98477744.5
NCAS0B007208.765ON127287735.2
ZYRO0G21296g1.295ON1227240727.7
TBLA0I021803.313ON10661669.2
Kwal_26.84002.178ON23953699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11330g
         (941 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...  1875   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...  1485   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...  1037   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   937   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   925   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   923   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   876   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   850   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   809   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   790   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   758   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   736   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   649   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   548   e-180
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   537   e-175
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   533   e-174
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   530   e-172
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   518   e-168
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   496   e-159
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   493   e-158
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   487   e-156
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   370   e-112
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   364   e-109
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   363   e-108
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   356   e-106
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   355   e-106
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   352   e-104
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   350   e-104
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   346   e-102
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   343   e-101
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   340   e-100
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   337   2e-99
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   333   1e-97
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   331   1e-96
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   328   2e-95
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   280   6e-79
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   192   4e-52
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   184   4e-48
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   183   8e-48
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   174   7e-45
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   171   3e-43
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   165   4e-43
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   165   5e-43
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   168   2e-42
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   166   3e-42
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   166   4e-42
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   162   8e-42
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   160   1e-41
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   163   3e-41
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   164   6e-41
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   162   8e-41
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   160   2e-40
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   160   4e-40
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   159   2e-39
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   158   3e-39
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   159   3e-39
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   158   3e-39
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   158   4e-39
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   157   6e-39
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   152   1e-38
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   156   1e-38
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   155   3e-38
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   154   5e-38
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   155   5e-38
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   154   8e-38
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   153   1e-37
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   153   2e-37
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   150   5e-37
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   150   5e-37
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   150   6e-37
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   150   9e-37
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   150   1e-36
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   150   1e-36
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   149   1e-36
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   149   1e-36
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   148   4e-36
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   147   1e-35
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   147   1e-35
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   146   1e-35
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   146   2e-35
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   145   2e-35
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   145   2e-35
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   147   2e-35
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   144   7e-35
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   144   9e-35
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   144   1e-34
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   144   1e-34
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   142   3e-34
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   142   4e-34
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   140   1e-33
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   139   3e-33
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   139   3e-33
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   137   1e-32
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   132   3e-31
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   131   8e-31
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   127   2e-29
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   125   6e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   116   1e-26
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   117   2e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   117   5e-26
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   116   5e-26
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   1e-24
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   110   4e-24
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   106   9e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   104   4e-22
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   102   1e-21
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   2e-21
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   100   5e-21
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    93   1e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    90   4e-18
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    90   1e-17
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    74   1e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    74   1e-12
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    69   3e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    69   3e-11
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    65   4e-10
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    65   7e-10
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    63   2e-09
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    61   1e-08
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    61   1e-08
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    60   2e-08
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    58   8e-08
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   4e-07
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     55   5e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    52   6e-06
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    47   2e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    46   4e-04
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     38   0.16 
TPHA0A04870 Chr1 complement(1102393..1103298) [906 bp, 301 aa] {...    36   0.31 
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    36   0.66 
SAKL0H10956g Chr8 complement(947455..948789) [1335 bp, 444 aa] {...    35   0.75 
KLTH0E13002g Chr5 complement(1149687..1152158) [2472 bp, 823 aa]...    34   1.8  
KAFR0F04110 Chr6 complement(802711..804972) [2262 bp, 753 aa] {O...    34   2.5  
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    34   2.7  
Ecym_8277 Chr8 (559750..562704) [2955 bp, 984 aa] {ON} similar t...    33   4.5  
NCAS0B00720 Chr2 (105858..109676) [3819 bp, 1272 aa] {ON} Anc_8....    33   5.2  
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    32   7.7  
TBLA0I02180 Chr9 (505818..506138) [321 bp, 106 aa] {ON} Anc_3.31...    30   9.2  
Kwal_26.8400 s26 complement(766497..767216) [720 bp, 239 aa] {ON...    31   9.2  

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score = 1875 bits (4857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 913/941 (97%), Positives = 913/941 (97%)

Query: 1   MSEEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKT 60
           MSEEEELNITVAVRCRGRN              PDVTGTNEVSINTTGDTGITAQINSKT
Sbjct: 1   MSEEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE
Sbjct: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180
           LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD
Sbjct: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180

Query: 181 SVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQ 240
           SVT              KPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQ
Sbjct: 181 SVTNPNSSRSSSRNSSPKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQ 240

Query: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKM 300
           NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKM
Sbjct: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKM 300

Query: 301 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ 360
           NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ
Sbjct: 301 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ 360

Query: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAE 420
           DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAE
Sbjct: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAE 420

Query: 421 LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKR 480
           LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKR
Sbjct: 421 LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKR 480

Query: 481 ITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYED 540
           ITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYED
Sbjct: 481 ITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYED 540

Query: 541 QGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFIN 600
           QGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFIN
Sbjct: 541 QGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFIN 600

Query: 601 TSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDY 660
           TSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDY
Sbjct: 601 TSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDY 660

Query: 661 LNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAAS 720
           LNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAAS
Sbjct: 661 LNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAAS 720

Query: 721 EVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAV 780
           EVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAV
Sbjct: 721 EVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAV 780

Query: 781 GDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDD 840
           GDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDD
Sbjct: 781 GDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDD 840

Query: 841 SIQGLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPR 900
           SIQGLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPR
Sbjct: 841 SIQGLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPR 900

Query: 901 KRSYSISPIREIDGNRKASSPFKRKITIDHENVPFSSQKIE 941
           KRSYSISPIREIDGNRKASSPFKRKITIDHENVPFSSQKIE
Sbjct: 901 KRSYSISPIREIDGNRKASSPFKRKITIDHENVPFSSQKIE 941

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score = 1485 bits (3844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/943 (76%), Positives = 820/943 (86%), Gaps = 2/943 (0%)

Query: 1   MSEEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKT 60
           MS++EELNITVAVRCRGRN              PDVTGTNEVSINTTGDTGITAQINSKT
Sbjct: 1   MSDDEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKT 60

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YTVD+VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE
Sbjct: 61  YTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180
           LSEGAGIIPRVLFKLFDAL A  DDYMIKCSFIELYNEELKDLLDETPDSSMP+KLRIFD
Sbjct: 121 LSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180

Query: 181 SVTXXXXXXXXXXXXXX-KPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHI 239
           SV+               KP EGS+ GT+R+ R  ++++P++SP  KP    E +SAIHI
Sbjct: 181 SVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPCEPSSAIHI 240

Query: 240 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSK 299
           QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY+KCNGESFRVSK
Sbjct: 241 QNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRVSK 300

Query: 300 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLL 359
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTRLL 360

Query: 360 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTA 419
           QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL+K+VTA
Sbjct: 361 QDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSVTA 420

Query: 420 ELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEK 479
           ELVKI+SDLL+TKSKDGIYMSQENYKELTNELENYKTEV+ECKRA+E++S QN LL KEK
Sbjct: 421 ELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIKEK 480

Query: 480 RITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYE 539
           R++NEVNESQ++K++KL NNI+FLYDKIDRQHKNEQELSNVVQELMRAL TMQ SL++YE
Sbjct: 481 RVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRIYE 540

Query: 540 DQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK-GTEEDGFDVDANIDTLTKELNRIYDF 598
           DQG RF TEMERVLY+NIGSFK SL++EIEKLK   +E+G DV+ N+D +T EL RI+DF
Sbjct: 541 DQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIFDF 600

Query: 599 INTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLK 658
           +N+S IE+ R ++ K+ +QTP Y +DI +QVESIT VV SYSS+LM+HLSSISEEYN+LK
Sbjct: 601 MNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNNLK 660

Query: 659 DYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNA 718
           DYLNEHFFKNNFQ+ALDVHVDRTYHQLKVSANSIFLKLREM+NEEL+TNKE MMQSL++A
Sbjct: 661 DYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLRHA 720

Query: 719 ASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSES 778
           ASEVVAKEM LLDPVKQAWE+SLENINECDKLN+ FE  IG  V ++F+ I++G + S+ 
Sbjct: 721 ASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTSQV 780

Query: 779 AVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEI 838
              DA  +L+R + A  +L+ + +I  +++ IKKKHN+LK +VQDSA+YM+AATQKFGEI
Sbjct: 781 TTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFGEI 840

Query: 839 DDSIQGLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSL 898
           D+SIQ LLN+Q + QP SEN I+GLLEQLN K LKPLGPSGKTPMR  Q  + ++DQL  
Sbjct: 841 DNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQLLP 900

Query: 899 PRKRSYSISPIREIDGNRKASSPFKRKITIDHENVPFSSQKIE 941
           P+K SY+ISPI+EIDGNR+ +SP KR +  DHE   F SQ+IE
Sbjct: 901 PQKSSYTISPIKEIDGNRRLTSPHKRGVVSDHERPAFKSQRIE 943

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/962 (56%), Positives = 691/962 (71%), Gaps = 43/962 (4%)

Query: 1   MSEE--EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS 58
           +SEE  +ELNITV+VRCRGRN              PDVTG+NEVSINTT + GITAQ+NS
Sbjct: 9   LSEENGQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNS 68

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           KTYTVD+VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD
Sbjct: 69  KTYTVDKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 128

Query: 119 GELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
           GELS+ AGIIPR+LFKLFD L+  ++DY++KCSFIELYNEELKDLL+E  +S + +KLRI
Sbjct: 129 GELSDAAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRI 188

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRI-RPNTMYKPS---------------RS 222
           FDS T               P    TSGT +RI +    YK                 R 
Sbjct: 189 FDSNTTSSNSRNNSRNN--SPNLVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRL 246

Query: 223 PTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIF 282
              K    SE +SAI+IQNLQEFHI +AK+GI LLQRGL+HRQVASTKMND SSRSHTIF
Sbjct: 247 INNKQQSLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIF 306

Query: 283 TIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 342
           TIMLY+  NGE FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA
Sbjct: 307 TIMLYKNHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 366

Query: 343 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKP 402
           DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN+EETSSTLEYATKAKNIKNKP
Sbjct: 367 DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKP 426

Query: 403 QVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECK 462
           Q+G+ +MKD+LVKN+T EL KI+SD L+TKSKDGIYM+Q++YKELT++LENYKTEVQECK
Sbjct: 427 QLGTLVMKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECK 486

Query: 463 RAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQ 522
           R IE++++QN LL K+KR ++EV+E QR+KIK L++ I  LYDK+D+QHKNEQ+L   + 
Sbjct: 487 REIEKMNSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIH 546

Query: 523 ELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDV 581
            L  A+ T+QNSLK  ED   + ++EME VLY+++ SFK S+  ++  +K +       +
Sbjct: 547 TLKDAIYTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGI 606

Query: 582 DANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSS 641
           D NID + +EL+++ + I ++++++CR  + KI E  P + + IR  +  I+ VV SYS+
Sbjct: 607 DGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSN 666

Query: 642 DLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMN 701
           +L+ +L  ISEEYN+ ++YLNEH FKNN ++ L +HVD+TYH LK SA  +F K +EMM+
Sbjct: 667 ELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMD 726

Query: 702 EELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSV 761
             LE NK +M++SLK A+ EVVAKE+ L  PVKQ WESSLENIN+CD LN+ F+  +   
Sbjct: 727 SHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDA 786

Query: 762 VRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKV 821
           +R +   I   L+FS++  GD    L +F   S  L+ +  +  +I E+K+KH  L+ +V
Sbjct: 787 LRRLEGNIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQV 846

Query: 822 QDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGK 880
           + ++SY+EAA +KF  ID  I+ +++ +  +        +  +LEQL    LKP+G + +
Sbjct: 847 ERTSSYIEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSASR 906

Query: 881 TPMRITQGCIASSDQLSLPRKRSYSISPIREIDGN-RKASSPFKRKITIDHENVPFSSQK 939
           TP                    S S+SP++ +D N     SP KRK+  + EN    SQ+
Sbjct: 907 TP-------------------SSRSVSPMKTLDNNIFNGISPSKRKVD-ETENDRSKSQR 946

Query: 940 IE 941
           I+
Sbjct: 947 IK 948

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/926 (52%), Positives = 647/926 (69%), Gaps = 19/926 (2%)

Query: 4   EEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTV 63
           +EELNITVAVRCRGRN              PDVTG+NEVSINTT + GI A++NS+TYTV
Sbjct: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 64  DRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           D+VFGPSADQ LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYDG+LS+
Sbjct: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137

Query: 124 GAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVT 183
            AGIIPR++FKLFDAL+A + D+++KCS+IELYNEELKDLLDE+ DSS  ++LRIFDS +
Sbjct: 138 SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDSSS 195

Query: 184 XXXXXXXXXXXXXXKPPEGSTSG-TKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNL 242
                         + PE + +G ++RR RP  + K +R    K  LS E  S I++QN+
Sbjct: 196 MNHSSRASSQSNSPREPEVAHNGFSRRRQRPPPV-KANRMSATKQQLS-ESGSGIYVQNV 253

Query: 243 QEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNL 302
           QEFHI++A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLY+ C+GE FRVSKMNL
Sbjct: 254 QEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNL 313

Query: 303 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDS 362
           VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDS
Sbjct: 314 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDS 373

Query: 363 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELV 422
           LGGNTKTALIATISPAKIN++ETSSTLEYA KAKNIKN+PQ+G+ +MKD+LVKN+++EL 
Sbjct: 374 LGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELA 433

Query: 423 KIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRIT 482
           KI+SD L+TKSKDGIYMS E+Y+E+ N+LEN +TE+QE KR IE L++QN LL K+K+ +
Sbjct: 434 KIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKAS 493

Query: 483 NEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQG 542
            EV E Q  KIKKL + I++LYDKI+RQH NE EL+  + +L  AL TMQ SLK YE   
Sbjct: 494 QEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHE 553

Query: 543 HRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDVDANIDTLTKELNRIYDFINT 601
            R Q +++ VLY+ I S++ S+   +EK+K +  D    +  NI+ +T   +     +  
Sbjct: 554 LRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEA 613

Query: 602 STIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYL 661
           +  ++C   +  I E    YL++    V S+   + SYS+ L   L+ ISEE NHL++YL
Sbjct: 614 NGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYL 673

Query: 662 NEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASE 721
           ++H FKN+ Q+ LD+ ++  Y ++K  ++ +  KL  M+   +E ++ +M+ S+K+  +E
Sbjct: 674 DQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNE 733

Query: 722 VVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVG 781
           ++  E  L  P++  W +S +NIN+CD  +  FE    S +  + E  +  L+ SE AV 
Sbjct: 734 IIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVN 793

Query: 782 DANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDS 841
            A      F D  + L  D  +   + +I  KH ML+    D+  Y + +++ F ++D S
Sbjct: 794 KAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCS 853

Query: 842 IQGLLN--SQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMR-ITQGCIASSDQLSL 898
           I+ +++  S  V    S   +E L+E++N +   P+ P+GKTP R + +  I S      
Sbjct: 854 IKKIIHEMSPEVGDIKS---VETLMERINARTFSPVRPTGKTPSRQVLKNAITS------ 904

Query: 899 PRKRSYSISPIREIDGNRKASSPFKR 924
            +  S S+SPI+ +D N +  SP KR
Sbjct: 905 -KASSRSMSPIKTLDTNVRIISPVKR 929

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  925 bits (2391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/928 (50%), Positives = 647/928 (69%), Gaps = 13/928 (1%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PDVTG+NEVSINTTGD GI  ++NS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGPSADQ LIFK IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTX 184
           AGIIPRVLF+LFD L+A   D+++KCS+IELYNEELKDLLD+TPD S  ++LRIFDS T 
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS--KRLRIFDSNTI 196

Query: 185 XXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNLQE 244
                        K  +G++S   +R   +   KP R P++   L  E +SAI+IQNLQE
Sbjct: 197 TNSRAGSQNNSP-KEQDGTSSSMAKRRYTHIPTKPKR-PSLNKQLLYEQSSAIYIQNLQE 254

Query: 245 FHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVD 304
           FHI +A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLY+   GE FR+SKMNLVD
Sbjct: 255 FHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFRISKMNLVD 314

Query: 305 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLG 364
           LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDSLG
Sbjct: 315 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLG 374

Query: 365 GNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKI 424
           GNTKTALIATISPAKIN++ETSSTLEYATKAKNIKN+PQ+GSF+MKD+LVK++++EL K+
Sbjct: 375 GNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKSISSELSKL 434

Query: 425 RSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNE 484
           +SD L+TK+K+GIYMS E+Y+E+ N+LENY+TE+QE KR +E  S+QN LL K+K+ + +
Sbjct: 435 KSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLLKDKKASQQ 494

Query: 485 VNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHR 544
           +NE Q +KI +L N I++L DKI+RQH+NE +L + + +L  AL TM+ SL+ YE    R
Sbjct: 495 LNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQNYETHELR 554

Query: 545 FQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDVDANIDTLTKELNRIYDFINTST 603
            Q +++ VLY+ I S++ S+   +E +K    D    ++ N+D +    +   D + ++ 
Sbjct: 555 LQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHETLDSVRSAG 614

Query: 604 IEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNE 663
            ++C   +  + +Q  T  Q  +  +  +   V +YS  L   L+ ++EE N++K+YL+E
Sbjct: 615 SDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDE 674

Query: 664 HFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVV 723
           HF KNN Q+ LD+ +++ YH+ K +++++   +  MM   +E ++ +M+ S+K+A SE++
Sbjct: 675 HFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSMKDAVSEMI 734

Query: 724 AKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDA 783
            KE+ +  PVK+ W  S ENINECD  +  FE     ++ ++ E  +  +  ++      
Sbjct: 735 DKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVVAADDVAKQV 794

Query: 784 NLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQ 843
             +++ F+   R     + I   + +I  KH ML+   +++  Y + +++ F E+D SI+
Sbjct: 795 QENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGFEEMDCSIK 854

Query: 844 GLLNSQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRS 903
            ++   +  +     +IE LLE++N +   P+  +GKTPMR          +  +P+ RS
Sbjct: 855 KIIREMS-PEVGDIKQIEALLERVNSRSFGPIASTGKTPMR-------PELKNPIPKTRS 906

Query: 904 YSISPIREIDGNRKASSPFKRKITIDHE 931
            S+SPI+ +D N     P  ++ T+D E
Sbjct: 907 RSMSPIKSLDTNVVHVVPLIKRGTMDIE 934

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/977 (50%), Positives = 666/977 (68%), Gaps = 62/977 (6%)

Query: 3   EEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           E +ELNITVAVRCRGRN              PDV G NEVSINT+GD GITA++NSKTYT
Sbjct: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68

Query: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
           VD+VFGPSADQ L+FK IA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS
Sbjct: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELS 128

Query: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDS--SMPRKLRIFD 180
           E AGIIPRVLFKLFD L+    DYM+KCSFIELYNEELKDLLD+  DS  +  RKLRI+D
Sbjct: 129 EAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYD 188

Query: 181 SVTXXXXXXXXXXXXXXKPPEGSTS-GTKRRIRPNTMYKPSRSPTVKPTLS--------- 230
           S+               +    + +   KRRIR   +YKP      KP L          
Sbjct: 189 SLNSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKP------KPKLPTQSQSNGQQ 242

Query: 231 --------------------SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTK 270
                               +E +SAI+IQ+LQEFHI DAKEG+RLLQ+GL HRQVASTK
Sbjct: 243 QQQQQQQQQQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTK 302

Query: 271 MNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 330
           MNDVSSRSHTIFT+ LY+  NGE+FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQS
Sbjct: 303 MNDVSSRSHTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQS 362

Query: 331 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 390
           LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE
Sbjct: 363 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 422

Query: 391 YATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE 450
           YATKAKNIKNKPQ+GSF+MKD+LVKN++ EL K++SD L+TKSK+GIYMS  +Y E+ N+
Sbjct: 423 YATKAKNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMND 482

Query: 451 LENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQ 510
           +ENYKTE+QE +R IE+LS+QN LL K+K+ + +  ESQRL+I+ L +++D+LY+KID +
Sbjct: 483 IENYKTEIQESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLK 542

Query: 511 HKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEK 570
           HKNE EL+N++ +L  A+R MQ +LK +ED   R Q++++++LY+NI  ++  +  +++ 
Sbjct: 543 HKNEIELTNMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDN 602

Query: 571 LKGTE-EDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQV 629
           LK    E  F +D +I+ +   L  + + +    I +C     K+    P +   + +++
Sbjct: 603 LKQQALEQSFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSEL 662

Query: 630 ESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSA 689
             +   V  ++  L   LS I+ E N+LK YL+ HFF+NN Q+ L+VH D+TYHQL +S+
Sbjct: 663 NDMFSKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSS 722

Query: 690 NSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDK 749
             +  K+  ++++ +E N+ ++M +LK A +EV+ +EM   +PV++ WE S  +IN CD 
Sbjct: 723 KHLMSKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDS 782

Query: 750 LNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANL-------DLSRFQDASRALRTDDV 802
           L++ F KD      D  E +N      ES V +++L       +L  FQD +        
Sbjct: 783 LSNKF-KD------DTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTN 835

Query: 803 IPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRIEG 862
           I G++++IK KH++L+ +++ + S++ A+++ F  ID S++ ++N + + +  +E   + 
Sbjct: 836 INGTVDDIKNKHSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFR-MPEGKTETLADD 894

Query: 863 LLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRSYSISPIREIDGNRKASSPF 922
           L++ ++   + P+  SGKTP+R      + + Q SL    S S+SP +        +SP 
Sbjct: 895 LIKHIDSSSVAPVASSGKTPLRPL--LKSETKQRSL----SKSVSPAKSSHAT-IINSPL 947

Query: 923 KRKITIDHENVPFSSQK 939
           KRK + D    P +S+K
Sbjct: 948 KRK-SSDSRIFPGNSKK 963

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/761 (57%), Positives = 562/761 (73%), Gaps = 5/761 (0%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PDVTG+NEVSINTTGD GITAQINSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
            VFGPSA+Q L+F+ IAEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LYDGELSE 
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTX 184
           AGIIPR+LFKLF+ L+   +DY++KCSF+ELYNEELKDLL ++ + +  RKLRIFDS T 
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192

Query: 185 XXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTM----YKPSRSPTVKPTLSSELNSAIHIQ 240
                        K    ++  +   +   T     +K + S T     S + N+ I+IQ
Sbjct: 193 SAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAPSVTQSHQNSQDQNAGIYIQ 252

Query: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKM 300
           NLQ+FHI +AKEGI+LLQ+GL+HRQVA+TKMND SSRSHTIFTI LY++ NGE FRVSKM
Sbjct: 253 NLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKM 312

Query: 301 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQ 360
           NLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DK+ H+PFRESKLTRLLQ
Sbjct: 313 NLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQ 372

Query: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAE 420
           DSLGGNTKTALIATISPAKINSEET STL+YA KAKNIKNKPQ+GS IMKD+LVKN+T E
Sbjct: 373 DSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGE 432

Query: 421 LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKR 480
           L KI++DLL+TKSK+GIYMSQ+NYKELTN+LE+YKTEV+ECKRAIE L++QN LL K+K+
Sbjct: 433 LAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKK 492

Query: 481 ITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYED 540
            +NEVN+ QR+K++ + + +  LY K ++Q+K EQ L      L   + TMQ+ +K +E 
Sbjct: 493 ASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHER 552

Query: 541 QGHRFQTEMERVLYENIGSFKHSLLNEIEKL-KGTEEDGFDVDANIDTLTKELNRIYDFI 599
           +    +++M  +        K ++L+ I  + +  + +   V  NID++  E++++ +  
Sbjct: 553 RERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERA 612

Query: 600 NTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKD 659
              T ++ +  + KI ++TP + Q    +V  +  ++ +   DL  +LS +SEE+N+L+ 
Sbjct: 613 QQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQ 672

Query: 660 YLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAA 719
           YLN+HFFKNN ++ L  H+DRTYH ++ SA+ +F + +EMM+  LE NK++M++SLK A 
Sbjct: 673 YLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTAT 732

Query: 720 SEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGS 760
            +V+ KEM L +P K+ WE S + IN+CD +N  F+  + S
Sbjct: 733 YDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKS 773

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/888 (50%), Positives = 595/888 (67%), Gaps = 46/888 (5%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVR RGRN              PDV G++EV+INTT D GITAQ+NSKTY VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGPSA+Q LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY+ ELS+ 
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTX 184
           AGIIPR+LFKLF+ LD  ++DY++KCSF+ELYNEELKDLLD++ ++S  RKLRI+DS + 
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192

Query: 185 XXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKP----------------- 227
                          P+  T     R R  T+  P  S   K                  
Sbjct: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTV--PLSSSLAKQQHQWQQRREQQHQLREQ 250

Query: 228 -----------------TLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTK 270
                                +  S ++IQNLQ+FHI  A++G++LLQ+GLR+RQVA+TK
Sbjct: 251 QQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTK 310

Query: 271 MNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 330
           MND SSRSHTIFTI LYR+  GE F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQS
Sbjct: 311 MNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQS 370

Query: 331 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 390
           LLTLGRVINSLADK+AH+PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEET STL+
Sbjct: 371 LLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQ 430

Query: 391 YATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE 450
           YA+KAKNIKN+PQ+ SFIMKD+LVKN+TAEL K++SDLL+TK ++G+YMSQ+NYKE+TN+
Sbjct: 431 YASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITND 490

Query: 451 LENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQ 510
           LE+YKTE+QE KR IERLS+QN LL K+K+ +NEVNE QR+K++ + + +  L +K++ Q
Sbjct: 491 LESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQ 550

Query: 511 HKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEK 570
           HK EQEL ++   L   L   Q+ +K Y  +  +    M+ +L +    F+  L+N IE 
Sbjct: 551 HKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIED 610

Query: 571 LKGTEEDGFD---------VDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTY 621
           ++ T   G D         +  N++ L +E+  +         ++ + ++ KI E+ PT 
Sbjct: 611 IR-TNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTV 669

Query: 622 LQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRT 681
            Q I N+V+ +   V +Y   L  +LS ISE YN+LK Y N+HFFKNN ++ L+ H+D+T
Sbjct: 670 FQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKT 729

Query: 682 YHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSL 741
           Y QL+ SA+ +  K ++MM++ L+ NK +MM+SL++A +E + KEM L +P ++ WE S 
Sbjct: 730 YQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESF 789

Query: 742 ENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDD 801
           + IN CD +++GF  D+ S + D+             +V     ++  ++DAS  L  ++
Sbjct: 790 DLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGNE 849

Query: 802 VIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQ 849
           V+   I +I  K + L+  +  S    +     F E+ + I+  + S+
Sbjct: 850 VVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASE 897

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/980 (46%), Positives = 615/980 (62%), Gaps = 112/980 (11%)

Query: 7    LNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVDRV 66
            LNITVAVRCRGRN              PD+ G+NEVSINTT D GITAQ+NSKTYTVD+V
Sbjct: 52   LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 67   FGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAG 126
            FGPSA+Q LIF  +AEPLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSE AG
Sbjct: 112  FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 127  IIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDE-----TPDSSMPRKLRIFDS 181
            IIPR+LFKLFD L+ + +DY++KCSFIELYNE+LKDLL++         S   KLRIFDS
Sbjct: 172  IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

Query: 182  VTXX------XXXXXXXXXXXXKP---PEGSTSGT------KRRIRPNTMYKPSRS---- 222
             T                     P   P  S  GT      +R+++ +    P  S    
Sbjct: 232  STASNVNVPGSNASSRANSRNNSPRLNPSTSNVGTTNNNYLRRKLKSSRYSNPENSNIFT 291

Query: 223  -----------------------------------PTVKPTLSSEL------NSAIHIQN 241
                                               P   PT S E       N+ I+IQN
Sbjct: 292  SNASSSVKNMTKNSFLSNSKNQTSNLNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQN 351

Query: 242  LQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMN 301
            LQEFHI +AKEG+ LLQ+GL++RQVASTKMND SSRSHTIFTI LY++  G  FR+SKMN
Sbjct: 352  LQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMN 411

Query: 302  LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQD 361
            LVDLAGSENI+RSGA NQRAKE GSINQSLLTLGRVINSLAD+N HIPFRESKLTRLLQD
Sbjct: 412  LVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQD 471

Query: 362  SLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAEL 421
            SLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GS I KD+L+KN+T EL
Sbjct: 472  SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKDILLKNITTEL 531

Query: 422  VKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRI 481
             +++SDLL+TKSK+GIYMSQE+Y++L NEL+N+KTE  E KR IERLS+QN LL K+KR 
Sbjct: 532  SQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQNALLLKDKRT 591

Query: 482  TNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQ 541
            +NEVNE QR+K+ K  ++I+ L +KI+ Q+  EQ L + V +L  +  T +  ++ YE Q
Sbjct: 592  SNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQ 651

Query: 542  GHRFQTEMERVLYENIGSFKHSLLNEIEKLK----GTEEDGFDVDANIDTLTKELNRIYD 597
                ++++E++L +++ S ++ L +   K+K    GT+   FD+ +N+D +  E+ ++  
Sbjct: 652  QIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTD---FDIGSNLDMIQNEVIKMLG 708

Query: 598  FINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHL 657
                   +  ++F+    +QTP   + I   +  I   + ++ + +  +LS ISEEYN+L
Sbjct: 709  TTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNL 768

Query: 658  KDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKN 717
            K YLNE+ F+NN +D ++ H++ T   L  SA+ +F   ++MMN+ LE+N+ +M+ S K 
Sbjct: 769  KQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKA 828

Query: 718  AASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSE 777
            A  EV+ KEM L  P K+ WE S++ IN+CD LN+GF+K+           + +GL ++ 
Sbjct: 829  ATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKE-----------VTDGLSYTR 877

Query: 778  SAVGDANLDLSRFQDASRALRT--------------------DDVIPGSIEEIKKKHNML 817
            S +  +   +++  D S  L+T                    + +I     E+ +K+++ 
Sbjct: 878  SKITAS---INQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIF 934

Query: 818  KLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRIEGLLEQLNGK--PLKPL 875
            +  V++S     A+      ++DSI+  +    +    +E  +    ++ NGK  P KP 
Sbjct: 935  QDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEVGVPFKKENGKEGPTKP- 993

Query: 876  GPSGKTPMRITQGCIASSDQ 895
               G  P++ T     +S Q
Sbjct: 994  ---GLQPLQPTNEIFLNSQQ 1010

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/897 (48%), Positives = 581/897 (64%), Gaps = 56/897 (6%)

Query: 3   EEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           E+ ELNITVAVRCRGRN              PD+TG  E+SINTTG+TGITAQ+NSKTYT
Sbjct: 25  EDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYT 84

Query: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE-- 120
           VD+VFGP+ADQ LIF+ +AEPLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LY     
Sbjct: 85  VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTM 144

Query: 121 LSEGAGIIPRVLFKLFDALDAH--------NDDYMIKCSFIELYNEELKDLLDETPDSSM 172
           LS+ AGIIPR+LFKLFD LD H          D+++KCSF+ELYNE+LKDLL+   +   
Sbjct: 145 LSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQ 204

Query: 173 -------PRKLRIFDSVTXXXXXXXXXXXXXXK------------PPEGSTSGTKR---- 209
                   RKLRIFDS                             P   +T+   R    
Sbjct: 205 QQQQQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKKSI 264

Query: 210 RIRPNTMYKPSRSPTVKPTLSSELNS---------AIHIQNLQEFHIMDAKEGIRLLQRG 260
           R   N+  K   S   +P  + E +S          I+IQNLQEFHI +AKEG+ LLQ+G
Sbjct: 265 RYNYNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQKG 324

Query: 261 LRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQR 320
           L+HRQVASTKMND SSRSHTIFTI LY++     FR+SKMNLVDLAGSENI+RSGA NQR
Sbjct: 325 LKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQR 384

Query: 321 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 380
           AKE GSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+
Sbjct: 385 AKETGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKV 444

Query: 381 NSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMS 440
            SEET STLEYA+KAKNIKNKPQ+GS I+KD+L+KN+T+EL K++SDL++TKSKDGIYMS
Sbjct: 445 TSEETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMS 504

Query: 441 QENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNI 500
            E+Y+EL  ELE+ KTEVQE KR IE+LS+QN +L K+KR  NEVNE QR+K+  L +++
Sbjct: 505 HEHYQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSM 564

Query: 501 DFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSF 560
             L +K++ Q+  E +L   + +L ++   + + +K Y+ +  + +T++  +L EN+   
Sbjct: 565 SNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQLKTQISNILNENLFEL 624

Query: 561 KHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPT 620
           K  +LN  +      E  FDV+ N+  +  E+  + +     T  + ++F+ +  EQTP 
Sbjct: 625 K-KILNSHKDAIRQSEGNFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPI 683

Query: 621 YLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDR 680
            LQ I   V  +  +V  Y +++  +LS ISEEYN+LK YL+  FF+NN +D L++H++ 
Sbjct: 684 NLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINA 743

Query: 681 TYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESS 740
           T   L  S+  +F K + MM+  L  NK++M+ + + A ++V+ KEM L  P +  WE S
Sbjct: 744 TSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEES 803

Query: 741 LENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRF---------Q 791
           +E IN CD +N+GF  ++   V     KI   L  S S++ +A   +             
Sbjct: 804 IELINRCDSINNGFHHNMTGQV----SKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDS 859

Query: 792 DASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNS 848
           D   AL  D +      EI +K+ +L+   +++ +Y + +     E+ ++++  LN+
Sbjct: 860 DVKTALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELSETVKIALNN 916

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/897 (47%), Positives = 573/897 (63%), Gaps = 56/897 (6%)

Query: 3   EEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           +EEELNITVAVRCRGRN              PD+ G+ EV+INT+ D G TAQ+NSKTYT
Sbjct: 13  QEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYT 72

Query: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
           VD+VFGPSA Q LIF  IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LY+ ELS
Sbjct: 73  VDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELS 132

Query: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL--DETPDSSMPRKLRIFD 180
           + AGIIPR+LFKLF+ L+  N+D+++KCSF+ELYNEELKDLL  D   D+   +KLRIFD
Sbjct: 133 DSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFD 192

Query: 181 SVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMY--------KPSRSPTV------- 225
           S+               K    +T+  K+++R   +         K S   T+       
Sbjct: 193 SL--GRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTTTK 250

Query: 226 ----------------------------KPTLSSELNSAIHIQNLQEFHIMDAKEGIRLL 257
                                       K T+ S+  + I+IQNLQEFHI  AKEGI+LL
Sbjct: 251 ASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIKLL 310

Query: 258 QRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQ 317
           Q+GL++RQVASTKMND SSRSHTIFTI L+++  GE FR+SKMNLVDLAGSENI+RSGA 
Sbjct: 311 QKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSGAL 370

Query: 318 NQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISP 377
           NQRAKEAGSINQSLLTLGRVINSLADKN H+PFRESKLTRLLQDSLGGNTKTALIATISP
Sbjct: 371 NQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATISP 430

Query: 378 AKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGI 437
           AK+  EET STLEYA+KAKNIKNKPQ+GSFIMKD+L+KN+T EL KI+SDLL+TKSKDGI
Sbjct: 431 AKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKDGI 490

Query: 438 YMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLS 497
           YM Q++YKELT +L+NYKTE+QECKR IE L++QN LL K+KR  NE NE QR+KI+ ++
Sbjct: 491 YMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQTMN 550

Query: 498 NNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENI 557
            ++  LY KI+RQ   E EL   +Q   +    +   +   +++     ++ + +L  ++
Sbjct: 551 ESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDHSL 610

Query: 558 GSFKHSLLNEIEKLK--GTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKIT 615
                 L  +IE  K  G  ++ F VD N+  +  E+  +      +  +  ++ + K  
Sbjct: 611 SYVSKKLNYQIENFKDQGINQN-FTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFL 669

Query: 616 EQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFF---KNNFQD 672
             TP    +I + V ++  +  +Y S +  +LS +SEEYN+ K ++ + F+   K +  +
Sbjct: 670 SDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHE 729

Query: 673 ALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDP 732
            L+ +++ T   ++ S+N +   ++ ++NE L  NKE+++ SL N  +E+++ E+  L P
Sbjct: 730 LLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKP 789

Query: 733 VKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQD 792
               WE S E IN  D LN+ F  ++ S +  + +KI +      + +   N        
Sbjct: 790 KLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKKINEHFKTNDI 849

Query: 793 A-SRALRTDD--VIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLL 846
           A S  L  DD  +I  + + I++K++ L   V++       + +K  E+D SI+ +L
Sbjct: 850 AHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVL 906

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/849 (47%), Positives = 565/849 (66%), Gaps = 26/849 (3%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGD--TGITAQINSKTYT 62
           +E+NI VAVRCRGRN              PDV G+NE+SINT+ D  +G+TAQ+NSKTYT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS 122
           VD+VFGPSA+Q LIF+ IAEPLF DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 123 EGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSV 182
           + AGIIPRVLFKLF+ ++  +D+Y+IKCSFIELYNEELKDLL ++ ++ + +KLRIFDS 
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKL-KKLRIFDSN 191

Query: 183 TXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNL 242
                              G      R+   N +   + +  ++       N++I+IQNL
Sbjct: 192 LSKSSNNNNISRQNSHFISGMDL---RKNPINPINNSNDNTAIQNG-----NASIYIQNL 243

Query: 243 QEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNL 302
           +EFHI +A+EGI+LLQ+GL++RQVASTKMNDVSSRSHTIFTI LY++  GE F++SKMNL
Sbjct: 244 EEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISKMNL 303

Query: 303 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDS 362
           VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADKN HIPFRESKLTRLLQDS
Sbjct: 304 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLLQDS 363

Query: 363 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELV 422
           LGGNTKTALIATISPAK+N+EET STLEYATKAK+IKNKPQ+GS IMKDV +K++  EL 
Sbjct: 364 LGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNNELA 423

Query: 423 KIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRIT 482
           KI+ DL +TK KDG+YM+Q +YK+LTN+LE+YKTE+QEC R ++ L  QN LL K+K+ +
Sbjct: 424 KIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDKKAS 483

Query: 483 NEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELM----RALRTMQNSLKVY 538
           NEVN+ Q L + +++N +  +   ++ QHK EQ L   V+EL     ++L+ M+  +K Y
Sbjct: 484 NEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQIL---VEELAHSREKSLK-MKTVIKEY 539

Query: 539 EDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDF 598
            ++  R Q+ M+ +  + +   K  L   IE L G  ++   V  N+    K +      
Sbjct: 540 SEKEERIQSNMKSIFNDELIKLKELL---IENLNGIAKENLIVQTNVKDNIKLIKDDVIS 596

Query: 599 INTSTIEICRK----FMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEY 654
           I T + E+ +K    F  +I ++TP  L+   + V+    +  +Y ++L  +L SI ++Y
Sbjct: 597 IVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQY 656

Query: 655 NHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQS 714
           + L +Y +  FFK+N    ++ HV+ T   ++ S + IF + ++ M    E N+++++++
Sbjct: 657 SKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILEN 716

Query: 715 LKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQ 774
           LK  +S+++  EM      K  W+ S + IN CD LN+ +   + + +R++  K+    +
Sbjct: 717 LKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSDE 776

Query: 775 FSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQK 834
             +  +     ++       + L TD  I  +  +I  K + L   +Q S +  + +   
Sbjct: 777 IIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLLV 836

Query: 835 FGEIDDSIQ 843
           F EI  SIQ
Sbjct: 837 FDEICKSIQ 845

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/945 (40%), Positives = 578/945 (61%), Gaps = 76/945 (8%)

Query: 3   EEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYT 62
           E++++NITVAVRCRGRN              PDVT T EVSINT+G +GI AQ+ +KTYT
Sbjct: 21  EKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYT 80

Query: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGEL 121
           VD+V+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G++
Sbjct: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140

Query: 122 SEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD---------SSM 172
           +  AGI PR+L KLF+ L    DDY++KCSF+ELYNE+L+DLL E  D         S  
Sbjct: 141 NGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197

Query: 173 P------RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVK 226
           P      +KLRIFDS                  P  +T+    + R + + K  +S   K
Sbjct: 198 PESLNASKKLRIFDS-----------NNSRSNSPVTNTNNPTHKARSDYLKKKLKSNRKK 246

Query: 227 PTLSSELNS-------------AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMND 273
                 LN+              I+IQNL++FHI  AKEG++LLQRGL+ RQVA+TK+ND
Sbjct: 247 SLDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLND 306

Query: 274 VSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 333
           VSSRSHTIFTI LY+K   + +R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLT
Sbjct: 307 VSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLT 366

Query: 334 LGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 393
           LGRVINSLADK+AHIPFRESKLTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+
Sbjct: 367 LGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYAS 426

Query: 394 KAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELEN 453
           KAKNIKNKPQ+GSFI+KD+L+K+V+ EL+K+R+DL  TKSK+GIY+SQ+NYKE+ ++L+N
Sbjct: 427 KAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDN 486

Query: 454 YKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKN 513
           +KTE+ E KR  + L  +N LL KEK+   E  +S + ++  L + +  + +K+ + +  
Sbjct: 487 FKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQ 546

Query: 514 EQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKG 573
             +LS  V ++ R    +++ ++VY+ +    + + +R+L + + +    +L++ + LK 
Sbjct: 547 NTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN 606

Query: 574 TEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESIT 633
                + +  +ID++  E+  + +    +   + +  ++ + ++TP   Q I + V  I 
Sbjct: 607 VNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIR 666

Query: 634 HVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIF 693
            +   + +++  + S +SEE+N  K YL+  FF+NN  + +  H D     ++  ++ + 
Sbjct: 667 GMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLL 726

Query: 694 LKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSG 753
             ++  +   L TN +++  S+ + A +V+ KEM L  P K  WE S++ IN+ D L++ 
Sbjct: 727 QSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNK 786

Query: 754 FEK-------DIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGS 806
           F         DI SV+R+  E ++  +   +  + + ++      ++   + +++++  S
Sbjct: 787 FRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDI------NSQEQINSNELLTNS 840

Query: 807 IEEIKKK-HNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLN-------SQAVSQPHSEN 858
            + I++K +N+L L   D     + +      +D SI+ L++       ++ V  P  +N
Sbjct: 841 FKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIP-PQN 899

Query: 859 RIEGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRS 903
           R   L        L PL PS     R++    +S      PRKRS
Sbjct: 900 RGPEL-----HSTLIPLKPSSSNLNRLSDSTKSS------PRKRS 933

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  548 bits (1413), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/639 (46%), Positives = 434/639 (67%), Gaps = 14/639 (2%)

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
           + I+IQNL+EFHI  AKEGI LLQRGL++RQVASTKMND SSRSHTIFTI LY++ +G+ 
Sbjct: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354
           FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN HIPFRESK
Sbjct: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414
           LTRLLQDSLGGNTKTALIATISPAK+NSEET STLEYA KAK+IKNKPQ+GS I KD+LV
Sbjct: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480

Query: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474
           KN+ +EL K+++DLL+TKS+DG+YMSQ +YKELTN+LE+YKTEVQECKR I+ L+TQNGL
Sbjct: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540

Query: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           L K+K+ +NEV+  Q++K++ + ++I  L+D I++QH+ EQ L +++ +L      MQ +
Sbjct: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600

Query: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKL-KGTEEDGFDVDANIDTLTKELN 593
           +K + ++    Q +M+++  E +   K  L+  +E++ K    +  D+  NI+ +  E+ 
Sbjct: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660

Query: 594 RIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEE 653
            I D        + +  M ++ +++P  L  + + +  +  +   Y+  L + +S ++ E
Sbjct: 661 SIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISELNIE 720

Query: 654 YNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQ 713
           +N LK YLN  FFK++ ++ L+ H+++TY  ++ ++  I  +L+  +   LE ++ I++ 
Sbjct: 721 HNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIIID 780

Query: 714 SLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGL 773
           SLKN  S++V  EM L  P K+ WE S E IN+CD LN+ +  DI +++ ++   +    
Sbjct: 781 SLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTS-- 838

Query: 774 QFSESAVGDANLDLSRFQD-ASRALRTDD---VIPGSIEEIKKKHNMLKLKVQDSASYME 829
             +   V D    + ++ D  SR+ +  +    I     E+ +K++ L+  + +S +  E
Sbjct: 839 --TSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNE 896

Query: 830 AATQKFGEIDDSIQGLLNSQAVSQPHSENRIEGLLEQLN 868
           ++   F ++ +SI       A  + ++ N I  L E  N
Sbjct: 897 SSINAFDKLSESIHS-----AFEKYNTANTISRLDESTN 930

 Score =  277 bits (709), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 128/178 (71%), Positives = 146/178 (82%), Gaps = 1/178 (0%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           +ELNI VAVRCRGRN              PDV G++E++INTT D GI  Q+NSKTYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGPSA+Q LIF+ +AEPLF DFI+GYNCTVLVYGMTSTGKTYTMTGDERLY+GELS+ 
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD-SSMPRKLRIFDS 181
           AGIIPRVLFKLFDA++  NDDY+IKCSFIELYNEELKDLLDE    +S  +KLRIFDS
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDS 188

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  537 bits (1384), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 297/673 (44%), Positives = 434/673 (64%), Gaps = 13/673 (1%)

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
           + I+IQNLQEFHI +A EG+ LLQ+GL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 314 NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 373

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFRESK
Sbjct: 374 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 433

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GSFIMKD+LV
Sbjct: 434 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILV 493

Query: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474
           KN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE+YK EVQECKR IE L+++N L
Sbjct: 494 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNAL 553

Query: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           L K+K  + E  +SQ  +I+ L   ID L  ++D+QHK E E+S+   +L +    MQ +
Sbjct: 554 LVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMA 613

Query: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSL---LNEIEKLKGTEEDGFDVDANIDTLTKE 591
           L  Y+ +      + E  + + I   K +L   LN +++    +E   ++  N+D +  E
Sbjct: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQET--NIQPNLDMIKNE 671

Query: 592 LNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSIS 651
           +  +   +      + +  + KI  ++P +   +  +++ I      +  ++  +LS IS
Sbjct: 672 VLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDIS 731

Query: 652 EEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIM 711
           EE N++K YL  HFFKNN Q+ L+ HVD TY  ++   N      ++++N+ L+ NK+++
Sbjct: 732 EENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLI 791

Query: 712 MQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINE 771
           MQ+L  A S V+ +EM L +P +  WE+S + IN+CD +N+ F   + + +  +   ++ 
Sbjct: 792 MQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDT 851

Query: 772 GLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAA 831
                  ++      +   ++A   L+ +       E++  KHNMLK  +++S +   + 
Sbjct: 852 SSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSH 911

Query: 832 TQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGCI 890
                +I ++I+ ++ +    +  +++  IE +L+++   P      S K P+R++    
Sbjct: 912 ITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEI---P----NLSKKMPLRLSNINS 964

Query: 891 ASSDQLSLPRKRS 903
            S   +  P+K +
Sbjct: 965 NSVQSVISPKKHA 977

 Score =  271 bits (693), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 141/184 (76%), Gaps = 8/184 (4%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PD+TG+ E+SINTTGDTGITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           D    +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 177 RIFD 180
           RIFD
Sbjct: 213 RIFD 216

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  533 bits (1373), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 294/671 (43%), Positives = 428/671 (63%), Gaps = 9/671 (1%)

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
           + I+IQNLQEFHI +A EG++LLQ+GL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 316 NGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 375

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFRESK
Sbjct: 376 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 435

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 436 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 495

Query: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474
           KN+T EL KI+SDLL+TKSK+GIYM+Q++YK L ++LE+YK EVQECKR IE L+++N L
Sbjct: 496 KNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTSKNSL 555

Query: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           L KEK  + E  +SQ  +I+ L   ID L  ++D+QHK E E+S    +L +    MQ +
Sbjct: 556 LVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEVMQMA 615

Query: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTE-EDGFDVDANIDTLTKELN 593
           L+ Y+ +      + E  +   I + K +L +++  L+        D+  N+D +  E+ 
Sbjct: 616 LQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIKNEVL 675

Query: 594 RIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEE 653
            + + +      + +  + KI  ++P +   I  +++ I      +  ++  +LS ISEE
Sbjct: 676 TLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFERFYKNIAENLSDISEE 735

Query: 654 YNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQ 713
            N+LK Y   HFF+NN Q+ L  HVD TY +++   N      ++ +N+ LE NK+++M+
Sbjct: 736 NNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENKKLIMK 795

Query: 714 SLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGL 773
           +L    S V+ +EM L +P +  WE S + INECD +N+ F   + + +  +   ++   
Sbjct: 796 NLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKSTVDTSS 855

Query: 774 QFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQ 833
                ++      +   ++A   L+ +       +++  KH +LK  ++ S +   +   
Sbjct: 856 NSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITSTNSHIT 915

Query: 834 KFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGCIAS 892
              +I ++I+ ++N+    +  +++  IE LL ++   P      S + P+RI+     S
Sbjct: 916 NIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEI---P----NLSKRMPLRISNTNSNS 968

Query: 893 SDQLSLPRKRS 903
              +  P+K +
Sbjct: 969 MQNIISPKKHA 979

 Score =  271 bits (692), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 141/184 (76%), Gaps = 8/184 (4%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PD+TG+ E+SINTTGDTGITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           D    +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 177 RIFD 180
           RIFD
Sbjct: 213 RIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  530 bits (1365), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/669 (43%), Positives = 438/669 (65%), Gaps = 15/669 (2%)

Query: 227 PTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 286
           P   ++ ++ I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI L
Sbjct: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363

Query: 287 YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
           Y+K   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D++ 
Sbjct: 364 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 423

Query: 347 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406
           HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+
Sbjct: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483

Query: 407 FIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIE 466
           F+MKD+LVKN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE++K EVQECKR IE
Sbjct: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 543

Query: 467 RLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMR 526
            L+++N LL K+K  + E  +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +
Sbjct: 544 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 603

Query: 527 ALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF---DVDA 583
               MQ +L+ Y+ +      + E  + + I S K +L  +++ ++  +++ F   D+  
Sbjct: 604 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQ--QKNIFQETDIQP 661

Query: 584 NIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDL 643
           N+D +  E+  + + +      + +  + KI  ++P +   I  +++ I     ++  ++
Sbjct: 662 NLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 721

Query: 644 MMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEE 703
             +LS ISEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   N      +  +N+ 
Sbjct: 722 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDH 781

Query: 704 LETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVR 763
           LE NK+++MQ++ NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + + 
Sbjct: 782 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 841

Query: 764 DVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQD 823
            + + ++        ++      +   ++A   L+ +       +++  KH +LK  ++ 
Sbjct: 842 QIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIES 901

Query: 824 SASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTP 882
           S +   +      +I ++I+ ++ +    +  +++  I+ +L+++   P      S + P
Sbjct: 902 SITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEI---P----NLSKRLP 954

Query: 883 MRIT--QGC 889
           +RI+   GC
Sbjct: 955 LRISNINGC 963

 Score =  268 bits (686), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 141/184 (76%), Gaps = 8/184 (4%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGP A Q LIF+ +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GEL++ 
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176
           AGIIPRVL KLFD L+    DY++KCSFIELYNEELKDLLD           D    +KL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 177 RIFD 180
           RIFD
Sbjct: 215 RIFD 218

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  518 bits (1333), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 296/674 (43%), Positives = 437/674 (64%), Gaps = 15/674 (2%)

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
           + I+IQNLQEFHI +A EG+ LLQRGL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 313 NGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 372

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+LADK+ HIPFRESK
Sbjct: 373 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKSGHIPFRESK 432

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 433 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 492

Query: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474
           KN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE+YK EVQECKR IE LS++N L
Sbjct: 493 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDIESLSSKNSL 552

Query: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           L K+K  + +  +SQ  +++ L   I+ L  ++D+QHK E E+S    +L +    MQ +
Sbjct: 553 LLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQKLTEIMQLA 612

Query: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGF----DVDANIDTLTK 590
           L+ Y+ +      + E  + + I S K +L ++   L G E++      ++  N+D +  
Sbjct: 613 LQDYKRRELDLNKKFETHISKEIKSLKTTLFSQ---LSGMEQNNISQETNIQPNLDIIKN 669

Query: 591 ELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSI 650
           E+  + + +      + +  + KI  ++P +   I  +++ I      + +++  +LS I
Sbjct: 670 EVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFYNNIAENLSDI 729

Query: 651 SEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEI 710
           SEE N+LK YL  HFFKNN Q+ L+ H+D TY  ++   +      +  +N+ LE NK++
Sbjct: 730 SEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTLNDHLEENKKL 789

Query: 711 MMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKIN 770
           +MQ+L NA S V+ +EM L +P +  WE+S + IN+CD +N+ F  ++ + +  +   ++
Sbjct: 790 IMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMATTLSQIKNTVD 849

Query: 771 EGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEA 830
                   ++      +   ++A   L+ +       +++  KH +LK  +++S +   +
Sbjct: 850 TSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDNIENSITSTHS 909

Query: 831 ATQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGC 889
                 +I D+I+ ++ +    +   +N  I+ +L+++   P      S + P+R++   
Sbjct: 910 HITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEI---P----SLSKRVPLRLSNTN 962

Query: 890 IASSDQLSLPRKRS 903
             S+  +  P+K +
Sbjct: 963 GNSAQNILSPKKHA 976

 Score =  268 bits (684), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 141/184 (76%), Gaps = 8/184 (4%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PD+TG+ EVSINTTGDTGITAQ+N+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP--------DSSMPRKL 176
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEELKDLLD           +    +KL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 177 RIFD 180
           RIFD
Sbjct: 213 RIFD 216

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  496 bits (1278), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 270/549 (49%), Positives = 374/549 (68%), Gaps = 17/549 (3%)

Query: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGE 293
           N+ I+IQNLQEF+I +A +GI+LLQ+GLRHR+VASTKMNDVSSRSHTIFTI LY++ NG 
Sbjct: 331 NNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGG 390

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 353
            +RVSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFRES
Sbjct: 391 LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRES 450

Query: 354 KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL 413
           KLTRLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP +GSFIMKDVL
Sbjct: 451 KLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVL 510

Query: 414 VKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNG 473
           +KN+T EL KI+SDL++T+ KDG+YMSQ++YKEL N+LE+YKTEVQE KRA ERL +QNG
Sbjct: 511 LKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNG 570

Query: 474 LLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQN 533
            L K+K+ +NE+NE QR++I+K +  I  LY+ +D  +K E  L  ++++L     +MQ+
Sbjct: 571 SLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGTSMQS 630

Query: 534 SLKVYEDQGHRFQTEMERVLYENIGSFKHSLL--------NEIEKLKGTEE--------- 576
           +++ Y ++    +   +++L       K+ L         N I+ LK +           
Sbjct: 631 TIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSSIEAI 690

Query: 577 DGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVV 636
           D  +   NID +     +I   +   +  I    + +I    P  L   + ++ SI    
Sbjct: 691 DSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQY 750

Query: 637 GSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKL 696
               + +  +LS +SEEYN+ K+YLN  F +NN++  L  H++    Q++  +N++ L +
Sbjct: 751 NDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSNNLLLNI 810

Query: 697 REMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEK 756
            + +NE    N ++  + L N  +++V KE   + P K+ W  S+E IN  DK+N+ F  
Sbjct: 811 NKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHN 870

Query: 757 DIGSVVRDV 765
           D+ + +  +
Sbjct: 871 DMNNRILQI 879

 Score =  277 bits (708), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 150/179 (83%), Gaps = 1/179 (0%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNITVAVRCRGRN              PD+ G+NEVSINT+ + GI A +NSKTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVT 183
           AGIIPRVLFKLF++ +  NDDY+IKCSF+ELYNE+LKDLLD++ D++  +KLRIFDS++
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTY-KKLRIFDSMS 186

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  493 bits (1268), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 288/658 (43%), Positives = 419/658 (63%), Gaps = 23/658 (3%)

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
           ++I+IQNL+EFHI  A EG++LLQ+GL+ RQVASTKMND SSRSH+IFTI LY++ NGE 
Sbjct: 307 ASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGEL 366

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354
           FRVSKMNLVDLAGSENISRSGA NQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESK
Sbjct: 367 FRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESK 426

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+G+FIMKD+LV
Sbjct: 427 LTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILV 486

Query: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474
           +++T+EL KI+SDLL+TKSK+G+YMS E+YK+L  ++E YKTE++E KRAIE L+ QN +
Sbjct: 487 RSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAM 546

Query: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           L +E+    + N   +  I  L +N+  L   +  Q   E  + ++++++  A   M+ +
Sbjct: 547 LQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKT 606

Query: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLK--GTEEDGFDVDANIDTLTKEL 592
           + ++E +    Q  +   + + I + + +L   IE L+  G  +D  ++  N+  L KE+
Sbjct: 607 IHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDT-EISGNLMRLEKEV 665

Query: 593 NRIYDFIN---TSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSS 649
            ++        + +   C K M K   +TP   + +  ++++I+ +     S +   LS 
Sbjct: 666 VKVIKAAEEEASKSYGECVKMMLK---ETPRLFESVSGRLDNISKLAEENHSKIAETLSD 722

Query: 650 ISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKE 709
           +SEEYN+LK YL  +FFKNN ++ L  HV  TY QL+ ++  +      M+++ ++ NK 
Sbjct: 723 VSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKR 782

Query: 710 IMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGS---VVRDVF 766
            M++++     EV+  E+ +    +  WE S   IN+CD +N  F + +GS    +RDV 
Sbjct: 783 HMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVV 842

Query: 767 EKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSAS 826
               + +  + S++     +    Q     ++ +DVI   I  IK+K+  L L  + S  
Sbjct: 843 SSSRDNIGATISSIQSRTRNR---QSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHST- 898

Query: 827 YMEAATQKFGEIDDSIQG---LLNSQAVSQPH-SENRIEGLLEQLNGKPLKPLGPSGK 880
             E AT   G + + ++G   ++  + ++ P  S  + E   E+L+     PLG + K
Sbjct: 899 --ETATTSIGSV-NKVEGNLKVIMDKVLNDPQLSRGKAEVPDEELHRLEKIPLGITNK 953

 Score =  268 bits (686), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 125/179 (69%), Positives = 144/179 (80%), Gaps = 2/179 (1%)

Query: 5   EELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64
           EELNI VAVRCRGRN              PD   TNEVSINTT D GI A++NSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124
           +VFGPSA Q L+++ IAEPLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDE+L++GEL + 
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDE--TPDSSMPRKLRIFDS 181
           AGIIPRVLF+LFD L+A+ DDY++KCSF+ELYNEELKDLLD   T  +S  +KLRIFDS
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDS 208

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  487 bits (1254), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 298/888 (33%), Positives = 508/888 (57%), Gaps = 46/888 (5%)

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-RLY 117
           + + +D +F     Q  ++    +P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L 
Sbjct: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL 115

Query: 118 DGELSE-GAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMP--- 173
             E S    G+IPRVL +LFD L  +N D+++KCS++E+YNEELKDLL +  +S +    
Sbjct: 116 HSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASI 175

Query: 174 RKLRIFDSVT--XXXXXXXXXXXXXXKPPEGS----TSGTKRRIRPNTMYKPSRSPTVKP 227
           +KLRI DS +                 P   S    T+  ++++   ++    ++ T+  
Sbjct: 176 KKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSI 235

Query: 228 TLSSELN------------SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVS 275
           + S+  N             A +IQNL+EFHI +AKEGI+LL RGL++RQ+AS+K    S
Sbjct: 236 SRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYS 295

Query: 276 SRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 335
           SR+ TIFTI+LY++  GE FRVSK N VDLAG+E+  +    NQR K+   INQ +  L 
Sbjct: 296 SRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLN 355

Query: 336 RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
           +++NSL +K + IPF++SKLT L++D+L GN+K+  I T+   K + +E   TLE+  K 
Sbjct: 356 KIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKV 415

Query: 396 KNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYK 455
           +++K  P +G  I K+ L+K+++ EL K++SDLL+TKSK+G+YMS E+Y  LT +L+ +K
Sbjct: 416 RSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHK 475

Query: 456 TEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQ 515
            E+ + K+ I+ L+ Q+  L K+KR   EVNE QR+K++ + +++  +Y  I++Q + E 
Sbjct: 476 VEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREH 535

Query: 516 ELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTE 575
           +L N   +L   +  M  ++  Y D+    QT+M+ +  E +   K  LL  + + +  E
Sbjct: 536 DLINSTDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNE 595

Query: 576 E-DGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMN---KITEQTPTYLQDIRNQVES 631
             D  +++ N++   +E+ +I   +  S  EI   F++   K++E++P         V  
Sbjct: 596 LIDNLEIENNLNKAHEEIKQI---LQISENEIDSLFLDCIKKMSEESPKLFSSFIQDVSR 652

Query: 632 ITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANS 691
           + +      ++L   LS +SEE+N+LK Y+NE FFKNN ++ L  +V++TYHQ++ S++ 
Sbjct: 653 LENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDD 712

Query: 692 IFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLN 751
             LK  +++   LE NK +++Q++K+A SEV+  EM    P K+ WE S+E I +    +
Sbjct: 713 FLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSS 772

Query: 752 SGFE---KDIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIE 808
           + F+   + I   ++D  +  +E L      + +    ++  Q A+  +  ++V+     
Sbjct: 773 NEFKTKNRVIVGKLQDTLKGTSESLF---DTLSEMKSKINELQKAANIIENNEVVTEEFI 829

Query: 809 EIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLNSQAVSQPHSENRI-EGLLEQL 867
            I KK+ +LK  +  + +  E +   F ++DDSI+ +  ++  +       I + + +QL
Sbjct: 830 SIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQL 889

Query: 868 NGKPLKPLGPSGKTPMRITQG---------CIASSDQLSLPRKRSYSI 906
           + + L P   + K+P+R +            + +SD L     RS+++
Sbjct: 890 DQQRLTPNMRNRKSPVRQSVSPSRTSPQIQSLMNSDLLQFNEARSFAV 937

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  370 bits (951), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 293/988 (29%), Positives = 508/988 (51%), Gaps = 96/988 (9%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--KTYTVDR 65
           NITVAVRCR                 P +    +    T+ +  +  +     K YT+D 
Sbjct: 9   NITVAVRCR------EPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTGRKKIYTLDA 62

Query: 66  VFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----ERLYDGEL 121
           V+G   DQ  +F     P ++ F  GYN +++ YG   +GK YT+ G+    +   + E 
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121

Query: 122 SEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDS----------- 170
           SE  G++PRVL +LF  L+++ +D++IKCSF+E+YN+EL+DLL +T ++           
Sbjct: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATG 181

Query: 171 SMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGT-----------KRRIRPNTMYKP 219
           S  +KLRI DS +                   + S             KR + PN     
Sbjct: 182 STGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSLPPNNSISN 241

Query: 220 SRSPTVKPTLS--------------SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQ 265
           + +   + +LS                LNS I+IQNLQE  I + +EG+ ++++GL++R+
Sbjct: 242 NTANNNRLSLSRTNSFSDYSLQSSHERLNS-IYIQNLQEITITEIEEGMAIIKKGLKNRR 300

Query: 266 VAST----KMNDVSSRSHTIFTIMLYRKCN-GESFRVSKMNLVDLAGSENISRSGAQNQR 320
           +AST      N+ S RSH+IF I LY++    E FR+SK++ V+ AGSE    + ++N  
Sbjct: 301 IASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDNNTSKN-- 358

Query: 321 AKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 380
               G+ N +L +  ++IN + + + +  F +SKLT+LLQ++  G T+T  IA I+P K 
Sbjct: 359 ----GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIANIAPLKK 414

Query: 381 NSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKD-GIYM 439
             + T S L  ATK K IKN+P+ GS I K+ L+K ++ ELVK +SDLL+ KS D GIYM
Sbjct: 415 QLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKSNDNGIYM 474

Query: 440 SQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNN 499
            +++Y ELT  LE+YK ++Q  K +I  L+ +   +  EKR   E+NE QR+K++ L   
Sbjct: 475 DEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIKLQNLRET 534

Query: 500 IDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGS 559
           I  L   +++Q K E EL N+  +L   L  MQ S++ Y D+    Q +++ +  + +  
Sbjct: 535 ISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLLYDKELVK 594

Query: 560 FKHSLLNEIEKLKGTEEDGFD-VDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQT 618
            K+SL +    +K    D  D ++ NID +  E+ +I +   +   E+     N++ + +
Sbjct: 595 LKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTS 654

Query: 619 PTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHV 678
           P Y + +   ++++   V    +     LS ISEE+N+L +Y+N++F K++ ++ +D ++
Sbjct: 655 PKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTYI 714

Query: 679 DRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWE 738
           +RTYH+++  +       +++++  +E N + + +S+ +  SE+V  E+   +P K+ WE
Sbjct: 715 NRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWE 774

Query: 739 SS----LENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVGD-----ANLDLSR 789
            +    +EN NE    N     +I + +      ++E    SE  + +      N+++  
Sbjct: 775 LASNEIIENFNESITKNKNKNSEILAKL------LSESTSTSELFINNMSSIKKNVEI-- 826

Query: 790 FQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDSIQGLL-NS 848
            ++ S    ++D+I     EI  K+  LK  + D+ +  E +   F  + +++Q +  N 
Sbjct: 827 VEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFKNE 886

Query: 849 QAVSQPHSENRIEGLLEQLNGKPLKPLGPSGK-------TPMRITQGCIASSDQLSLPRK 901
              S  +    ++ + EQ+  + L     S K       +P +I+   I SS +L+ P K
Sbjct: 887 MKESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNLSPSKIS--PIKSSTKLNSPLK 944

Query: 902 RSYSISPIREIDGNRKASSPFKRKITID 929
               I  + EID  R    P KRK+ ++
Sbjct: 945 --VEIQSLSEIDMKR----PIKRKLNLN 966

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  364 bits (935), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 254/691 (36%), Positives = 367/691 (53%), Gaps = 122/691 (17%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVDRVF 67
           NI V VRCR RN                  G + +  N +  +  +     KTYT DRVF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE------- 120
           G  +DQ ++F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 121 ---LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDET--PDSSMPRK 175
              LSE AGIIPRVL  LF  L   + DY +K SF+ELYNE LKDLL ++   D +    
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 176 LRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNS 235
           +RIFD++                 PE +T G+                            
Sbjct: 234 IRIFDNI----------------KPEKNTQGS---------------------------H 250

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----YRKCN 291
           +I ++ ++E +I  A+EG++LL  G   RQVASTK ND+SSRSHT+FTI          +
Sbjct: 251 SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLS 310

Query: 292 GESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 350
           GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+
Sbjct: 311 GEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPY 370

Query: 351 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMK 410
           RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+   + K
Sbjct: 371 RESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTK 430

Query: 411 DVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYK----------ELTNELENYKTEVQE 460
           D  +     E+ ++R +L AT++KDGIY++QE Y           E    ++N + ++  
Sbjct: 431 DSCITEYIHEIDRLRKELRATRTKDGIYITQEKYDLYESNCILVGEQKARIDNLEEQI-- 488

Query: 461 CKRAIERLSTQNGLLTKEKRITNEVNES-QRLKIKK--LSNNIDFLYDKIDR-------- 509
            KR  E+   Q  +  + ++   +++ S Q++  KK  L +++D+L  K +         
Sbjct: 489 -KRFKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQLLESSLDYLQQKCNSFEHEITEI 547

Query: 510 QHKNEQELSNVVQELMRALRTMQNSLKVYED--QGHRFQTEMERVLYENIGSFKH---SL 564
            HKN + L ++V E             + ED  Q +R+ TE +  + + + + K+   +L
Sbjct: 548 HHKNLKILDSIVDE----------RDTISEDLVQKYRYITETDHCITKELTTLKNVKKTL 597

Query: 565 LNEIEKLKGTEEDGF----DVDANIDTLTKELNRIYDF---------INTSTIEICRKFM 611
            N  +  KG  +  F    D   N+  +T+E  R+ D          +NTS  +   K  
Sbjct: 598 NNYNKSFKGVLKSVFQELQDKVINLSAVTEEQVRVVDTEGIINSFEDLNTSITKCIGKLK 657

Query: 612 NKI----------TEQTPTYLQDIRNQVESI 632
            KI          +E   +++ D+  Q E++
Sbjct: 658 VKIDFKDLLLDETSEAVQSWISDLTKQHEAL 688

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  363 bits (931), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 280/783 (35%), Positives = 397/783 (50%), Gaps = 140/783 (17%)

Query: 4   EEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQI------N 57
           E E NI V VRCR RN               ++   + V I+T G+ G    +      +
Sbjct: 50  EPEYNIKVYVRCRSRNER-------------EIREKSSVVISTLGNNGREVILTNPGTGS 96

Query: 58  SKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           +KTYT DRVFG  +DQ  +F  +A     + I+GYNCTV  YG T TGKTYTM+GD  + 
Sbjct: 97  NKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMM 156

Query: 118 DGE--------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD 169
                      LSE AGIIPRVL +LF  L   ++DY +K SF+ELYNE+L+DLL +  D
Sbjct: 157 GSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKD 216

Query: 170 SSM----------PRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKP 219
            S+          P  +RI+DS+                           R  PN     
Sbjct: 217 VSLEDHNFNGMAPPESIRIYDSLKTD------------------------RTSPN----- 247

Query: 220 SRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSH 279
                           +I ++ ++E +I  A+EG++LL  G   R+VA+TK ND+SSRSH
Sbjct: 248 --------------GYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSH 293

Query: 280 TIFTIML----YRKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           TIFTI          +GE + +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTL
Sbjct: 294 TIFTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTL 353

Query: 335 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 394
           GRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYAT+
Sbjct: 354 GRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATR 413

Query: 395 AKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENY 454
           AK+IKN PQV   + K+  +     E+ ++R +L A+ SK+GIY++QE +       E Y
Sbjct: 414 AKSIKNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKF-------ETY 466

Query: 455 KTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNE 514
           ++               N +L +E          Q+ KI  L   +  L +K   Q K  
Sbjct: 467 ES---------------NSILVEE----------QQAKIDNLQEQLRRLKEKFLEQTKLI 501

Query: 515 QELSNVVQELMRALRT---MQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKL 571
           +E    ++EL  A R        L +Y +  H    + E  +   I +    LL +I   
Sbjct: 502 KEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLEDYEHTMI-GIHNNNMKLLEDINDN 560

Query: 572 KGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVES 631
           +G   +  D+ A +D + +  N I     TS I I R  +   +++  T L  +  +++ 
Sbjct: 561 RGNIHE--DLLAKVDHI-ETCNLIISREITSLISI-RNVLQAYSDRFKTVLGGVFEELQE 616

Query: 632 ITHVVGSYS--SDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQ---LK 686
               VG  +  S L + LS + E++  + D +       N    +D HV     +   L 
Sbjct: 617 KLTQVGRTTEESQLDVDLSFVDEKFEEVTDIIKATC--ENLVRTMDEHVSNMKLETTDLT 674

Query: 687 VSANSIFLKLREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINE 746
            S  S+  K  + ++ +L+   E M Q L +   E+V      LD       SS+ N+ +
Sbjct: 675 SSCASLLEKECQALHGKLQKYVESMKQELNSTLQEMVRD----LD----MKASSMLNVVQ 726

Query: 747 CDK 749
           C K
Sbjct: 727 CTK 729

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  356 bits (913), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 217/548 (39%), Positives = 313/548 (57%), Gaps = 97/548 (17%)

Query: 2   SEEEELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQI----- 56
           SEE+  NI V VRCR RN               ++   + V ++T G  G    +     
Sbjct: 50  SEEQGYNIKVYVRCRSRNVR-------------EIKEKSSVVVSTLGSQGREIILSNQST 96

Query: 57  -NSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
            N+KTYT D+VFG  +DQ  +F  +A     + ++GYNCTV  YG T TGKTYTM+GD  
Sbjct: 97  GNNKTYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDIS 156

Query: 116 LYDGEL--------SEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDET 167
           +    L        SE AGIIPRVL +LF  L   ++DY +K SF+ELYNE+L+DLL E 
Sbjct: 157 VVGASLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVED 216

Query: 168 PD------------SSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNT 215
            +            ++ P  +RI+D++               K    ++SG         
Sbjct: 217 KEPLIDEGGIGGGVANSPETIRIYDNL---------------KLDRSNSSG--------- 252

Query: 216 MYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVS 275
                               +I ++ ++E +I  A+EG++LL  G   R+VA+T+ ND+S
Sbjct: 253 -------------------HSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLS 293

Query: 276 SRSHTIFTIML----YRKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 330
           SRSHTIFTI          +GE + ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+S
Sbjct: 294 SRSHTIFTITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKS 353

Query: 331 LLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLE 390
           LLTLGRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET+STLE
Sbjct: 354 LLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLE 413

Query: 391 YATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE 450
           YAT+AK+IKN PQ+   + K+  +     E+ K+R +L A  +K+GIY+++E Y+   + 
Sbjct: 414 YATRAKSIKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESN 473

Query: 451 ---LENYKTEVQECKRAIERLS---TQNGLLTKEK----RITNEVNESQRLKIKKLSNNI 500
              +E  + ++   +  I+R      +   L KEK    ++   +NE   +  KKL++ +
Sbjct: 474 CILVEEQQAKIDNLQEQIKRFKEKYLEQTKLVKEKDTQVKMIKSINERITMYNKKLTDYL 533

Query: 501 DFLYDKID 508
           D L  +++
Sbjct: 534 DKLRFRVE 541

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  355 bits (912), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 271/794 (34%), Positives = 404/794 (50%), Gaps = 173/794 (21%)

Query: 6   ELNITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS------- 58
           E NI V VRCR RN               ++   + V I+T G  G    +++       
Sbjct: 50  ESNIHVYVRCRSRNRR-------------EIDEKSSVVISTLGPQGKEIILSNGSHQSYS 96

Query: 59  ---KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
              KTY  D+VFG  +DQ ++F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  
Sbjct: 97  SSKKTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDIN 156

Query: 116 LYDGE--------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL--- 164
           +  G+        L E AGIIPRVL  LF  L + N +Y +K SF+ELYNE LKDLL   
Sbjct: 157 IL-GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDN 215

Query: 165 -DETPDSSMPRK-LRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRS 222
            D+ P ++  +K +RIFD+                                         
Sbjct: 216 EDDDPTANDSKKQIRIFDN----------------------------------------- 234

Query: 223 PTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIF 282
                   +  NS+I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+F
Sbjct: 235 --------NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVF 286

Query: 283 TIMLY-----RKCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           TI         K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTL
Sbjct: 287 TITTNIIEQDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTL 346

Query: 335 GRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATK 394
           GRVIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+
Sbjct: 347 GRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATR 406

Query: 395 AKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENY---------- 444
           AK+IKN PQV   + KD  +K+   E+ K+R+DL  +++K GI+++Q+            
Sbjct: 407 AKSIKNSPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILI 466

Query: 445 KELTNELENYKTEVQECK-RAIERLSTQNGLLTKEKRITNEVNESQ------RLKIKKLS 497
            E   ++ N + ++++ K + + +L   N L ++++++ N +           L+I+K+ 
Sbjct: 467 DEQNLKIHNLREQIKKFKEKYLNQLDINNFLQSEKEKLINIIRNFHVDFSNFNLEIQKIH 526

Query: 498 -NNIDFLYDKID----------RQHKNEQELS-NVVQELMRALRTMQNSLKVYEDQGHRF 545
            +N++ + +             RQ+   Q L   +  ++++ L T+QNSL  Y  +  + 
Sbjct: 527 RSNLEVMTEITQQRDLSQVNSRRQYTTNQNLQLEISNQVLQTLDTLQNSLMNYNSKFSQV 586

Query: 546 QTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIE 605
              +   L  N+ S K        K   T E  F+  AN+  LT ++N +   I+ S   
Sbjct: 587 INGVTEELSLNVNSHK-------VKHDSTLESLFNTTANL--LTIKMNELVSSISQSLAN 637

Query: 606 I-------CRKFMNKITEQTPTYLQDIRNQVESITHVVGS------------------YS 640
           I         K +N+I +    +L  ++N ++S    +GS                    
Sbjct: 638 IRNDSLSHYNKDLNEIYQSHQRFLSKLQNDIKSCLDSIGSSILNSINEISQTCTTNLNSM 697

Query: 641 SDLMMHLSSISEEY---NHLK------DYLNEHFFKNNF-------QDALDVHVDRTYHQ 684
           +DL  H  S++ E     HL+      + LNE    N F       ++    HV RT  +
Sbjct: 698 NDLTSHHQSVATEMIEKQHLQIEKLKNELLNERKVSNQFHKQSTRLKEYFQNHVSRTRTE 757

Query: 685 LKVSANSIFLKLRE 698
           L    N    KL+E
Sbjct: 758 LDDEFNEFISKLKE 771

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  352 bits (903), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 232/570 (40%), Positives = 319/570 (55%), Gaps = 97/570 (17%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR RN               ++   + V I+T G  G    ++          
Sbjct: 59  NIQVYVRCRSRNQR-------------EIEEKSSVVISTMGAQGKEVVLSDPSSVLSHTK 105

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLY 117
           KTY  D+VFG  +DQ ++F   A+    + ++GYNCT+  YG T TGKTYTM+GD   L 
Sbjct: 106 KTYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILG 165

Query: 118 DGE------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSS 171
           D E      L E AGIIPRVL  LF  L   + +Y +K SF+ELYNE LKDLL ++ ++ 
Sbjct: 166 DLESQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETE 225

Query: 172 MPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSS 231
               +RIFD+                  P G++           + K SR+ T       
Sbjct: 226 --ESIRIFDN----------------HIPSGNSK----------IQKSSRNNTY------ 251

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK-- 289
              S+I ++ ++E +I  A EG++LL  G   R+VASTK ND+SSRSHTIFTI       
Sbjct: 252 ---SSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKI 308

Query: 290 --CNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
              +GE + ++ K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 309 DPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQ 368

Query: 347 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+  
Sbjct: 369 HIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQ 428

Query: 407 FIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIE 466
            + KDV +     E+ ++R +L A++ KDG+Y++QE +                      
Sbjct: 429 SMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQFD--------------------- 467

Query: 467 RLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMR 526
            L   NG+L  E++      E Q  K K+   N   +  +++   KN QELSN   +L+ 
Sbjct: 468 -LYESNGILVDEQKAKIVNMEEQIKKFKEKYVNQTAINKELETSLKNSQELSN---DLLD 523

Query: 527 ALRTMQNSLKVYEDQGHRFQTEMERVLYEN 556
              ++ +    Y+     F+TE+   ++EN
Sbjct: 524 KQASLISIFGEYQSNFKLFETEI-NTIHEN 552

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  350 bits (899), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 248/698 (35%), Positives = 370/698 (53%), Gaps = 139/698 (19%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR RN               ++   + V I+T G  G    +++         
Sbjct: 51  NIHVYVRCRSRNKR-------------EIDEKSSVVISTLGPQGKEIILSNGSHQSYSSS 97

Query: 59  -KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
            KTY  D+VFG  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 98  KKTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 157

Query: 118 DGE--------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD 169
            G+        L E AGIIPRVL  LF  L + N +Y +K +F+ELYNE LKDLL +  D
Sbjct: 158 -GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNED 216

Query: 170 -----SSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPT 224
                +   R++RIFD+                                           
Sbjct: 217 DDPAVNDSKRQIRIFDN------------------------------------------- 233

Query: 225 VKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTI 284
                 +  NS+I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI
Sbjct: 234 ------NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTI 287

Query: 285 MLY-----RKCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 336
                    K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGR
Sbjct: 288 TTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 347

Query: 337 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 396
           VIN+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK
Sbjct: 348 VINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAK 407

Query: 397 NIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENY----------KE 446
           +IKN PQV   + KD  +K+   E+ K+R+DL  +++K GI+++Q+             E
Sbjct: 408 SIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDE 467

Query: 447 LTNELENYKTEVQECK-RAIERLSTQNGLLTKEKRITNEV-----------NESQRLKIK 494
              ++ N + ++++ K   + +L   N L ++++++ N +           +E Q++   
Sbjct: 468 QNLKIHNLRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHT 527

Query: 495 KLS--NNI----DFLYDKIDRQHKNEQEL-SNVVQELMRALRTMQNSLKVYEDQGHRFQT 547
            L   N I    D   +    Q+   QEL + + Q++++ L T+Q+SL  Y  +  +   
Sbjct: 528 NLELMNEITLQRDLSQETSQEQYTTSQELQTKITQQVLQTLSTLQSSLMNYNSKFSQVIN 587

Query: 548 EMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTS----- 602
            +   L  N+   K    + +E L       FD  AN   LT +LN + + I+ S     
Sbjct: 588 GVTEELSRNVNFHKLKHDSALESL-------FDTSAN--QLTIKLNELVNGISHSLKHFR 638

Query: 603 --TIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGS 638
             ++    K +N++      +L+D+ N +++    +GS
Sbjct: 639 DDSVSHYNKDLNEVYLSHKQFLKDLENDIKNCLDSIGS 676

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  346 bits (887), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 204/473 (43%), Positives = 285/473 (60%), Gaps = 72/473 (15%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR RN               ++   + V ++T G  G +  +++         
Sbjct: 44  NIKVYVRCRSRNQR-------------EIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPK 90

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY- 117
           KTY  D VFG  +DQ  IF  +A+   Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ 
Sbjct: 91  KTYMFDEVFGADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWG 150

Query: 118 --DGE----LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSS 171
             D +    L E AGIIPRVL  LF  L     ++ +K SF+ELYNE LKDLL +  + S
Sbjct: 151 DLDSQDKILLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLAD--NDS 208

Query: 172 MPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSS 231
               +RIFD+                    G+++G        +  K ++S    PTLS 
Sbjct: 209 DEDNIRIFDN--------------NNSNAHGASNGM-------SQVKMNKSKVRAPTLSG 247

Query: 232 ---------------ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSS 276
                            +S+I ++ ++E +I  A EG++LL +G   R+VA+TK ND+SS
Sbjct: 248 ATVSSSASNSSTSSSSSSSSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSS 307

Query: 277 RSHTIFTIMLY----RKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSL 331
           RSHTIFTI+ +       +GE + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+SL
Sbjct: 308 RSHTIFTIVTHVARTDPVSGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSL 367

Query: 332 LTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEY 391
           LTLGRVIN+L + ++HIP+R SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STLEY
Sbjct: 368 LTLGRVINALVEHSSHIPYRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEY 427

Query: 392 ATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENY 444
           AT+AK+IKN PQV   + KD  +     E+ ++R +L A++ ++G+Y++QE Y
Sbjct: 428 ATRAKSIKNTPQVNQSLSKDSCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  343 bits (879), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 250/699 (35%), Positives = 367/699 (52%), Gaps = 141/699 (20%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR RN               ++   + V I+T G  G    +++         
Sbjct: 52  NIHVYVRCRSRNKR-------------EIEEKSSVVISTLGPQGKEIILSNGSHQSYSSS 98

Query: 59  -KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
            KTY  D+VFG  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 99  KKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 158

Query: 118 DGE--------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDET-- 167
            G+        L E AGIIPRVL  LF  L + N +Y +K SF+ELYNE LKDLL ++  
Sbjct: 159 -GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSED 217

Query: 168 --PDSSMP-RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPT 224
             P  + P R++RIFD+                                           
Sbjct: 218 DDPAVNDPKRQIRIFDN------------------------------------------- 234

Query: 225 VKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTI 284
                 +  NS+I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI
Sbjct: 235 ------NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTI 288

Query: 285 MLY-----RKCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 336
                    K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGR
Sbjct: 289 TTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 348

Query: 337 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 396
           VIN+L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET+STLEYAT+AK
Sbjct: 349 VINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAK 408

Query: 397 NIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENY----------KE 446
           +IKN PQV   + KD  +K+   E+ K+R+DL  +++K GI+++Q+             E
Sbjct: 409 SIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDE 468

Query: 447 LTNELENYKTEVQECKRAIERLSTQNGLLTKEKR------------ITNEVNESQRLKIK 494
              ++ N + ++++ K         N LL  EK              +N  +E Q++   
Sbjct: 469 QNLKIHNLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFYSEIQKIHHT 528

Query: 495 KLS--NNI----DFLYDKIDRQHKNEQELS-NVVQELMRALRTMQNSLKVYEDQGHRFQT 547
            L   N +    DF  +   +Q+   Q +   + Q++++ L T+Q SL  Y  +      
Sbjct: 529 NLELMNEVIQQRDFSLENSQKQYNTNQNMQLKISQQVLQTLNTLQGSLNNYNSKCSEVIK 588

Query: 548 EMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEIC 607
            +   L  N+ + K        K   T +   ++  N+  L  ++N +   I+TS +EI 
Sbjct: 589 GVTEELTRNVNTHK-------AKHDSTLKSLLNITTNL--LMNQMNELVRSISTS-LEIF 638

Query: 608 --------RKFMNKITEQTPTYLQDIRNQVESITHVVGS 638
                   RK +N+I +    +L++++N ++S    +GS
Sbjct: 639 QSDSTSHYRKDLNEIYQSHQQFLKNLQNDIKSCLDSIGS 677

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  340 bits (872), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 205/486 (42%), Positives = 277/486 (56%), Gaps = 91/486 (18%)

Query: 9   ITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS---------- 58
           I V VRCR RN               ++   + V I+T G    T  + S          
Sbjct: 61  IKVYVRCRSRNER-------------EIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK 107

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +TYT DRVFG  +DQ  +F   A+    + ++GYNCTV  YG T TGKTYTM+GD  +  
Sbjct: 108 RTYTFDRVFGAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILG 167

Query: 119 GEL--------SEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDS 170
           G+L         E AGIIPRVL +LF  LD  N+ Y +K SF+ELYNE LKDLL    + 
Sbjct: 168 GDLDSNTMVLLGEHAGIIPRVLVELFRWLDG-NEGYSVKVSFLELYNERLKDLL--ASEQ 224

Query: 171 SMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS 230
           S    +RIFD+V+                                               
Sbjct: 225 SEEENIRIFDNVSA---------------------------------------------- 238

Query: 231 SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML---- 286
              +S+I ++ ++E +I  A +G++LL  G   R+VA+TK ND+SSRSHT+FTI      
Sbjct: 239 ---SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITK 295

Query: 287 YRKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN 345
               +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D  
Sbjct: 296 LDPVSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHT 355

Query: 346 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVG 405
            HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQV 
Sbjct: 356 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVN 415

Query: 406 SFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNE---LENYKTEVQECK 462
             + KD  +     E+ ++R +L  ++ KDGI ++Q+ +    +    ++  KT++Q  +
Sbjct: 416 QSMSKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNME 475

Query: 463 RAIERL 468
             I+R 
Sbjct: 476 EQIQRF 481

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  337 bits (865), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 194/450 (43%), Positives = 275/450 (61%), Gaps = 41/450 (9%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINSKTYTVDRVF 67
           N+ V VRCR RN                  G   +  N  G    +   + +TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 68  GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERL---YDGE---- 120
           G  +DQ  +F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +    D +    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180
           L E +GIIPRVL  LF  L    ++Y +K SF+ELYNE+LKDLL E+        +RIFD
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQE--EENIRIFD 214

Query: 181 SVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQ 240
           + +                        K+ ++ +         + + + +S  +S+I ++
Sbjct: 215 NNSGF----------------NCNKNVKQLVKLD-------GSSHRTSSASSSSSSIMVK 251

Query: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIM--LYRK---CNGESF 295
            ++EF+I  A EG+ LL  G   R+VA+TK ND+SSRSHT+FTI   + R     N +  
Sbjct: 252 GMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSNEQYI 311

Query: 296 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKL 355
           ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+RESKL
Sbjct: 312 KIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYRESKL 371

Query: 356 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVK 415
           TRLLQDSLGG TKT +IATISPAKI+ +ET STLEYAT+AK+IKN PQV   + K+  + 
Sbjct: 372 TRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKNSCLG 431

Query: 416 NVTAELVKIRSDLLATKSKDGIYMSQENYK 445
               E+ ++R +L A++ K+G+Y++++ ++
Sbjct: 432 EYIHEIERLRQELKASRQKEGMYITEDQFQ 461

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  333 bits (853), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 226/599 (37%), Positives = 323/599 (53%), Gaps = 139/599 (23%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR RN               ++   + V I+T G  G    +++         
Sbjct: 52  NIHVYVRCRSRNKR-------------EIDEKSSVVISTLGPQGKEIILSNGSHQSYSSS 98

Query: 59  -KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
            KTY  D+VFG  +DQ  +F   A+   ++ + GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 99  KKTYQFDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL 158

Query: 118 DGE--------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD 169
            G+        L E AGIIPRVL  LF  L   N +Y +K SF+ELYNE LKDLL ++ D
Sbjct: 159 -GDVQSTDKLLLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDD 217

Query: 170 -----SSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPT 224
                +   R++RIFD+                                           
Sbjct: 218 DDPVVNDTKRQIRIFDN------------------------------------------- 234

Query: 225 VKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTI 284
                 +  NS+I ++ +QE  I  A EG+ LL +G   R+VA+TK ND+SSRSHT+FTI
Sbjct: 235 ------NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTI 288

Query: 285 MLY-----RKCNGES---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 336
                    K +G++    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGR
Sbjct: 289 TTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 348

Query: 337 VINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 396
           VIN+L D + HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET+STLEYAT+AK
Sbjct: 349 VINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAK 408

Query: 397 NIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQEN---YKELTNELEN 453
           +IKN PQV   + KD  +K+   E+ K+++DL  +++K GI+++Q+    Y+  +  ++ 
Sbjct: 409 SIKNTPQVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDE 468

Query: 454 YKTEVQECKRAIERLSTQNGLLTKEKRIT----NEVNESQRLKIKKLSNNIDF----LYD 505
              ++   +  I++         KEK +T    N + +S++ K+  +  + D      Y 
Sbjct: 469 QNLKIHNLREQIKKF--------KEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYSHFYS 520

Query: 506 KIDRQHKNEQELSNVV--------------------------QELMRALRTMQNSLKVY 538
           KI + H    EL N V                          Q++++ L ++QNSL+ Y
Sbjct: 521 KIQQIHYTNLELINQVTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNY 579

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  331 bits (849), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 196/456 (42%), Positives = 262/456 (57%), Gaps = 85/456 (18%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTGITAQINS--------- 58
           NI V VRCR R+               ++   + V I+T G  G    +++         
Sbjct: 108 NIKVYVRCRSRSER-------------EIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK 154

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           K+Y+ DRVFG  +DQ  +F   A+    + + GYNCTV  YG T TGKTYTM+GD  +  
Sbjct: 155 KSYSFDRVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILG 214

Query: 119 GE-------LSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSS 171
                    L E AGIIPRVL  LF  L   ND Y +K SF+ELYNE LKDL  +  + S
Sbjct: 215 NLESKDMILLGEHAGIIPRVLVNLFKMLALEND-YSVKISFLELYNERLKDLFAQ--NES 271

Query: 172 MPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSS 231
               +RIFD+                                                ++
Sbjct: 272 EEETIRIFDN------------------------------------------------NN 283

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----Y 287
             +S+I ++ ++E +I  A EG++LL  G   R+VASTK ND+SSRSHT+FTI       
Sbjct: 284 NASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKI 343

Query: 288 RKCNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
              +GE + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + 
Sbjct: 344 DPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQ 403

Query: 347 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406
           HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEYA +AK+IKN PQ+  
Sbjct: 404 HIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQ 463

Query: 407 FIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQE 442
            + KD  +    +E+ ++R +L  ++ KDGI ++Q+
Sbjct: 464 SMSKDTCINEYVSEIERLRLELKTSRQKDGICITQD 499

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  328 bits (842), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 213/549 (38%), Positives = 312/549 (56%), Gaps = 96/549 (17%)

Query: 46  TTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTG 105
           T  +TG     N +TYT D+VFG  +DQ  +F+ +A+    + ++GYNCTV  YG T TG
Sbjct: 120 TNSNTGT----NGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYGQTGTG 175

Query: 106 KTYTMTGDERLY---DGE----LSEGAGIIPRVLFKLFDALDAH---------------- 142
           KTYTM+GD  +    D +    L E AGIIPRVL  LF  L  +                
Sbjct: 176 KTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNNKNNNN 235

Query: 143 -------------NDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTXXXXXX 189
                        N +Y +K SF+ELYNE+L DLL      ++    ++ +  +      
Sbjct: 236 NSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKLINQTSGNST-- 293

Query: 190 XXXXXXXXKPPEGSTSGT----KRRIRPNTMY----KPSRSPTVKPTLSSELN-SAIHIQ 240
                     P   T+G     K +I+ N ++    K  R  + +   +S  N S+I ++
Sbjct: 294 ----------PYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQNKSASNCNGSSITVK 343

Query: 241 NLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML----YRKCNGESF- 295
            ++E +I  A EG++LL  G   R+VASTK+ND+SSRSHTIFTI+          G+ F 
Sbjct: 344 GMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPVTGKHFV 403

Query: 296 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKL 355
           +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D++ HIP+RESKL
Sbjct: 404 KTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIPYRESKL 463

Query: 356 TRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVK 415
           TRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYAT+AK+IKN PQ+   + KD  + 
Sbjct: 464 TRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLSKDTFIH 523

Query: 416 NVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLL 475
               E+ ++R++L   ++K+GIY++Q+       +L+ Y++               N +L
Sbjct: 524 EYINEIDRLRNELKLARTKEGIYITQD-------QLDLYES---------------NSIL 561

Query: 476 TKEK--RITNEVNESQRLKIKKL----SNNIDFLYDKIDRQHKNEQELSNVVQELMRALR 529
             E+  +I N  ++ +R K K +    SN I  L +K+++     Q+LS   + ++   +
Sbjct: 562 ITEQKAKIDNMEDQIKRFKAKYVEETESNRI--LLNKLEQSEDANQKLSEKTKVIISLFK 619

Query: 530 TMQNSLKVY 538
             Q + K++
Sbjct: 620 RYQENFKIF 628

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  280 bits (717), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 186/447 (41%), Positives = 244/447 (54%), Gaps = 101/447 (22%)

Query: 8   NITVAVRCRGRNXXXXXXXXXXXXXXPDVTGTNEVSINTTGDTG----ITAQINSKTYTV 63
           NI V VRCR RN               ++   + V ++T G  G    I+   N   Y  
Sbjct: 9   NIKVYVRCRSRNQK-------------EIDEKSSVVVSTLGQNGNQIIISNSTNKNKYIF 55

Query: 64  DRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELS- 122
           D VFG  +DQ  IF  +A    Q+ I GYNCT+  YG T TGKTYTM+GD  +  G+L+ 
Sbjct: 56  DNVFGVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-GDLNS 114

Query: 123 -------EGAGIIPRVLFKLFDALDAHNDD--------YMIKCSFIELYNEELKDLLDET 167
                  E AGIIPRVL +LF +L+    +        Y +K SF+ELYNE LKDLL  +
Sbjct: 115 TKNILLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLL--S 172

Query: 168 PDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKP 227
            D+ +P                         P  GS+S     +  N     ++  +   
Sbjct: 173 ADADLP-------------------------PNSGSSSANDPSVSSNIKIFDNKDSS--- 204

Query: 228 TLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIM-- 285
                 +S+I ++ +QE  I +A EG+ LL +G   R+V STK+ND+SSRSHTIFTI   
Sbjct: 205 ------DSSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTN 258

Query: 286 ---LYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 342
              L  + N E  ++ K+NLVDLAGSENI++SG   +R++E G IN+SLLTLGRVIN+L+
Sbjct: 259 IIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALS 316

Query: 343 DK--NAH----------------------IPFRESKLTRLLQDSLGGNTKTALIATISPA 378
           DK  N H                      IP+RESKLTRLLQDSLGG TKT +IATISPA
Sbjct: 317 DKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPA 376

Query: 379 KINSEETSSTLEYATKAKNIKNKPQVG 405
           K   +ET STLEYAT+A +IKN P++ 
Sbjct: 377 KTCLDETISTLEYATRAMSIKNNPKIN 403

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  192 bits (488), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 153/455 (33%), Positives = 218/455 (47%), Gaps = 107/455 (23%)

Query: 59  KTYTVDRVF----GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 114
           K +T D  F      S DQ +I+  I        + GYN  +L YG T +GK++TM G E
Sbjct: 54  KIFTFDHCFKYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPE 113

Query: 115 ---------RLYDGELSEGA-GIIPRVLFKLFDALDAHNDD-------YMIKCSFIELYN 157
                       D  + + A GIIPRV   LFD  +  N +       + I CS++E+YN
Sbjct: 114 VSKHFHNNQTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYN 173

Query: 158 EELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMY 217
           E+++DLL E                                       G+K R+R     
Sbjct: 174 EQVRDLLSE--------------------------------------DGSKCRVRERA-- 193

Query: 218 KPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSR 277
                           +    ++ L EF +   +E +  +++G R R V  T MN+ SSR
Sbjct: 194 ----------------DKTTFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSR 237

Query: 278 SHTIFTIMLYRK----CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 333
           SH IFTI + +         + R S + LVDLAGSE +S +GA+  R KE  +IN+SL T
Sbjct: 238 SHAIFTISIKQSETTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTT 297

Query: 334 LGRVINSLADKN--AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEY 391
           LGRV++ LA KN    IP+R+S LT +L+++LGGN+KT +IA +SP   + EET STL Y
Sbjct: 298 LGRVVSVLAKKNRPKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRY 355

Query: 392 ATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNEL 451
           AT AK +KN  +V S       +KN   +LV +R+ L            +E  KEL+  L
Sbjct: 356 ATTAKEVKNTARVNS----SESLKN-KEQLVTMRNQL------------EELQKELS--L 396

Query: 452 ENYKTEVQECKR-AIERLSTQNGLLTKEKRITNEV 485
           ++ K + QE  R  I ++   N  L  EKRI  E 
Sbjct: 397 QSVKLQNQELLREQINKIKCTNAYL--EKRIEQEA 429

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  184 bits (466), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 118/359 (32%), Positives = 184/359 (51%), Gaps = 68/359 (18%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           + Q N + +T DRVF   + Q  +++ +A  + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 113 DERLYDGELSEGAGIIPRV---LFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD 169
            +        E  G+IPR+   +FK  +  D  +  + +  SF+E+Y E++ DLL ++ +
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLE 178

Query: 170 SSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTL 229
               +++ +                                                 +L
Sbjct: 179 KPADKRISL-------------------------------------------------SL 189

Query: 230 SSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML-YR 288
               +S I+++ L   ++   +E +  +++G   R V+ST MN  SSRSH+I  I L  R
Sbjct: 190 HDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKR 249

Query: 289 KCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD----- 343
               E+ + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L       
Sbjct: 250 NALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKS 309

Query: 344 --KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKN 400
              +AHIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N +ET STL + ++AK IKN
Sbjct: 310 KRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  183 bits (464), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 122/364 (33%), Positives = 187/364 (51%), Gaps = 63/364 (17%)

Query: 51  GITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTM 110
           G+  +  S+++  D VFG ++ Q  ++  +AE +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 111 TG--DERLYDGELSEGAGIIPRVLFKLFDAL----DAHNDDYMIKCSFIELYNEELKDLL 164
            G  D R          G+IPR+  ++F+ +     + + +Y++  SF+E+Y E++ DLL
Sbjct: 137 FGPIDNR----------GLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLL 186

Query: 165 DETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPT 224
            E+ + S                           P + S   T   I  ++ +       
Sbjct: 187 GESINKS-------------------------ASPKKTSEKRTSLTIHESSTF------- 214

Query: 225 VKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTI 284
                       +++Q+     + D  E +  +  G   R  +ST MN  SSRSH I  I
Sbjct: 215 -----------GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKI 263

Query: 285 MLYRKCNGE-SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 343
            L ++ N E S + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  
Sbjct: 264 NLLKRDNLEGSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQ 323

Query: 344 KN---AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKN 400
           K+    HIP+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+N
Sbjct: 324 KDKKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIEN 383

Query: 401 KPQV 404
           K  V
Sbjct: 384 KAIV 387

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  174 bits (440), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 118/356 (33%), Positives = 179/356 (50%), Gaps = 62/356 (17%)

Query: 58  SKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           ++ +  D VFG  A Q  +F  +AE +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 118 DGELSEGAGIIPRVLFKLFDAL----DAHNDDYMIKCSFIELYNEELKDLLDETPDSSMP 173
                   G+IPR+  ++F+ +    +  + +Y++  SF+E+Y E++ DLL E+      
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESI----- 163

Query: 174 RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS-SE 232
                                                   N    P ++   + +L+  E
Sbjct: 164 ----------------------------------------NKASSPKKNSDKRASLTVHE 183

Query: 233 LNS-AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN 291
            N+  ++++      + D  E +  +  G   R   ST MN  SSRSH I  I L ++ N
Sbjct: 184 SNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDN 243

Query: 292 GES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKNAHI 348
            E   + S + LVDLAGSE ++++ A     +EA  IN SL +LG VIN+L   +K  HI
Sbjct: 244 LEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHI 303

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQV 404
           P+R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK+IKNK  V
Sbjct: 304 PYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNKAIV 359

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 168/611 (27%), Positives = 277/611 (45%), Gaps = 150/611 (24%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DRVF   A Q  +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 177

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
            +E  GII   + +LF  ++   D   + +  S++E+YNE ++DLL+             
Sbjct: 178 -AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE------------- 223

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                PE                    +P+ K  L  +++  I 
Sbjct: 224 ---------------------PE--------------------TPSKKLVLREDVHRHIT 242

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNG----ES 294
           + NL    +   ++ + L+ +G  +R  ++T  N+ SSRSH +  + + +K       E 
Sbjct: 243 VANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELTED 302

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-----HIP 349
            + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H+P
Sbjct: 303 HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFHVP 362

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK-------- 401
           +R+SKLTRLL+ SLGGN KT +I  ISP   + +ET +TL+YAT+AK IK K        
Sbjct: 363 YRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTKIIRNQHSL 422

Query: 402 -PQVGSFIMKDVLVKNVTAELVKIRS------DLLATK---SKDGIYMSQENYKELTNEL 451
              VGS++    ++     E+ ++RS      DL  ++   S++ ++MS   +  + +  
Sbjct: 423 DRHVGSYLK---MITEQRQEIEELRSRERKMIDLELSRYKISRERVHMSV--WDSVQSLR 477

Query: 452 ENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDF------LYD 505
           +NYKT           L     L+  ++R    V     + +K  S N D       L++
Sbjct: 478 QNYKT-----SEKFHHLKVIKSLMLCKRRFLQMVGVELAVLLKFTSPNSDIHVNCMALHE 532

Query: 506 KIDRQHKNEQELSNVVQELMRAL-RTMQNSL-KVYEDQGHRFQTEMERVLYENIGSF-KH 562
           ++ ++ KN ++  +   EL  AL  T Q  L K+ E +G     E + V YE++ S+   
Sbjct: 533 QLVQKVKNLEQSFDSPDELESALEHTRQVDLVKLQEMEG---WAESDLVWYESLLSWVSE 589

Query: 563 SLLNEI------------------EKLK--------------GTEEDGFDVDANIDTLTK 590
           S+ NEI                  ++LK              G++E  FD     D+LT+
Sbjct: 590 SVRNEILVGSSLMMERLMEDHVLLDRLKFISETLLRFTHTAEGSDEHSFD----FDSLTE 645

Query: 591 ELN-RIYDFIN 600
           +L+ +I D IN
Sbjct: 646 QLHGQIRDLIN 656

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  165 bits (418), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 181/367 (49%), Gaps = 87/367 (23%)

Query: 58  SKTYTVDRVFGPS----ADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           ++++  D+ F  S    ADQL +++ ++       + GY+  V  YG T +GK++TMTG 
Sbjct: 44  TRSFHFDQCFAYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS 103

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALDAH-------NDDYMIKCSFIELYNEELKDLLDE 166
                    E  GI+ R+  +LF+  + +       N  + I+CS++E+YNE ++DLL  
Sbjct: 104 --------PESPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL-- 153

Query: 167 TPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKR-RIRPNTMYKPSRSPTV 225
                                                  GT R RIR             
Sbjct: 154 ---------------------------------------GTGRCRIRERA---------- 164

Query: 226 KPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIM 285
                   +    ++ L+EF +   ++ +  +++G   R + ST +N+ SSRSHTIFTI 
Sbjct: 165 --------DKTTFVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTIS 216

Query: 286 LYRK---CNGESF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 341
           + +K     G    R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L
Sbjct: 217 IKQKEKSALGHVIERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISML 276

Query: 342 ADKNAH--IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           A +     IP+R++ LT +L++SLGGN+KT +IA +SP   + EET STL YAT A+N+K
Sbjct: 277 AKRKQPKLIPYRDAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVK 334

Query: 400 NKPQVGS 406
              Q+ +
Sbjct: 335 TCAQLNA 341

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  165 bits (417), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 118/348 (33%), Positives = 176/348 (50%), Gaps = 81/348 (23%)

Query: 72  DQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRV 131
           DQ  +++ +A       + GYN  +  YG T +GK++TMTG         +E  GI+PR+
Sbjct: 62  DQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGS--------AELPGIVPRM 113

Query: 132 LFKLFDALDAH--NDD-----YMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTX 184
             +LF+  + +  +DD     + I+CS++E+YNE ++DLL                    
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL-------------------- 153

Query: 185 XXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNLQE 244
                                  K RIR     +  ++  V+     E+NS   I     
Sbjct: 154 --------------------GANKCRIRE----RADKTTFVEGLQEFEVNSVDEI----- 184

Query: 245 FHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN---GESF-RVSKM 300
                    +  L++G   + V +T +N+ SSRSHTIFTI + +K N   G    R S +
Sbjct: 185 ---------LDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHVLERRSSI 235

Query: 301 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAH--IPFRESKLTRL 358
            L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R++ LT +
Sbjct: 236 RLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYRDAALTWV 295

Query: 359 LQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406
           L++SLGGN+KT +IA +SP     EET STL YAT A+++K   Q+ +
Sbjct: 296 LKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQLNT 341

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  168 bits (425), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 155/574 (27%), Positives = 257/574 (44%), Gaps = 114/574 (19%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T   +   +  D++F     Q  +++     L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 113 DERLYDGELSEGAGIIPRVLFKLFDALDA--HNDDYMIKCSFIELYNEELKDLLDETPDS 170
                     E  GII R + +LF  +DA     D+ +  SF+E+YNE + DLL  +PD+
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL--SPDT 244

Query: 171 SMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS 230
                                       PP+                        K  + 
Sbjct: 245 ----------------------------PPQ------------------------KLVIR 252

Query: 231 SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKC 290
            + N  I + NL        ++ + L+ RG  +R  + T+ N VSSRSH +  I + ++ 
Sbjct: 253 EDSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRN 312

Query: 291 N----GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD--- 343
                 E      ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L     
Sbjct: 313 KLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDG 372

Query: 344 --KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
             +N H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 373 SHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

Query: 402 P---------QVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELE 452
                      V S++      K +T +   I  D L  +    + +   NYK    ++E
Sbjct: 433 VIRNHQTLNRHVASYL------KMITEQKRTI--DELEARQAQMVQVGITNYKLAIEKIE 484

Query: 453 NYKTEV--QECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQ 510
               EV    CK+   + S QN  L K   +T       +L + ++ N +  + +  D++
Sbjct: 485 RSIEEVVGNVCKQLSSK-SFQNIKLLKALTLTKRT--LLQLIVIEVENVLAIVSEWTDQR 541

Query: 511 HKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEK 570
                    +++   R +R MQ  +K+ ED   RF T  E  L       +HS   ++++
Sbjct: 542 ---------IIETCERVIRQMQEQVKLLED---RFDTATELNLV-----VEHSREIDLKR 584

Query: 571 LKGTEEDGFDVDANIDTLTKELNRIYDFINTSTI 604
           L+  E + +D   ++ +    L+ +Y+ +  S +
Sbjct: 585 LR--EMEHWDDTVHLRSFEARLDLVYESLQKSIL 616

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  166 bits (419), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 117/355 (32%), Positives = 169/355 (47%), Gaps = 76/355 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           YT D VF P A    ++    +PL      G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDG- 158

Query: 121 LSEGAGIIP----RVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
               AG+IP     +  K+FD+    N  Y    S++E+YNE++ DLL+   D       
Sbjct: 159 ---NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFDP------ 209

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS--SELN 234
                                                    KP RS    P L    + N
Sbjct: 210 -----------------------------------------KPLRSSIAVPELKIRDDPN 228

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--CNG 292
             + +  L E      +E +  ++ G +HR+ +ST  N  SSRSH I  I L      +G
Sbjct: 229 YGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSG 288

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-------- 344
           E    S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +        
Sbjct: 289 EVV-TSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESV 344

Query: 345 -NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
            N+HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +TL +A++AKN+
Sbjct: 345 NNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  166 bits (419), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 188/414 (45%), Gaps = 98/414 (23%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T   N+  Y  D VF P  D   I+K  A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 113 DERLYDGELSEGAGIIPRVLFKLFD-ALDAHNDD-YMIKCSFIELYNEELKDLLDETPDS 170
           D    DG       I+P  +  LF+  L++ ND  Y +  S++E+YNE++ DLLD+    
Sbjct: 185 DNENPDG-------IVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDD--- 234

Query: 171 SMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS 230
                                                    R N +  PSR  +    L+
Sbjct: 235 -----------------------------------------RTNHLLTPSRFTSTPSRLN 253

Query: 231 S-------ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFT 283
           S       +L   + I  L E     ++E ++ ++ G  +R+ + T+ N  SSRSH +  
Sbjct: 254 SSELRIRDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVIL 313

Query: 284 IML--YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 341
           + L  +   +G S   S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L
Sbjct: 314 VRLVTHNVIDG-SKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKL 369

Query: 342 A------------------------DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISP 377
           +                        + N HIP+R+SKLTRLLQ +L GN+    I TI P
Sbjct: 370 SAESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDP 429

Query: 378 AKINSEETSSTLEYATKAKNI-------KNKPQVG-SFIMKDVLVKNVTAELVK 423
                 ET +TL +A++AKN+       KN   +  S + KD ++K +T  L K
Sbjct: 430 RMETYAETINTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEK 483

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  162 bits (410), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 117/374 (31%), Positives = 170/374 (45%), Gaps = 90/374 (24%)

Query: 64  DRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123
           D  FG    Q   +K       +D + GYNC +L YG T +GKTYTM G+ +      ++
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 124 GAGIIPRVLFKLFDALDA----------HNDDYMIKCSFIELYNEELKDLLDETPDSSMP 173
             G+IPR    LF  +++             +Y + CS  E+YNE++ DLL+        
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNE----- 172

Query: 174 RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSEL 233
                                          S +K R+R N                   
Sbjct: 173 -----------------------------VQSCSKYRVRENR------------------ 185

Query: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYR----- 288
           + +++I+N+ E  + +  + I+ ++ G R+R   ST MN  SSRSH I +I + R     
Sbjct: 186 DRSMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDL 245

Query: 289 KCNGESFRVSKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--- 344
             N      S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +   
Sbjct: 246 NTNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREEL 305

Query: 345 -----------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 393
                      N  +PFRES LT +L+D+LGGN+KT +IA ISP   N EE++STL YA 
Sbjct: 306 KYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYAD 363

Query: 394 KAKNIKNKPQVGSF 407
            A+ IK    + ++
Sbjct: 364 IAQTIKTNSIINTY 377

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  160 bits (406), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 144/441 (32%), Positives = 209/441 (47%), Gaps = 85/441 (19%)

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +++  D +F  S+ Q  I   +        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 119 GELSEGAGIIPRVLFKLFDALDAHNDDY-MIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
              +   GIIP +   LFDAL+        +  ++ E+YNE+L DLL +T          
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGDT---------- 136

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
                                P    T+  K  ++  T +K +R   V            
Sbjct: 137 --------------------SPRVRETNDKKTFVQDITTFKVNRVEEV------------ 164

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRV 297
               L+   I D+K            R VAST+MN  SSRSH IFT+ + ++    S R 
Sbjct: 165 ----LEYLSIGDSK------------RSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 298 SKMNLVDLAGSENISRS-GAQN-QRAKEAGSINQSLLTLGRVINSLADKNAH-IPFRESK 354
           S + LVDLAGSE  + + G  N +R KE  +IN+SL TLGR I+ LA  + H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF---IMKD 411
           LT +L+++LGGN+KT +IA ISP  I+ EE+ STL YAT AK IK +  +      I +D
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINED 326

Query: 412 VLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQ 471
             +K         R +L   KS+     S+ N K      E +KT  +   R    ++  
Sbjct: 327 --MKAAVEAAASSRKELEMLKSEMSSLQSEYNIKS-----EQWKTHEKLLVR-FNHITKL 378

Query: 472 NGLLTKEKRITNEVNESQRLK 492
           N  L  E ++TNE+ +SQ L+
Sbjct: 379 NDYL--ENQLTNEITKSQSLQ 397

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  163 bits (413), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 175/349 (50%), Gaps = 63/349 (18%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF P  +   +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 121 LSEGAGIIPRVLFKLFDALDAH--NDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
              G GIIP  +  +FD ++       + ++ S++E+YNE + DLL+             
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNL------------ 205

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                P+G T      +  N M  PS + T    L  +L   + 
Sbjct: 206 ---------------------PQGKT------LNSNIMV-PSSTLTNDLKLRDDLKYGVK 237

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY--RKCNGESFR 296
           +  L E ++   KE ++ +  G  +R+   T  N  SSRSH +  I ++   +  GE   
Sbjct: 238 VVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVFCTDEITGEQV- 296

Query: 297 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA-------HIP 349
           +S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +++       HIP
Sbjct: 297 MSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHIP 353

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
           +R+SKLTR+LQ +L G++  A I T+      S E+ +T+ +A++AKNI
Sbjct: 354 YRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  164 bits (415), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 108/352 (30%), Positives = 171/352 (48%), Gaps = 73/352 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DRVF   + Q+ +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 176

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII   + +LF  ++   D   + +  S++E+YNE ++DLL+             
Sbjct: 177 TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE------------- 223

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                PE                    +PT K  L  + +  I 
Sbjct: 224 ---------------------PE--------------------TPTKKLVLREDSHRHIT 242

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNG----ES 294
           + NL    +   ++ + L+ +G  +R  ++T  N+ SSRSH +  + + ++       E 
Sbjct: 243 VANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELTED 302

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIP 349
            + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H+P
Sbjct: 303 HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYHVP 362

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YAT+AK IK K
Sbjct: 363 YRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  162 bits (410), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 174/354 (49%), Gaps = 75/354 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   + Q  IF+    PL    + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 121 LSEGAGIIPRVLFKLFDAL-----DAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRK 175
            SE  GII R + +LF  +     D++     I  S++E+YNE ++DL            
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDL------------ 191

Query: 176 LRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNS 235
                                              ++P T       P+ K  +  + NS
Sbjct: 192 -----------------------------------LKPET-------PSKKLIIREDQNS 209

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN---- 291
            I + NL      + ++ I L+ RG  +R  + T+ N+VSSRSH++  I + +       
Sbjct: 210 KISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDD 269

Query: 292 -GESFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKNAH 347
            G + ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    K+ H
Sbjct: 270 IGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCH 329

Query: 348 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           IP+R+SKLTRLL+ SLGGN KT +I  +SP+ ++ +ET +TL+YA +AK IK K
Sbjct: 330 IPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 201/416 (48%), Gaps = 81/416 (19%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T DRVF  +   L I++  + P+    ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 121 LSEGAGIIPRVLFKLFDALDAHN----DDYMIKCSFIELYNEELKDLLD---ETPDSSMP 173
             + AG+IP  +  LF  +  H+      Y +  S++E+YNE++ DLLD   E   +S P
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENKFNSTP 223

Query: 174 RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSEL 233
              R+F S T                P  S    + RIR +  Y                
Sbjct: 224 S--RMFLSGT----------------PRSSGGPVELRIRDDLKY---------------- 249

Query: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--CN 291
              + I  L E     ++E  R +Q G ++R+ + T  N  SSRSH I  + L      +
Sbjct: 250 --GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRS 307

Query: 292 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---------- 341
           GE+   S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI+ L          
Sbjct: 308 GETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGP 363

Query: 342 --------ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYAT 393
                    + N HIP+R+SKLTR+LQ +L GN+    I TI      + ET +T+ +A+
Sbjct: 364 PTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFAS 423

Query: 394 KAKN----IKNKPQV--GSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQEN 443
           +AKN    +  +P V  GS+  KD  ++N+T +L K    ++  K +  +  S  N
Sbjct: 424 RAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQRTSMTSSSHN 479

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  160 bits (405), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/363 (33%), Positives = 177/363 (48%), Gaps = 67/363 (18%)

Query: 48  GDTGITA-QINSKT--YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           GD G+T  + NS+   +  D++F        IFK + + L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGS 439

Query: 105 GKTYTMTGDERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELK 161
           GKTYTM          L+ G GI+P  +   F   D L A    Y + C FIE+YNE + 
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIV 489

Query: 162 DLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSR 221
           DLL     S  P                        +      + +K  IR +   K + 
Sbjct: 490 DLLR----SGAP-----------------------SQENNDRNADSKHEIRHDQELKTT- 521

Query: 222 SPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHT 280
                           +I N+    ++D+++ + ++L+R  + R  AST  N+ SSRSH+
Sbjct: 522 ----------------YITNITTC-VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHS 564

Query: 281 IFTIMLYRKCNGESFRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN 339
           IF I L  K  G   +    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI+
Sbjct: 565 IFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIH 624

Query: 340 SLADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 396
           +L   +    HIPFR SKLT LLQ SL G++KT +   ISPA ++  ET ++L +A+K  
Sbjct: 625 ALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVN 684

Query: 397 NIK 399
           N K
Sbjct: 685 NTK 687

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 112/363 (30%), Positives = 179/363 (49%), Gaps = 77/363 (21%)

Query: 54  AQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           A+ N   +  D++F  ++ Q  ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSS 171
           +        E  GII RV+ +LF+ ++   D+  + +  S++E+YNE + DLL       
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL------- 288

Query: 172 MPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSS 231
                                                   +P+T       P+ K  +  
Sbjct: 289 ----------------------------------------KPDT-------PSKKLIIRE 301

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYR--- 288
           + +S I + NL   +    ++ I L+ RG  +R  +ST+ N+VSSRSH +  I + +   
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 289 KCNGES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----- 342
           K +  S    + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 362 KIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNN 421

Query: 343 ----DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
               +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK I
Sbjct: 422 TRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 481

Query: 399 KNK 401
           K K
Sbjct: 482 KTK 484

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  158 bits (399), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 106/353 (30%), Positives = 167/353 (47%), Gaps = 74/353 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   A Q  +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GI+ + + +LF  ++   D   + I  SF+E+YNE ++DL               
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDL--------------- 252

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                           ++P T       P+ K  +  + ++ I 
Sbjct: 253 --------------------------------LKPET-------PSQKLIIREDTDNKIT 273

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNG----ES 294
           + NL +      +E + L+ RG  +R  + T+ N+VSSRSH +  I + +K       E 
Sbjct: 274 VANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIKEE 333

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNAHI 348
                ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           H+
Sbjct: 334 HTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRCHV 393

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 394 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  159 bits (401), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 107/353 (30%), Positives = 171/353 (48%), Gaps = 76/353 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  ++ Q+ ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
                GII   + +LF+ +    D+  + I  S++E+YNE + DLL              
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL-------------- 250

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                            RP T       P+ +  +  +  + I 
Sbjct: 251 ---------------------------------RPET-------PSKRLVIREDTQNHIK 270

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK------CNG 292
           + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH++  I + +        + 
Sbjct: 271 VANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLTSQ 330

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHI 348
            +F  + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      +  HI
Sbjct: 331 HTF--ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHI 388

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 172/352 (48%), Gaps = 73/352 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DR+F   + Q  +++    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII + + +LF+ ++   D   + +  SF+E+YNE ++DLL   P++S  + + +
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CPETSSKKLVIL 237

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
            DS                                                    N +I 
Sbjct: 238 EDS----------------------------------------------------NESIR 245

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFR-- 296
           + NL  ++    ++ + L+ +G  +R  ++T  N+ SSRSH +  I + +       +  
Sbjct: 246 VSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLKSD 305

Query: 297 --VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIP 349
              + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       ++ H+P
Sbjct: 306 HTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSCHVP 365

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 366 YRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 179/379 (47%), Gaps = 80/379 (21%)

Query: 39  TNEVSINTTGDTGITAQINSK----TYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNC 94
           T   SIN+ G     +Q         +  D++F  ++ Q  ++K    PL    + GYN 
Sbjct: 127 TASSSINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNS 186

Query: 95  TVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSF 152
           TV  YG T  GKTYT++G             G+I   + +LF+ +D   D+  + I  S+
Sbjct: 187 TVFAYGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSY 238

Query: 153 IELYNEELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIR 212
           +E+YNE ++DL                                               ++
Sbjct: 239 LEIYNERIRDL-----------------------------------------------LK 251

Query: 213 PNTMYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMN 272
           P T       P+ +  +  +  + I + NL   H    ++ + L+ +G  +R  + T+ N
Sbjct: 252 PET-------PSKRLIIREDTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEAN 304

Query: 273 DVSSRSHTIFTIMLYRK------CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGS 326
           +VSSRSH +  I + +        +  +F  + ++++DLAGSE  + +  +  R  E  +
Sbjct: 305 EVSSRSHAVLQIHIMQTNKLVDLTSQHTF--ATLSVIDLAGSERAAATRNRGLRLHEGAN 362

Query: 327 INQSLLTLGRVINSLA----DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINS 382
           IN+SLL LG  IN+L      +  HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + 
Sbjct: 363 INRSLLALGNCINALCLNDGSRTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHY 422

Query: 383 EETSSTLEYATKAKNIKNK 401
           +ET +TL+YA +AK IK K
Sbjct: 423 DETLNTLKYANRAKEIKTK 441

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 168/356 (47%), Gaps = 77/356 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++   ++ Q  +F+   EPL    + GYN TV  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII   L  LF+ ++   D  +  I  S++E+YNE +KDLLD T           
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPT----------- 210

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                     S  K  IR +   K S S                
Sbjct: 211 -------------------------ISSKKLVIREDANNKISVS---------------- 229

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK------CNG 292
             NL  +     +E + L+ +G  +R  +ST  N+ SSRSH +  I L ++       N 
Sbjct: 230 --NLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDINS 287

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------ADKN 345
                S ++++DLAGSE  + +  + +   E  +IN+SLL LG  IN+L       + + 
Sbjct: 288 TEQLFSTLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINTSSHSQQQ 347

Query: 346 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
            HIP+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 348 IHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKTK 403

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 173/378 (45%), Gaps = 99/378 (26%)

Query: 58  SKTYTVDRVFGPS----ADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           +K +  D  FG +     DQ +I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALD-AHND--------DYMIKCSFIELYNEELKDLL 164
           +           GI+PR   +LF+     H D        D+ +KCSF E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 165 DETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPT 224
                                                 S S  K +IR     +   S  
Sbjct: 161 -------------------------------------SSLSQRKCKIRE----RHDHSTF 179

Query: 225 VKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTI 284
           V+          I + N++E         I  + +G  +R V ST MN  SSRSH IF I
Sbjct: 180 VEGL------EEIAVHNVEEL--------ISCIHKGNENRTVRSTNMNQESSRSHAIFHI 225

Query: 285 MLYRK-----------CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 333
            + +K           C+      S   LVDLAGSE +  + A  +  +E  SIN+SL  
Sbjct: 226 SVNQKETHKKTGTVVECH------STCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSI 279

Query: 334 LGRVINSLAD----KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 389
           LGRVI+ LA+    ++  IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL
Sbjct: 280 LGRVISLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTL 337

Query: 390 EYATKAKNIKNKPQVGSF 407
            YA+  K +K    + S 
Sbjct: 338 RYASLTKKVKTNATINSM 355

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 171/353 (48%), Gaps = 76/353 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  ++ Q  ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
                GII   + +LF+ +    D  D+ I  S++E+YNE ++DL               
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDL--------------- 249

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                           ++P T       P+ +  +  +  + I 
Sbjct: 250 --------------------------------LKPET-------PSKRLVIREDTQNHIK 270

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK------CNG 292
           + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  I + +        + 
Sbjct: 271 VANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQ 330

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHI 348
            +F  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ HI
Sbjct: 331 HTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHI 388

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 171/353 (48%), Gaps = 76/353 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  ++ Q  ++K    PL    + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
                GII   + +LF+ +    D+  + I  S++E+YNE ++DL               
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDL--------------- 249

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                           ++P T       P+ +  +  +  S I 
Sbjct: 250 --------------------------------LKPET-------PSKRLVIREDTQSHIK 270

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK------CNG 292
           + NL   H    ++ + L+ +G  +R  + T+ N+VSSRSH +  I + +        + 
Sbjct: 271 VANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQ 330

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHI 348
            +F  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ HI
Sbjct: 331 HTF--ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHI 388

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 389 PYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  154 bits (388), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 171/347 (49%), Gaps = 67/347 (19%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           Y+ D+VF  +     IFK ++E L Q  + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 121 LSEGAGIIPRVLFKLFDALD--AHND-DYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
           L+   GIIP     +FD +D  A N   Y + C F+E+YN+E+ DLL    + S      
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKS------ 485

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
                                    S++G + +I  +   K     TV            
Sbjct: 486 ------------------------NSSNGPRHKIHHDDASKT----TV------------ 505

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY--RKCNGESF 295
            ++NL+   +   +    +L+  ++ R  AST  N+ SSRSH+IF I ++   +  GE  
Sbjct: 506 -VENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEE- 563

Query: 296 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRE 352
           R   +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL   +A   HI FR+
Sbjct: 564 RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRD 623

Query: 353 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           SKLT LLQ SL GN+KT ++  IS +  +  ET  +L +A K  + K
Sbjct: 624 SKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 107/351 (30%), Positives = 169/351 (48%), Gaps = 72/351 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   A Q  +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  G+I   + +LF  ++   D   + +  S++E+YNE ++DLL  +PD S  +KL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDIS-SKKLVI 244

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                     R  ++K          I 
Sbjct: 245 ------------------------------------------REDSIK---------GIS 253

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN----GES 294
           + NL        ++ + L+ RG  +R  + T  N+ SSRSH +  I + +K       E+
Sbjct: 254 VANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEA 313

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKNAHIPF 350
              + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+
Sbjct: 314 HTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPY 373

Query: 351 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           R+SKLTRLL+ SLGGN KT +I  I+P+  + +ET +TL+YA +AK IK K
Sbjct: 374 RDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 171/352 (48%), Gaps = 73/352 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   + QL +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII   + +LF  ++   D  ++ +  S++E+YNE ++DLL+  PD+        
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLN--PDT-------- 247

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                       P+ K  +  +  S I 
Sbjct: 248 --------------------------------------------PSKKLVIREDNESKIS 263

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGESF 295
           + NL        ++ + L+ +G  +R  ++T  N+ SSRSH +  I +    R  +  S 
Sbjct: 264 VANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLTSS 323

Query: 296 RV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIP 349
            V + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++ H+P
Sbjct: 324 HVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCHVP 383

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 384 YRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 165/362 (45%), Gaps = 81/362 (22%)

Query: 57  NSKTYTV--DRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 114
           N+ TY+   D VF        +F  I E L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 115 RLYDGELSEGAGIIP---RVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSS 171
                 L+   G+IP   + +F   D+L  +  +Y + C FIELYNE + DL        
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF------- 539

Query: 172 MPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSS 231
                                                   R N   K S S  ++    S
Sbjct: 540 ----------------------------------------RDNGPTKDSISHEIRHDDQS 559

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRK 289
           ++    ++ N++ F I +  + I L+ +    R  +ST +N  SSRSH IF I L  Y  
Sbjct: 560 KI---TYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNH 616

Query: 290 CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-------- 341
              E   +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L        
Sbjct: 617 KTNEKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 342 ----ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKN 397
                 K  HIPFR SKLT LL+ SL G++KT +   +S  + +  ET ++L +ATK  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 398 IK 399
            K
Sbjct: 736 TK 737

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/352 (29%), Positives = 168/352 (47%), Gaps = 74/352 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   A Q  +F+    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             +  GII   + +LF  ++   D   + +  S++E+YNE ++DLL+  PD+        
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLE--PDT-------- 229

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                       P+ K  +  + +S   
Sbjct: 230 --------------------------------------------PSQKLIIREDSDSTTT 245

Query: 239 IQNLQEFHIMDAKEGIR-LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRV 297
           + NL  +H  +  E +  L+ RG  +R  + T  N+ SSRSH +  + + +       + 
Sbjct: 246 VANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSRTVDLKE 304

Query: 298 SKM----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIP 349
            KM    +++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P
Sbjct: 305 DKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRAVCHVP 364

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 365 YRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 416

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  150 bits (379), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/433 (27%), Positives = 208/433 (48%), Gaps = 87/433 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           ++ D VF P+ D   +++  A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 121 LSEGAGIIPRVLFKLFDAL---DAHNDDYMIKCSFIELYNEELKDLLD-ETPDSSMPRKL 176
            S   G+IP  +  +F  +     +N  + +K S++E+YNE++ DLL+ +    S   K 
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLNYQVSKGSFGTK- 257

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSA 236
                                      T+G + +IR ++ Y                   
Sbjct: 258 ---------------------------TTGIELKIRDDSKY------------------G 272

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGE 293
           + +  L E  +  +++ ++ +  G  +R+   T  N  SSRSH I  I L     K   E
Sbjct: 273 VKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLE 332

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA------- 346
           +   S ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ ++        
Sbjct: 333 T--TSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGG 387

Query: 347 --HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI-----K 399
             HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +A++AKNI     +
Sbjct: 388 GHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVKR 447

Query: 400 NKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYM-----SQENYKELTNELENY 454
           N+  + +   KD +++N+  +L +    +   KS +G        + E+   L +E +  
Sbjct: 448 NEMDISN--EKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSENKVL 505

Query: 455 KTEVQECKRAIER 467
           K  ++ C++ +++
Sbjct: 506 KLRLEHCEKLLDK 518

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  150 bits (379), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 175/370 (47%), Gaps = 81/370 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D VF        I+    +PL    I+GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 121 LSEGAGIIPRVLFKLFDAL----DAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPR-K 175
             E  G+IP  +  LF +L    +  N+   +  S++E+YNE++ DLLD    S++    
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNVQNTP 244

Query: 176 LRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNS 235
            R+F S                     S+SG   +IR ++                    
Sbjct: 245 SRLFTST------------------HTSSSG-DLKIRDDS------------------EC 267

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--CNGE 293
            + +  L +     ++E +  + +G ++R+ + T+ N  SSRSH I  I L  K    GE
Sbjct: 268 GVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGE 327

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVIN-------------- 339
              +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+              
Sbjct: 328 Q-NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGR 383

Query: 340 ------SLADKNA-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 388
                 SLA  N      HIP+R+SKLTRLLQ +L G++    + TI  A  +S ET +T
Sbjct: 384 AANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNT 443

Query: 389 LEYATKAKNI 398
           L +A+++KN+
Sbjct: 444 LRFASRSKNV 453

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  150 bits (379), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 169/348 (48%), Gaps = 67/348 (19%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DR+F        +F  I + L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 121 LSEGAGIIPRVLFKLFDALDAHND---DYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
           L+   G+IP  +  +FD  D+  +   +Y + C F+E+YNE + DLL E   + +     
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLREETSAEL----- 500

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
             D +T                     +  +  IR ++  + +    +K +         
Sbjct: 501 --DEIT---------------------NNGRHDIRHDSDKRITTITNIKTS--------- 528

Query: 238 HIQNLQEFHIMDAKEGIR-LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN--GES 294
                    I+ +K+ +  L+++  + R  A+T  N+ SSRSH+IF I L    N  GES
Sbjct: 529 ---------ILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGES 579

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFR 351
                +NLVDLAGSE ++ S  +  R +E  +IN+SL  LG VI++L   +A   HIPFR
Sbjct: 580 -SYGILNLVDLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFR 638

Query: 352 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
            SKLT LLQ SL GN+KT +   ISP +   +ET ++L +A+K    K
Sbjct: 639 NSKLTYLLQYSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  150 bits (378), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 117/356 (32%), Positives = 165/356 (46%), Gaps = 79/356 (22%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DR+F        +F+ I + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 403 FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 451

Query: 121 LSEGAGIIPRVLFKLFDA---LDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
           L+   GIIP  +  +F+    L      Y + C F+E+YNE + DLL             
Sbjct: 452 LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL------------- 498

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSG------TKRRIRPNTMYKPSRSPTVKPTLSS 231
                               + P GS SG      TK  IR N   + ++  T+    + 
Sbjct: 499 -----------------RREEKPAGSASGDDTNSNTKLEIRHN---QETKETTITNVTTV 538

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN 291
            L S   +                LL+R  + R  AST  N+ SSRSH+IF + L    +
Sbjct: 539 PLTSKNTVD--------------ELLKRANKLRSTASTACNERSSRSHSIFIVHL----S 580

Query: 292 GESFRVSK-----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
           GE+    +     +NLVDLAGSE I+ S    +R +E  SIN+SL  LG VI++L   +A
Sbjct: 581 GENVLTGERSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADA 640

Query: 347 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
              HIPFR SKLT LLQ SL GN+KT +   IS    ++ ET ++L +A+K  + K
Sbjct: 641 SKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 113/392 (28%), Positives = 177/392 (45%), Gaps = 73/392 (18%)

Query: 34  PDVTGTNEVSINTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYN 93
           P     NE  +    D    A  +   + +DR+F      L I+  + +PL      GYN
Sbjct: 82  PKPISNNEKKVWNIVDNKRIAHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYN 141

Query: 94  CTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAHN----DDYMIK 149
            T+  YGMT +GKT+TM+G +        E  G+IP  +  LF+ ++  N      Y + 
Sbjct: 142 ATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGKKKYEML 193

Query: 150 CSFIELYNEELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPE-GST--SG 206
            S++E+YNE+L DLLD                 T               PP  G++  S 
Sbjct: 194 VSYMEIYNEKLYDLLD-----------------TNVEGVNFGYSSNLQTPPRFGNSFNSA 236

Query: 207 TKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQV 266
              RIR +  Y                   I +  L E       + ++ ++ G +++++
Sbjct: 237 QDLRIRDDAQY------------------GIKVVGLSEHRCSSKDDLMKWVRIGDKNKKI 278

Query: 267 ASTKMNDVSSRSHTIFTI-MLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAG 325
           + T+ N  SSRSH+I  + ++           S ++L DLAGSE   ++ +Q +R KE  
Sbjct: 279 SETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGA 335

Query: 326 SINQSLLTLGRVINSLADK-------------------NAHIPFRESKLTRLLQDSLGGN 366
            IN+SLL LG VI  L+ +                   N+HIP+R+SKLTR+LQ +L GN
Sbjct: 336 FINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGN 395

Query: 367 TKTALIATISPAKINSEETSSTLEYATKAKNI 398
           +    I T+      S ET +TL +A++AKN+
Sbjct: 396 SIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 165/351 (47%), Gaps = 72/351 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   A Q  +F     PL    I G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII   + +LF  ++   D   + +  S++E+YNE ++DLL+  PD+        
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE--PDT-------- 231

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                       P+ K  +  + ++   
Sbjct: 232 --------------------------------------------PSQKLIIREDTDNTTT 247

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVS 298
           + NL        ++ + L+ +G  +R  + T  N+ SSRSH +  I + +       +  
Sbjct: 248 VANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKED 307

Query: 299 K----MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN----AHIPF 350
           K    ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L         H+P+
Sbjct: 308 KTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPY 367

Query: 351 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK+IK K
Sbjct: 368 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  149 bits (377), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/356 (33%), Positives = 170/356 (47%), Gaps = 81/356 (22%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  +     +FK + + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 404 FKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 452

Query: 121 LSEGAGIIPRVLFKLFDA---LDAHNDDYMIKCSFIELYNEELKDLL-----DETP--DS 170
           L    GIIP  +  +F+    L      Y I C F+E+YNE + DLL     D+T   DS
Sbjct: 453 LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSNDDTRNIDS 512

Query: 171 SMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS 230
           ++P                                 TK  IR +   + +R+ T+   ++
Sbjct: 513 NIP---------------------------------TKHEIRHD---QENRNTTITNIVT 536

Query: 231 SELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKC 290
             L+S     N+              L+R  + R  AST  N+ SSRSH+IF I L R  
Sbjct: 537 RNLDSEETADNI--------------LKRANKLRSTASTGSNEHSSRSHSIFIIHL-RGS 581

Query: 291 NG----ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
           N     ES+ +  +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L   + 
Sbjct: 582 NSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQ 639

Query: 347 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
              HIPFR SKLT LLQ SL GN+KT +   ISP+  +  ET ++L +A+K  + K
Sbjct: 640 GKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  149 bits (377), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 172/352 (48%), Gaps = 70/352 (19%)

Query: 58  SKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           S+ Y  DR+F  +     +FK I + L Q  + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 118 DGELSEGAGIIPRVLFKLFDALDAHNDD---YMIKCSFIELYNEELKDLLDETPDSSMPR 174
              L++  G+IP  +  +FD  ++  +    Y I C FIE+YNE + DLL +        
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNS------ 529

Query: 175 KLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGT--KRRIRPNTMYKPSRSPTVKPTLSSE 232
                                     +G+ +G+  K  IR +   K + + +V    +  
Sbjct: 530 -------------------------TDGNEAGSPNKHEIRHD---KETMTTSVTNINTIA 561

Query: 233 LNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--C 290
           LN+   + N+              L++  + R  A+T  N+ SSRSH++F I L  K   
Sbjct: 562 LNNKGIVNNV--------------LKKATKLRATAATNSNERSSRSHSVFMIYLKGKNEI 607

Query: 291 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---AH 347
            G+S     +NLVDLAGSE ++ S A   R +E  +IN+SL  LG VI++L   +    H
Sbjct: 608 TGDSSE-GILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRH 666

Query: 348 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           IPFR SKLT LLQ SL G++KT +   ISP K +  ET ++L +A+K  + K
Sbjct: 667 IPFRNSKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  148 bits (374), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 174/354 (49%), Gaps = 66/354 (18%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  +     +FK + + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 121 LSEGAGIIPRVLFKLFDA---LDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
           L    GIIP  +  +F+    L      Y I+C F+E+YNE + DLL    D++     +
Sbjct: 502 LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNG----K 557

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKP-SRSPTVKPTLSSELNSA 236
           + D +                 P  S S TK  IR    + P +++  V    + +L+S 
Sbjct: 558 VNDLLAS---------------PSQSNS-TKHEIR----HDPETQTTKVTNITTCKLDSK 597

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRKCNGE- 293
           I + N              +L+R  + R  AST  N+ SSRSH+IF I L    +  GE 
Sbjct: 598 ITVDN--------------ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEK 643

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------KN 345
           S+ +  +NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI++L          K 
Sbjct: 644 SYGI--LNLVDLAGSERINSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKK 701

Query: 346 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
            HIPFR SKLT LLQ SL GN+KT +   ISP+     ET ++L +A+K  + K
Sbjct: 702 RHIPFRNSKLTYLLQYSLIGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  147 bits (370), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/357 (33%), Positives = 163/357 (45%), Gaps = 66/357 (18%)

Query: 47  TGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGK 106
           T    IT       +  D++F P      IF+ I + L Q  + GYN  +  YG T +GK
Sbjct: 399 TQSMNITRDSKKHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGK 457

Query: 107 TYTMTGDERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDL 163
           TYTM          L    G+IP  L   F+    L     +Y I   FIE+YNE + DL
Sbjct: 458 TYTM----------LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDL 507

Query: 164 LDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSP 223
           L            R  ++ T                 E  T   K  IR +         
Sbjct: 508 L------------RGLNNDT-----------------EDITESLKHEIRHD--------- 529

Query: 224 TVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFT 283
                   + +   H+ N+    + D      LL+R  + R  A+T  N+ SSRSH++F 
Sbjct: 530 --------QESQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFI 581

Query: 284 IML--YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 341
           I L  Y    GE  + + +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L
Sbjct: 582 IKLRGYNSNTGEECQGT-LNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHAL 640

Query: 342 ADKNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
           A  +A   HIPFR SKLT LLQ SL G++KT +   ISP   +  ET ++L +A+K 
Sbjct: 641 ASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKV 697

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/353 (30%), Positives = 170/353 (48%), Gaps = 74/353 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  DR+F     Q  +++    PL    + G+N TV  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
            SE  GII   + +LF  ++   D   + ++ SF+E+YNE++ DLLD    S   +KL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDPNISS---KKLVI 232

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                     R  +   T  S L S   
Sbjct: 233 ------------------------------------------REDSYNRTFVSNL-SKHS 249

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFR-- 296
            +N++E  +MD      L+ +G  +R  + T  N+ SSRSH +  I + +       +  
Sbjct: 250 PENVEE--VMD------LVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADIKQD 301

Query: 297 --VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------NAHI 348
              + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L         + H+
Sbjct: 302 QTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFSCHV 361

Query: 349 PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           P+R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 362 PYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/358 (31%), Positives = 170/358 (47%), Gaps = 60/358 (16%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D V+ P    L I++ I +P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGG----D 190

Query: 121 LSEGAGIIPRVLFKLFDALD----AHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
             +  G+IP  +  LF  +          + +  S++E+YNE + DLLD           
Sbjct: 191 GGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLDS---------- 240

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSA 236
              +S+                  E S S  + +IR ++ Y                   
Sbjct: 241 ---ESLVGGTTTPSRGFGSGGGRNE-SVSTNELKIRDDSKY------------------G 278

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--CNGES 294
           + +  L+E     ++E ++ ++RG  HR+ A T  N  SSRSH I  I L      +G S
Sbjct: 279 VRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGTS 338

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL------------- 341
              S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L             
Sbjct: 339 IS-STLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 342 -ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
            A+ N HIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +A++AKN+
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/355 (31%), Positives = 167/355 (47%), Gaps = 68/355 (19%)

Query: 50  TGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYT 109
           T I +      +  D++F        +FK + + L Q  + GYN  +  YG T +GKT+T
Sbjct: 425 TKIQSTTQVHEFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 110 MTGDERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLLDE 166
           M          L+ G GIIP  +   F   + L     DY + C FIE+YNE + DLL  
Sbjct: 484 M----------LNTGDGIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRN 533

Query: 167 TPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVK 226
                        DS+                  + + + +K  IR +   + +++  + 
Sbjct: 534 -------------DSIGK----------------DDTNTNSKHEIRHD---QETKTTMIT 561

Query: 227 PTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 286
              S +L S   +                +L++  + R  AST  N+ SSRSH+IF I L
Sbjct: 562 NVTSCQLESEERVD--------------MILKKANKLRSTASTASNEHSSRSHSIFMIHL 607

Query: 287 Y---RKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 343
                K   +S+    +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L  
Sbjct: 608 SGSNAKTGAQSY--GTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQ 665

Query: 344 KNA---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
            ++   HIPFR SKLT LLQ SL G++KT +   ISP+  +  ET ++L +A+K 
Sbjct: 666 PDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 110/383 (28%), Positives = 181/383 (47%), Gaps = 78/383 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF        +++ +  P+     +GYN T+  YGMT +GKT+TM+G++      
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK------ 199

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD----YMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
             +  G+IP+ +  +FD + + +      Y +K S++E+YNE++ DLL+           
Sbjct: 200 --QEPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYV--------- 248

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSA 236
                                +P   S + T  +IR ++ Y                   
Sbjct: 249 -------------DRQAGSTGQP---SRNATGLKIRDDSKY------------------G 274

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYR---KCNGE 293
           + + +L E  +   ++ ++ +  G R+R+   T  N  SSRSH I  + L R   K   E
Sbjct: 275 VKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGSE 334

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----------- 342
           +   S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+           
Sbjct: 335 A--TSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQP 389

Query: 343 -DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK-- 399
                HIP+R+SKLTR+LQ +L G++    I TI     +S ET++T+ +A++AKNI   
Sbjct: 390 SPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALN 449

Query: 400 -NKPQVGSFIMKDVLVKNVTAEL 421
             K ++ S   KD +++N+  +L
Sbjct: 450 VRKNEMDSHAEKDTIIQNLRKQL 472

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 171/362 (47%), Gaps = 75/362 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D+VF P  +   +++ I +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 121 LSEGAGIIPRVLFKLFDAL---DAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
             + AG+I   + ++F  +     +N  Y ++ S++E+YNE++ DLL+  P +  P    
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN-YPSAKSP---- 246

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLS--SELNS 235
                                   G T G+         ++    P     L    +   
Sbjct: 247 ------------------------GGTYGS---------FQSKNVPGAGAELPVRDDARH 273

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN---G 292
            + +  L E  +  +++ +R ++ G  +R+   T  N  SSRSH I TI +   C     
Sbjct: 274 GVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKV--TCTELLS 331

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD--------- 343
            +   S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+          
Sbjct: 332 GTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGA 388

Query: 344 -------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAK 396
                   N+H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AK
Sbjct: 389 ATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAK 448

Query: 397 NI 398
           N+
Sbjct: 449 NV 450

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 166/354 (46%), Gaps = 77/354 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  +A+Q  ++      L    + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDDYMIKC--SFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII   + +LF  +++  D   I+   S++E+YNE ++DLL+             
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN------------- 226

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                             PN   K       K  +  + +  I 
Sbjct: 227 ----------------------------------PNVSSK-------KLVIREDSDQKIT 245

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK------CNG 292
           + NL        +E +  + RG  +R  + T  N+ SSRSH +  I + +        + 
Sbjct: 246 VSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLISN 305

Query: 293 ESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAH 347
            +F  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +  H
Sbjct: 306 STF--ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCH 363

Query: 348 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +P+R+SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL YA +AK+IK K
Sbjct: 364 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  144 bits (362), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 109/356 (30%), Positives = 168/356 (47%), Gaps = 61/356 (17%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF  + + + ++   ++P+     +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 121 LSEGAGIIPRVLFKLFDALDAH----NDDYMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
             E  G+IP  +  L+  +       +  + I  S++E+YNE++ DLLD           
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD----------- 222

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSA 236
                                KP    T+ T  R+  +   + S++P V+  L  +    
Sbjct: 223 ----------------CENELKP----TAATSSRMFAHMGTRSSKTP-VELKLREDSKYG 261

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFR 296
           + I  L E     + E ++ ++ G + R+   T  N  SSRSH I  I L +    E   
Sbjct: 262 VKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGTS 321

Query: 297 VSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKN---------- 345
           VS  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ ++          
Sbjct: 322 VSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSSS 378

Query: 346 ---AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
               HIP+R+SKLTR+LQ +L GN     I TI      S ET +TL +A++AKN+
Sbjct: 379 PVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNV 434

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  144 bits (363), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 113/427 (26%), Positives = 199/427 (46%), Gaps = 67/427 (15%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF P ++   +++ I +P+     +GYN  +  YGMT +GKT+TM+G        
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT------- 191

Query: 121 LSEGAGIIPRVLFKLFDALDAH---NDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
             E AG+I   +  +F  + +    N  + +  S++E+YNE++ DLL+++          
Sbjct: 192 -PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQS---------- 240

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
                +              KP   +  GT+  +R ++ +                   +
Sbjct: 241 --SLKSPGGGSGGGYGSFSSKPTHAA--GTELPVRDDSKH------------------GV 278

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN---GES 294
            +  L E  +  +++ ++ +  G  +R+   T  N  SSRSH I T+ L   C      +
Sbjct: 279 RVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNL--ACTDLVSGA 336

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------N 345
              S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+           N
Sbjct: 337 ETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTPSFGN 393

Query: 346 AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI-----KN 400
           +HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+     +N
Sbjct: 394 SHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMTVKRN 453

Query: 401 KPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQE 460
           + ++     KD L+ N+  +L + +  +   K          +   L  E +  K ++Q 
Sbjct: 454 EAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYLLRKESDALKRKLQL 511

Query: 461 CKRAIER 467
           C+R +++
Sbjct: 512 CERLLDK 518

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 166/350 (47%), Gaps = 64/350 (18%)

Query: 58  SKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           S  +  D++F P      +F+ I + L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 118 DGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPR 174
              L+ G G+IP  L   F+  + L  H   Y + C +IE+YNE + DL           
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDL----------- 511

Query: 175 KLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELN 234
            LR F+S                   +      K  IR +                   N
Sbjct: 512 -LREFNS---------------NDNIDDILESQKHEIRHD-----------------HDN 538

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
            A  I N+ +  +   ++   +L+R  R R  A T+ N+ SSRSH++F + +    N ++
Sbjct: 539 HATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHNDQT 597

Query: 295 FRVS--KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIP 349
             VS  K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L   +A   HIP
Sbjct: 598 GEVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIP 657

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           FR SKLT LLQ SL G++KT +   I   + ++ ET ++L +A+K  + K
Sbjct: 658 FRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 162/352 (46%), Gaps = 73/352 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F  +A Q  ++      L    + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 121 LSEGAGIIPRVLFKLFDALDAHND--DYMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  G+I   + +LF  ++   D   + I  S++E+YNE ++D                
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRD---------------- 224

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
                                                +  P  SP  K  +  +  + I 
Sbjct: 225 -------------------------------------LLSPEMSPK-KLVIREDSENRIS 246

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFR-- 296
           + NL        ++ + L+  G  +R  ++T  N+ SSRSH +  I + +          
Sbjct: 247 VANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSD 306

Query: 297 --VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKNAHIP 349
              +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L       +  H+P
Sbjct: 307 HTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVP 366

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           +R+SKLTRLL+ SLGGN KT +I  +SP+  + +ET +TL+YA +AK IK K
Sbjct: 367 YRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 107/349 (30%), Positives = 172/349 (49%), Gaps = 66/349 (18%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F   A Q  +++     L    + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKLRI 178
             E  GII RV+ +LF+ ++   D   + +  S++E+YNE ++DLL   P+ ++P++L I
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLLK--PE-TVPKRLII 259

Query: 179 FDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIH 238
            +                   P+         I+ N       + T  PT ++E++S  H
Sbjct: 260 RED----GANKISVSNLSYHNPQTVQEVIDLVIKGNI------NRTTSPTEANEVSSRSH 309

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVS 298
              + + HIM                   + +  D++S  HT  T               
Sbjct: 310 A--VLQIHIMQ------------------TNRTADLTSE-HTFAT--------------- 333

Query: 299 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKNAHIPFRE 352
            ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +++ HIP+R+
Sbjct: 334 -LSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSCHIPYRD 392

Query: 353 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNK 401
           SKLTRLL+ SLGGN KT +I  ISP+  + +ET +TL+YA +AK IK K
Sbjct: 393 SKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  142 bits (357), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 171/352 (48%), Gaps = 70/352 (19%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           TAQ++   +  D++F        +FK + + L Q  + GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 113 DERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD 169
                   L+ G GIIP  +   F   + L     DY + C FIE+YNE   +++D    
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE---NIVDLLRS 533

Query: 170 SSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTL 229
            ++ R                          + ++S  K  IR +   + +++  +    
Sbjct: 534 DNINR--------------------------DDTSSSLKHEIRHD---QETKTTVITNVT 564

Query: 230 SSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY-- 287
           + +L S           ++D      +L++  + R  AST  N+ SSRSH+IF I L   
Sbjct: 565 TCKLESE---------KMVDM-----ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGS 610

Query: 288 -RKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA 346
             K   +S+    +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L   ++
Sbjct: 611 NTKTGAQSY--GTLNLVDLAGSERINISQVVGDRLRETQNINKSLSCLGDVIHALGQPDS 668

Query: 347 ---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
              HIPFR SKLT LLQ SL G++KT +   ISP+  +  ET ++L +A+K 
Sbjct: 669 TKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 116/378 (30%), Positives = 177/378 (46%), Gaps = 87/378 (23%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDAL--DAHNDD--YMIKCSFIELYNEELKDLLD---ETPDSSMP 173
           L    G+IP  +  LF  +   + N D  + +  S++E+YNE + DLL+   E   S + 
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRIS 274

Query: 174 RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSEL 233
              R++ S +                      G + +IR ++ Y                
Sbjct: 275 TPSRLYMSKSNSNGL-----------------GVELKIRDDSQY---------------- 301

Query: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKC--N 291
              + +  L E     ++E +R +  G + R++  T  N  SSRSH I  I L      N
Sbjct: 302 --GVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKN 359

Query: 292 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------ 344
           G S R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      
Sbjct: 360 GTS-RSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGS 415

Query: 345 ---------------NA---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKI 380
                          NA         HIP+R+SKLTRLLQ +L G++    I T+     
Sbjct: 416 NIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 475

Query: 381 NSEETSSTLEYATKAKNI 398
            + ET +TL +A++AKN+
Sbjct: 476 AAAETMNTLRFASRAKNV 493

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 111/389 (28%), Positives = 180/389 (46%), Gaps = 84/389 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF        ++  + +P+     +GYN T+  YGMT +GKT+TM+G +      
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK------ 198

Query: 121 LSEGAGIIPRVLFKLFDAL-----DAHNDDYMIKCSFIELYNEELKDLLD--ETPDSSMP 173
             +  G+IP  +  +FD +      +    Y +K S++E+YNE++ DLL   E   +   
Sbjct: 199 --QDPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITEANGAVAS 256

Query: 174 RKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSEL 233
           R+L                          ++SG K  IR ++ Y                
Sbjct: 257 RQL------------------------GRNSSGLK--IRDDSKY---------------- 274

Query: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGE 293
              + + +L E  +    E I+ +  G ++R+   T  N  SSRSH I  + L R C  +
Sbjct: 275 --GVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTR-CELK 331

Query: 294 SFR--VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL---------- 341
           +     S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L          
Sbjct: 332 TGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSG 388

Query: 342 ------ADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
                 +    HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++A
Sbjct: 389 SNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRA 448

Query: 396 KNIK---NKPQVGSFIMKDVLVKNVTAEL 421
           KNI     K ++ +   KD +++N+  +L
Sbjct: 449 KNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 113/375 (30%), Positives = 171/375 (45%), Gaps = 81/375 (21%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++   +P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD----YMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
           L    G+IP  +  LF  +   + D    + +  S++E+YNE + DLL+   + S     
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEES----- 269

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKP-SRSPTVKPTLSSELNS 235
                                    GS  GT  R   + M K  S +  V+  +  +   
Sbjct: 270 -------------------------GSRPGTPSR---SYMGKSNSNAMGVELKIRDDSKY 301

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK-CNGES 294
            + +  L E      +E +R +  G + R++  T  N  SSRSH I  I L     N  +
Sbjct: 302 GVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGT 361

Query: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKNA------- 346
            R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK         
Sbjct: 362 SRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNIS 418

Query: 347 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 383
                                  HIP+R+SKLTRLLQ +L G++    I T+      + 
Sbjct: 419 TTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAA 478

Query: 384 ETSSTLEYATKAKNI 398
           ET +TL +A++AKN+
Sbjct: 479 ETMNTLRFASRAKNV 493

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 170/372 (45%), Gaps = 75/372 (20%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L I++VI  P+     +G+N T+  YGMT +GKTYTM G       E
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----E 191

Query: 121 LSEGAGIIPRVLFKLF-----DALDAHNDDYMIKCSFIELYNEELKDLL-DETPDSSMPR 174
             +  G+IP  +  LF     + LD  +  + I  S++E+YNE++ DLL DE  +++   
Sbjct: 192 REQKDGLIPLSVSYLFTKIMEETLDG-DKKFEIVLSYLEIYNEKIYDLLGDENNNNNNNN 250

Query: 175 KLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELN 234
               F + T                        + +IR ++ Y                 
Sbjct: 251 GTLAFGTPTRNNNNICFQ--------------NELKIRDDSKY----------------- 279

Query: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294
             + +  L E     ++E +  + +G + R+ A T  N  SSRSH I  I L      + 
Sbjct: 280 -GVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDG 338

Query: 295 FRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKN----- 345
             +S  ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+   +KN     
Sbjct: 339 TSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTL 395

Query: 346 -------------------AHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETS 386
                               HIP+R+SKLTRLLQ +L G++    I TI     +S ET 
Sbjct: 396 PSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETL 455

Query: 387 STLEYATKAKNI 398
           +TL +A++AKNI
Sbjct: 456 NTLRFASRAKNI 467

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 170/380 (44%), Gaps = 85/380 (22%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFDAL--DAHNDD--YMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
           L    G+IP  +  LF  +   + N D  + +  S++E+YNE + DLL+   + S  R  
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSR-- 272

Query: 177 RIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSA 236
                                     +  G + +IR ++ Y                   
Sbjct: 273 ------------LGTPSRSYMSKNNSNALGVELKIRDDSQY------------------G 302

Query: 237 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK-CNGESF 295
           + +  L E     +++ +R +  G + R++  T  N  SSRSH I  I L        + 
Sbjct: 303 VKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDGTS 362

Query: 296 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK---------- 344
           R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK          
Sbjct: 363 RSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPT 419

Query: 345 --------------------------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPA 378
                                     + HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 420 TPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 479

Query: 379 KINSEETSSTLEYATKAKNI 398
              + ET +TL +A++AKN+
Sbjct: 480 NDAAAETMNTLRFASRAKNV 499

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  131 bits (330), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 170/368 (46%), Gaps = 80/368 (21%)

Query: 47  TGDTGITAQI------NSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYG 100
           TG   +T  I       S  +  D++F        +F  + E L Q  + G+N  +  YG
Sbjct: 388 TGTQSLTLDIKRPMTNGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYG 446

Query: 101 MTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFD---ALDAHNDDYMIKCSFIELYN 157
            T +GKTYTM          L+E  GIIP  L  + D   ++      Y +K  F+E+YN
Sbjct: 447 QTGSGKTYTM----------LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYN 496

Query: 158 EELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMY 217
           +                  RIFD +                  +G     +  +R + + 
Sbjct: 497 D------------------RIFDLLN-----------------DGKGKHKECEVRHDDIG 521

Query: 218 KPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSR 277
           + +    V  T   +L   +   N +E           L+QR  + R+ A T MN+ SSR
Sbjct: 522 RRTELTNV-ITREFQLEEDLIESNRRELQ--------ELVQRLNKVRRTAKTAMNNRSSR 572

Query: 278 SHTIFTIMLY-------RKCNGESFRVSKMNLVDLAGSENISRSG-AQNQRAKEAGSINQ 329
           SH++F + +         +C G       +NLVDLAGSE ++RSG    +R +E   IN+
Sbjct: 573 SHSVFIVEVEGFNKDSEERCKG------VLNLVDLAGSERMNRSGLVDKERIEETKQINK 626

Query: 330 SLLTLGRVINSLADKNA--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSS 387
           SL ++G VI++L   +   HIPFR +KLT LL+ SL G++KT ++ T+SP+  +  ET +
Sbjct: 627 SLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLMLVTVSPSNSSRNETMN 686

Query: 388 TLEYATKA 395
           +L +ATK 
Sbjct: 687 SLRFATKV 694

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 175/379 (46%), Gaps = 89/379 (23%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D VF      L +++  ++P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 121 LSEGAGIIPRVLFKLFD---ALDAHNDD-YMIKCSFIELYNEELKDLLDETPDSSMPRKL 176
           L    G+IP  +  LF     L  + D  + +  S++E+YNE + DLL+   + S+ R  
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSRPS 274

Query: 177 ---RIFDSVTXXXXXXXXXXXXXXKPPEGSTSG--TKRRIRPNTMYKPSRSPTVKPTLSS 231
              R++                     +G+++G   + +IR +T Y              
Sbjct: 275 TPSRLYMG-------------------KGNSNGLSAELKIRDDTQY-------------- 301

Query: 232 ELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK-C 290
                + +  L E     ++E ++ +  G + R++  T  N  SSRSH I  I L     
Sbjct: 302 ----GVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDL 357

Query: 291 NGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK----- 344
              + R S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 ESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTG 414

Query: 345 -NAHIP------------------------FRESKLTRLLQDSLGGNTKTALIATISPAK 379
            N H                          +R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 380 INSEETSSTLEYATKAKNI 398
             + ET +TL +A++AKN+
Sbjct: 475 DAAAETINTLRFASRAKNV 493

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  125 bits (314), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 166/343 (48%), Gaps = 65/343 (18%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T D++FG   D   +F  I + L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 121 LSEGAGIIPRVL-FKLFDALDAHN--DDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
           L+E  GII + + + +  A + H    +Y ++  FIE+YNE ++DLL+  P++     +R
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN--PEAKHQHVIR 490

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
             D                    +G+T  T            +   T+K T +       
Sbjct: 491 HDD-------------------KKGTTEVTN-----------THKITIKLTHN------- 513

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRKCNGESF 295
                ++  I  + +  +L++ G   R   ST MN+ SSRSH++F + +  + +   E  
Sbjct: 514 -----EDDEIAKSAQIRQLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEH- 567

Query: 296 RVSKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 353
              ++NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR S
Sbjct: 568 STGRLNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNS 627

Query: 354 KLTRLLQDSLGGNTKTALIATISPAKINS-EETSSTLEYATKA 395
           KLT LL++SL   +KT +   ISP  INS  ET ++L  A K 
Sbjct: 628 KLTYLLKNSLINKSKTLMYVNISP-NINSIRETINSLRLARKV 669

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 112/175 (64%), Gaps = 9/175 (5%)

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESF-- 295
           +I+ L +  +   +E ++ ++ G   R VA T +N+ SSRSH I TI + ++   +SF  
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINI-QQTEIDSFGD 231

Query: 296 ---RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKNAHIPFR 351
              RVS + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+R
Sbjct: 232 TVERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYR 291

Query: 352 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 406
           ES LTR+L+D+L GN+ T ++A ISP   + EE+ STL YA+ AK+++ +  + +
Sbjct: 292 ESLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHLNT 344

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 112/386 (29%), Positives = 170/386 (44%), Gaps = 94/386 (24%)

Query: 57  NSKTYTVDRVFGPSAD-QLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
           N K + VD++F P A  +     +I + + Q F  GYN  ++ YG T +GKT TM G   
Sbjct: 67  NLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLF-NGYNVAIMAYGQTDSGKTSTMFG--- 122

Query: 116 LYDGELSEGAGIIPRVLFKLFDALDA---HNDDYMIKCSFIELYNEELKDLLDETPDSSM 172
                 ++G G+I  V  ++F  ++    +N DY I  S IE+  E ++DLL        
Sbjct: 123 -----YNKGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLL-------- 169

Query: 173 PRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSE 232
                                                   P +  KP     +K  L S+
Sbjct: 170 ---------------------------------------APLSEQKP-----LKLRLDSK 185

Query: 233 LNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN- 291
             S+I I+NL+  ++    E +   ++G   R +AS       SRS  I  I + ++ N 
Sbjct: 186 -KSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNV 234

Query: 292 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--------- 342
            E F+     LVDL  S+ I +        +    INQS++TL  V  SLA         
Sbjct: 235 KEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNG 294

Query: 343 ---DKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
                N +IP++ES LT+LLQ+++GGN KT L+   S AK + EET +TL +    K +K
Sbjct: 295 RPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVK 354

Query: 400 -----NKPQVGSFIMKDVLVKNVTAE 420
                NK    S  M D+L+K+  A+
Sbjct: 355 NLFQQNKAGTNSKAMLDLLMKDFDAK 380

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 99/155 (63%), Gaps = 8/155 (5%)

Query: 247 IMDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGESFRVSKMNL 302
           ++++KE + ++L+R  + R  AST  N+ SSRSH+IF I L+    K   ES  V  +NL
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGV--LNL 659

Query: 303 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA--HIPFRESKLTRLLQ 360
           VDLAGSE +  S    +R +E  +IN+SL  LG VI +L DKN   HIPFR SKLT LLQ
Sbjct: 660 VDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQ 719

Query: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395
            SL GN+KT +   ISP+  +  ET ++L +A+K 
Sbjct: 720 YSLVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (51%), Gaps = 18/110 (16%)

Query: 60  TYTVDRVF--GPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLY 117
           ++  D++F  G S D+  +FK + + L Q  + GYN  +  YG T +GKTYTM       
Sbjct: 471 SFKFDKIFDTGESNDE--VFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 520

Query: 118 DGELSEGAGIIPRVLFKLFDA---LDAHNDDYMIKCSFIELYNEELKDLL 164
              L    G+IP  +  +FD    L     +Y I C F+E+YNE + DLL
Sbjct: 521 ---LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  116 bits (290), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 114/440 (25%), Positives = 191/440 (43%), Gaps = 115/440 (26%)

Query: 43  SINTTGDTGITA----QINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLV 98
           SIN T DT +T     Q+ +  Y  D+VF  S D  +  +   E   +  ++GYN +++ 
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVT 109

Query: 99  YGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAH------NDDYMIKCSF 152
           YG + TGK++ + G+++          G+I ++L KLF+ +D        N  Y +K SF
Sbjct: 110 YGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSF 160

Query: 153 IELYNEELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIR 212
           +E+Y E++ DL+D +P  S+ + L+I DS                               
Sbjct: 161 LEVYQEKMFDLMD-SP--SVKKHLKINDSTYAM--------------------------- 190

Query: 213 PNTMYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKE-----GIRLLQRGLRHRQVA 267
                                 +   ++NL+   ++  +E      I LL +  RH    
Sbjct: 191 ----------------------NGFQVENLRTTQVLTLEELKILINICLLNQKERH---- 224

Query: 268 STKMNDVSSRSHTIFTIMLYRKCN-GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGS 326
               N++  RSHTI  + + ++    ES  +S + +VDLAGS+ I ++ +     ++A  
Sbjct: 225 ----NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKK 280

Query: 327 INQSLLTLGRVINSLADKNAH-------------IPFRESKLTRLLQDSLGGNTKTALIA 373
           IN  + ++  VIN L   N               +P++ S LTRLL D LGGN KT  + 
Sbjct: 281 INHQIKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLL 340

Query: 374 TISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKS 433
           T S  K +  ET STL++    K+    P++  F +             K   D+  T  
Sbjct: 341 TSSLKKNDWNETLSTLKFGYNCKSANTNPRINRFGLNS-----------KATMDIFLTDM 389

Query: 434 KDGIYMSQENYKELTNELEN 453
           K    + ++N+  +TN L N
Sbjct: 390 K----LKEDNFISITNNLTN 405

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/159 (44%), Positives = 98/159 (61%), Gaps = 9/159 (5%)

Query: 248 MDAKEGI-RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGESFRVSKMNLV 303
           +D +E + ++L R  + R  ASTK N+ SSRSH+IF I L+    K N +S+ +  +NLV
Sbjct: 546 LDREETVEKVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLV 603

Query: 304 DLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLADKNAHIPFRESKLTRLLQ 360
           DLAGSE I+ S    +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+
Sbjct: 604 DLAGSERINSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLK 663

Query: 361 DSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
            SL GN+KT +   IS +  +  ET ++L +A+K  + K
Sbjct: 664 YSLSGNSKTLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 59/122 (48%), Gaps = 14/122 (11%)

Query: 52  ITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMT 111
           IT   N+  Y  D++F        IFK + + L Q  + GYN  +  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 112 GDERLYDGELSEGAGIIP---RVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETP 168
                    L+   GIIP   R +F   D L     +Y I C F+E+YNE + DLL E  
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQ 520

Query: 169 DS 170
            S
Sbjct: 521 TS 522

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/167 (41%), Positives = 97/167 (58%), Gaps = 6/167 (3%)

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRKCNGESF 295
           HI N+    +   +   R+L+R L+ R  A+T  N  SSRSH++F I L  Y   +GE  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 296 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRE 352
               +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L   +A   HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 353 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 59/125 (47%), Gaps = 16/125 (12%)

Query: 47  TGDTGITAQINSK--TYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           TG   IT + +SK   +T DR F        +F  I + L Q  + GYN  +  YG T +
Sbjct: 393 TGMQSITIKRDSKQHKFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGS 451

Query: 105 GKTYTMTGDERLYDGELSEGAGIIPRVLFKLF---DALDAHNDDYMIKCSFIELYNEELK 161
           GKT+TM          L+   GIIP  L  +F   + L      Y I   F+E+YNE +K
Sbjct: 452 GKTFTM----------LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIK 501

Query: 162 DLLDE 166
           DL  E
Sbjct: 502 DLFKE 506

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 66/147 (44%), Positives = 91/147 (61%), Gaps = 8/147 (5%)

Query: 255 RLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGESFRVSKMNLVDLAGSENI 311
           R+L+R  + R  AST  N+ SSRSH+IF I L     K   +S+    +NLVDLAGSE I
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSY--GTLNLVDLAGSERI 632

Query: 312 SRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTK 368
           + S     R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++K
Sbjct: 633 NISQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSK 692

Query: 369 TALIATISPAKINSEETSSTLEYATKA 395
           T +   ISP+  +  ET ++L +A+K 
Sbjct: 693 TLMFVNISPSSSHINETLNSLRFASKV 719

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D++F        +FK + + L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 121 LSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLL 164
           L+ G GIIP  +   F   + L     DY + C FIE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 92/149 (61%), Gaps = 6/149 (4%)

Query: 256 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSK--MNLVDLAGSENISR 313
           LL++  R R  AST  N+ SSRSH++F I L +  N  +   S   +NLVDLAGSE I+ 
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFL-KGSNHLTGEQSDGILNLVDLAGSERINS 624

Query: 314 SGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKTA 370
           S    +R +E  +IN+SL  LG V+++L   +A   HIPFR SKLT LLQ SL GN+KT 
Sbjct: 625 SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTL 684

Query: 371 LIATISPAKINSEETSSTLEYATKAKNIK 399
           +   IS  + +  ET ++L +A+K  + K
Sbjct: 685 MFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 64/138 (46%), Gaps = 17/138 (12%)

Query: 35  DVTGTNEVSINTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNC 94
           D  G   + I  + +TG +   N   +  DR+F  +     +F+ I + L Q  + GYN 
Sbjct: 405 DENGCQTMEIVKSNNTGNSIPQN---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNV 460

Query: 95  TVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRV---LFKLFDALDAHNDDYMIKCS 151
            +  YG T +GKTYTM          L+   GIIP     +F   + L     +Y I C 
Sbjct: 461 CIFAYGQTGSGKTYTM----------LNPRNGIIPATISHIFSWIENLKERGWNYEINCQ 510

Query: 152 FIELYNEELKDLLDETPD 169
           FIE+YNE + DLL    D
Sbjct: 511 FIEIYNENIADLLRSDQD 528

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 89/146 (60%), Gaps = 8/146 (5%)

Query: 256 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY---RKCNGESFRVSKMNLVDLAGSENIS 312
           +L++  + R  AST  N+ SSRSH+IF I L     K    S+    +NLVDLAGSE I+
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSY--GTLNLVDLAGSERIN 634

Query: 313 RSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIPFRESKLTRLLQDSLGGNTKT 369
            S     R +E  +IN+SL  LG VI++L   ++   HIPFR SKLT LLQ SL G++KT
Sbjct: 635 VSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKT 694

Query: 370 ALIATISPAKINSEETSSTLEYATKA 395
            +   ISP+  +  ET ++L +A+K 
Sbjct: 695 LMFVNISPSSSHINETLNSLRFASKV 720

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           TAQ++   +  D++F      + +FK + + L Q  + GYN  +  YG T +GKT+TM  
Sbjct: 430 TAQVHE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 484

Query: 113 DERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLL 164
                   L+ G GIIP  +   F   + L     DY + C FIE+YNE + DLL
Sbjct: 485 --------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (62%), Gaps = 4/147 (2%)

Query: 256 LLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY--RKCNGESFRVSKMNLVDLAGSENISR 313
           +L+   + + +A+T  N+ SSRSH++FTI ++      GE+     +NLVDLAGSE I  
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEA-SDGVLNLVDLAGSERIDT 599

Query: 314 SGAQNQRAKEAGSINQSLLTLGRVINSLADKN-AHIPFRESKLTRLLQDSLGGNTKTALI 372
           S     R +E  +IN+SL  LG VI +L  K+  HIPFR SKLT LLQ SL G++KT + 
Sbjct: 600 SNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMF 659

Query: 373 ATISPAKINSEETSSTLEYATKAKNIK 399
             +SP+  + +ET ++L +A+K  + K
Sbjct: 660 VNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 57/121 (47%), Gaps = 14/121 (11%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  D+VF  +A    +F+ + + L Q  + GYN  +  YG T +GKTYTM  D       
Sbjct: 404 FLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMMND------- 455

Query: 121 LSEGAGIIPRVLFKLFDA---LDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
                G+IP  L  +FD    L     DY  +  FIE+YNE++ DLL        P K  
Sbjct: 456 ---PDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLLRSLNPEPGPTKYE 512

Query: 178 I 178
           I
Sbjct: 513 I 513

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 97/170 (57%), Gaps = 12/170 (7%)

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRV 297
           +I N+    +    +   +L++  + R  A+T+ N+ SSRSH++F + +    NG +   
Sbjct: 540 YITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHI----NGRNLHT 595

Query: 298 S-----KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNA---HIP 349
                 K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L   +A   +IP
Sbjct: 596 GETSQGKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIP 655

Query: 350 FRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
           FR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 656 FRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 58/114 (50%), Gaps = 14/114 (12%)

Query: 54  AQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
            +I S  +  D +F PS     IF+ I + L Q  + GYN  +  YG T +GKTYTM   
Sbjct: 408 GRILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--- 463

Query: 114 ERLYDGELSEGAGIIPRVL---FKLFDALDAHNDDYMIKCSFIELYNEELKDLL 164
                  L+ G G+IP  L   FK    L     +Y ++C +IE+YNE + DLL
Sbjct: 464 -------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/298 (28%), Positives = 137/298 (45%), Gaps = 45/298 (15%)

Query: 236 AIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRK--CNGE 293
            + +  + E     A+E ++ +  G   R+   T  N  SSRSH I  + L      NG 
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK--------- 344
           +   + ++L DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +         
Sbjct: 302 TH-FNTLSLCDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRP 357

Query: 345 ------NAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 398
                 N+HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 358 SSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

Query: 399 KNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEV 458
                            NV+ + +  R D    +    +    +  +E    + N K + 
Sbjct: 418 S---------------LNVSRKSISYRPDSQDAEKDKRVRSLTKLVEEQDLIISNLKKQQ 462

Query: 459 QECKRAIERLSTQNGLLTKEKRITNEV---------NESQRLKIKKLSNNIDFLYDKI 507
           Q    A++R +++  LL  E R+  +          N+S  L+  ++   +DFL  ++
Sbjct: 463 QHAGSALQRPNSRTALLEAENRVLRDKLQHCERLLDNDSVELQDSQIMEIVDFLPPEV 520

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 54  AQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 113
           A  +   +  D VFGP+A    +F  +   L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 114 ERLYDGELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLD 165
               DG +         V  ++ +A D       +  S++E+YNE++ DLL+
Sbjct: 180 N---DGIVKMCGDC---VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLN 225

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 89/149 (59%), Gaps = 10/149 (6%)

Query: 254 IRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISR 313
           + L+ +G R+R+V ST+ N  SSRSH +  + +     G   RV  + L DLAGSE   R
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRIT-DSMGSKARV--LTLCDLAGSE---R 294

Query: 314 SGAQNQRAK-EAGSINQSLLTLG---RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKT 369
           +   ++  + E G+IN+SL+ LG   R++N     + H+P+R+SKLTRLL+ SL GN   
Sbjct: 295 ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLV 354

Query: 370 ALIATISPAKINSEETSSTLEYATKAKNI 398
            ++ T+S +  + E++  TL +A +A  +
Sbjct: 355 TMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 54/109 (49%), Gaps = 23/109 (21%)

Query: 76  IFKVIAEPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRV 131
           IF    +PL      D I G   T++ YG T +GKTYTM G +       +EG GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTK-------AEG-GIVQ-- 168

Query: 132 LFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFD 180
              + D L   + +  I  S++E+YNE L DLL +       ++LRI D
Sbjct: 169 -LSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDG-----TKELRILD 211

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 112/488 (22%), Positives = 209/488 (42%), Gaps = 92/488 (18%)

Query: 60  TYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 119
           ++    +F   ++  LI   I   +  + ++GYN  ++ YG   +GKTY++ G+    D 
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGN----DV 138

Query: 120 ELSEGAGIIPRVLFK-LFDALDAHNDD------YMIKCSFIELYNEELKDLLDETPDSSM 172
           + S G G   +++FK LF  ++    D      +++K SF+E++ +++ DLL        
Sbjct: 139 DDSFGLG---QIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL-------- 187

Query: 173 PRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSE 232
                                      P+  T     +IR  + +K              
Sbjct: 188 --------------------------APQNLTKLPHLKIRHVSEHK-------------- 207

Query: 233 LNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCN- 291
               + + NL++ H+   KE +    + +    V ++K ++   R++TIF I + +    
Sbjct: 208 ---GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKL 261

Query: 292 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD------KN 345
            ES   S + LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+       KN
Sbjct: 262 DESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKN 321

Query: 346 AH------IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIK 399
                   +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  T  ++ K
Sbjct: 322 YEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSK 381

Query: 400 NKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQ 459
             PQ+  F + +    ++  E  K++ +    +  + +   +E    +TN+ E+   E  
Sbjct: 382 TVPQINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLE-- 439

Query: 460 ECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKK--LSNNIDFLYDKIDRQHKNEQEL 517
                + +L ++N  L  +     ++  S +L      L NN     +  +R   NE   
Sbjct: 440 ----ELNKLRSENAKLKAQVNTLTQLMVSPKLASPSPMLENNKTVRNNSAER---NETSY 492

Query: 518 SNVVQELM 525
            NVVQ LM
Sbjct: 493 ENVVQTLM 500

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 92/238 (38%), Gaps = 62/238 (26%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T DR FG       IF  I + L Q  + GYN  +  YG T +GKTYTM   E      
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPE------ 460

Query: 121 LSEGAGIIPRVLFKLF---DALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
                GIIP  L  +F   + L      Y I   FIE+YNE +KDL  +    +      
Sbjct: 461 ----DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTEN------ 510

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
                                  +  +   K  IR +     S S T             
Sbjct: 511 -----------------------DDGSEALKHEIRHD-----SDSQTT------------ 530

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRKCNGE 293
           HI N+    + + +    +L R ++ R  A+T  N  SSRSH++F I L  Y   +GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 92/238 (38%), Gaps = 62/238 (26%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +T DR FG       IF  I + L Q  + GYN  +  YG T +GKTYTM   E      
Sbjct: 408 FTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTMLNPE------ 460

Query: 121 LSEGAGIIPRVLFKLF---DALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLR 177
                GIIP  L  +F   + L      Y I   FIE+YNE +KDL  +    +      
Sbjct: 461 ----DGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTEN------ 510

Query: 178 IFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAI 237
                                  +  +   K  IR +     S S T             
Sbjct: 511 -----------------------DDGSEALKHEIRHD-----SDSQTT------------ 530

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML--YRKCNGE 293
           HI N+    + + +    +L R ++ R  A+T  N  SSRSH++F I L  Y   +GE
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAISGE 588

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 19/129 (14%)

Query: 45  NTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           NTTGDT         T+  D+VF  +A Q  +   + +P   D + GYN T+L YG + +
Sbjct: 67  NTTGDT-------HSTFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFS 119

Query: 105 GKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAH----NDDYMIKCSFIELYNEEL 160
           GK+Y++ G +        +G GI+P +   LF  L+       +++ +     E+Y E+ 
Sbjct: 120 GKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKT 171

Query: 161 KDLLDETPD 169
            DLL   P+
Sbjct: 172 YDLLVPLPE 180

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 26/181 (14%)

Query: 276 SRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           SRSH +F + +  R    +  + S + L+DL G+E   +             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 335 GRVINSL---------ADKNAHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 384
              + SL         + K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 385 TSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLA--TKSKDGIYMSQE 442
           T STL++    + I N+           ++ N +   ++ + DL     K KD  Y+SQ 
Sbjct: 352 TLSTLKFGDSIRQINNR-----------VMDNTSGLNLRKKMDLFVQDMKIKDDNYISQI 400

Query: 443 N 443
           N
Sbjct: 401 N 401

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 13/121 (10%)

Query: 60  TYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 119
           T+  D+VF  +A Q  + K +  P+  D + GYN TV+ YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK----- 128

Query: 120 ELSEGAGIIPRVLFKLFDALDAH----NDDYMIKCSFIELYNEELKDLLDETPDSSMPRK 175
              E  GI+P +   LFD L+ +     D + +     E+Y E+  DLL   P+   P K
Sbjct: 129 ---ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLLVPLPERK-PLK 184

Query: 176 L 176
           L
Sbjct: 185 L 185

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 84/181 (46%), Gaps = 26/181 (14%)

Query: 276 SRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           SRSH +F + +  R    +  + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 335 GRVINSLA---------DKNAHI-PFRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 384
              + SL+          K +H   +RES+LT +L+DSLGGN KT +I T   + + +  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 385 TSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLA--TKSKDGIYMSQE 442
           T STLE+    + I NK           +  N T   +K + DL     K KD  Y++Q 
Sbjct: 351 TLSTLEFGDSIRQINNK-----------VTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQI 399

Query: 443 N 443
           N
Sbjct: 400 N 400

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 19/130 (14%)

Query: 39  TNEVSINTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLV 98
           T+E S  TTGDT         T+  D+VF  +A Q  +   +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDT-------YSTFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 99  YGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFDALDAH----NDDYMIKCSFIE 154
           YG + +GK+Y++ G +        EG GI+P +   LF+ L+ +     +++ +     E
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 155 LYNEELKDLL 164
           ++ E+  DLL
Sbjct: 165 IFMEKTYDLL 174

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 94/194 (48%), Gaps = 28/194 (14%)

Query: 276 SRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           S+SH +F + +  R  N +  R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 335 GRVINSLADKN---------AHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 384
             ++  L+ K+         +H   +RES+LT +L+DSLGGN KT +I T   + +++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 385 TSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLA--TKSKDGIYMSQE 442
           T STLE+    + I NK           ++ N T   +K + DL     K +D  Y S+ 
Sbjct: 351 TLSTLEFGECIRQITNK-----------VIDNTTGLNLKKKMDLFIEDMKIRDNNYASRI 399

Query: 443 NYKELTNELENYKT 456
           N   L  E+++ KT
Sbjct: 400 NI--LKAEIDSLKT 411

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 95/419 (22%), Positives = 158/419 (37%), Gaps = 133/419 (31%)

Query: 48  GDTGITAQINSKT-----YTVDRVFGPSADQL-LIFKVIAEPLFQDFIKGYNCTVLVYGM 101
           G TG      S+T     + VD+VF     Q  L+   I +    +   G+N +++ +G 
Sbjct: 33  GATGTRIIFTSETTGNTEFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQ 92

Query: 102 TSTGKTYTMTG--------------------------DERLYDGE--------------- 120
           + TGK++TM G                          DE + D +               
Sbjct: 93  SGTGKSFTMFGNNSLTSTNTSPIKHKNSHNNKKADANDEYVSDIDSIEGLDSDLDSNQDN 152

Query: 121 -------------LSEGAGIIPRVLFKLFDALD-----AHNDDYMIKCSFIELYNEELKD 162
                        LS   GI+ R +  +F  ++          + +  SF E+Y +++ D
Sbjct: 153 LSSDMLLAQSGLVLSPNDGILQRSVKDIFSRINEVKRLKEKSQFSVSFSFYEVYEDKVFD 212

Query: 163 LLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRS 222
           LL  T D + P KL                                  IRPN  +K +  
Sbjct: 213 LLSPTKDKT-PLKL----------------------------------IRPN--FKKN-- 233

Query: 223 PTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIF 282
                      NS++ I+NL++ ++   +E    L  G  +R      M  ++SRS+ + 
Sbjct: 234 -----------NSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVI 277

Query: 283 TIMLYRK-CNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL 341
            I L +     +  + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN L
Sbjct: 278 KINLEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLL 337

Query: 342 ADKNAHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTL 389
           A+     P+ +           S L  ++   +GGN KT  I+TISP   N  ET  TL
Sbjct: 338 AETGTS-PYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 119/550 (21%), Positives = 212/550 (38%), Gaps = 148/550 (26%)

Query: 45  NTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTST 104
           NT     IT   +   +  ++V+      + I K ++E + +D   GY+ +++ YG   +
Sbjct: 71  NTIIHYPITNFADESIFNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGS 130

Query: 105 GKTYTMTGDERLYDGELSEG--AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKD 162
           GK++T      L+  E S+G  A     ++ K  +     N    I+ S +E+  E++ D
Sbjct: 131 GKSFT------LFGNEDSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYD 184

Query: 163 LLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPNTMYKPSRS 222
           +L    D                            + P  S   TK+             
Sbjct: 185 MLHSADD----------------------------RKPLKSHHETKKF------------ 204

Query: 223 PTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIF 282
                         ++ Q     +I   KE  R+++    +++ +  KM+   S SH + 
Sbjct: 205 -------------GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVI 251

Query: 283 TIMLYRKCNGESF-RV------SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 335
                 +C+ E   RV      S +   DL GS    +   Q    +    +N S+  L 
Sbjct: 252 ------RCSVEQLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLE 305

Query: 336 RVINSL---ADKN-----------------AHIPFRESKLTRLLQDSLGGNTKTALIATI 375
            V+NS+     KN                   +P+++S+LT L+Q++LGGN++T ++   
Sbjct: 306 SVVNSVLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNC 365

Query: 376 SPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKD 435
              K + EET +TL +  + +NI N      F+  DV   N    L     DLL     D
Sbjct: 366 FDDKSHHEETIATLRFGVQLQNILN------FVRADVTGLNSKKTL-----DLLI----D 410

Query: 436 GIYMSQENYKE----LTNELENYKTEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRL 491
            + + + NY +    L +EL      V++ K   E L T+         I  + +E ++L
Sbjct: 411 NMKVIENNYDQKITLLESELNKLADTVKKAK-VTEELETE---------IVEKNDEIKKL 460

Query: 492 K-----IKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQGHRFQ 546
           +     + +L NNID          K  ++   ++Q LM    ++            + Q
Sbjct: 461 REQLETMTQLFNNID---------PKESEDTKKIIQTLMEKCESVA-----------QLQ 500

Query: 547 TEMERVLYEN 556
            E+E  L+EN
Sbjct: 501 LELEGQLHEN 510

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 13/121 (10%)

Query: 60  TYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDG 119
           T+  D+VF  +A Q  +   +  P  +D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQY---- 129

Query: 120 ELSEGAGIIPRVLFKLFDALDAHND----DYMIKCSFIELYNEELKDLLDETPDSSMPRK 175
                 G++P +   LF+ L+ + +    ++ +     E+Y E+  DLL   P+   P K
Sbjct: 130 ----NEGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLLVPLPERK-PLK 184

Query: 176 L 176
           L
Sbjct: 185 L 185

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 98/213 (46%), Gaps = 44/213 (20%)

Query: 276 SRSHTIFTIMLYRKCNGES-FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           S+SH +F + + ++   E   + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 335 GRVINSLADKN---------AHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKINSEE 384
             ++  LA KN         +H   +RES+LT +L+DSLGGN K  +I T   + + +  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 385 TSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLA--TKSKDGIYMSQE 442
           T STLE+    + I NK           ++ + T   +K + DL     K KD  Y+SQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 443 N--------YKELTNE----------LENYKTE 457
           N         K+L+NE          LENY+ E
Sbjct: 400 NILKSELDSLKDLSNESSSREDMKTELENYEKE 432

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 127/326 (38%), Gaps = 99/326 (30%)

Query: 82  EPLFQDFI----KGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEGAGIIPRVLFKLFD 137
           EPL  D I    +G +C+++ YG ++TGKT+ +    R          GIIP  + +L+ 
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQVR----------GIIPLFIEQLYI 115

Query: 138 ALDAHND-DYMIKCSFIELYNE-ELKDLLDETPDSSMPRKLRIFDSVTXXXXXXXXXXXX 195
            L+A +D  Y I  S  E  ++ +++DLL    D    + L+ +DS              
Sbjct: 116 YLEAQSDLQYQIGLSVWEADSKGKIRDLLVPLNDPQQQKSLK-WDSTI------------ 162

Query: 196 XXKPPEGSTSGTKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIR 255
                 G+  G K       ++  SR       L   LN+A  +QN              
Sbjct: 163 ------GAVKGLKE------VFVSSRCE-----LQDYLNAACDLQN-------------- 191

Query: 256 LLQRGLRHRQVASTKMNDVSSRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRS 314
                               S  HT   I L    C+ +SFR   +  VDL   E++   
Sbjct: 192 --------------------STFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL-- 229

Query: 315 GAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIAT 374
                         Q + +L  V+++  D +  I   +S+  +LL +S+GGN KT  I  
Sbjct: 230 --------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNRKTTFILA 273

Query: 375 ISPAKINSEETSSTLEYATKAKNIKN 400
            S  + N + +  TLE+  K   + N
Sbjct: 274 CSTLEQNEKISLETLEFGLKVSQVVN 299

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 69/127 (54%), Gaps = 11/127 (8%)

Query: 59  KTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118
           +T+++D+VF PSA Q  +  V+  P+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 119 GELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSF--IELYNEELKDLLDE-TPDSSMPRK 175
                  G++ R+L K+F  ++  N+   ++ S   +EL N+++ DLL++ +P       
Sbjct: 100 -----SQGLLQRILTKVFQLMN-ENEGVTVQYSLSAVELVNDKVYDLLNKRSPLGQNKNH 153

Query: 176 LRIFDSV 182
           L+ F +V
Sbjct: 154 LKGFKAV 160

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 107/245 (43%), Gaps = 36/245 (14%)

Query: 239 IQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRV- 297
           I+N++   I+D  E   L+      R + S   N +  RS TI  I L +    E     
Sbjct: 231 IKNVKSVTILDRNELNDLIDSS--RRLLHSCHNNGI--RSSTILRIKLLQLDEDEDLETQ 286

Query: 298 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK-----NAHIPFRE 352
           S +  VDLAGS+  S+   +    + A   N+ + +L  ++ +LA+      N  I +R 
Sbjct: 287 STICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLNSMVYTLANSESISINKSI-YRN 345

Query: 353 SKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDV 412
           S LTR+L D L GN KT LI + S  K +  ET STL +++ A ++ N+           
Sbjct: 346 SHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGFSSYASSMSNQ----------- 394

Query: 413 LVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQN 472
                    +KI    +    K  I     N  E     E Y+  ++  K  +  +S QN
Sbjct: 395 ---------IKINQTAIGGDKKRAILTDDWNLME-----EYYRNRIELLKDELHEVSMQN 440

Query: 473 GLLTK 477
            ++T+
Sbjct: 441 VMMTR 445

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%)

Query: 58  SKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           S  Y  D++F P      I   ++     D  KGYN T + YG T TGKTYT+ G
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG 109

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 78/375 (20%), Positives = 155/375 (41%), Gaps = 88/375 (23%)

Query: 53  TAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 112
           T +++S+ +  D +F  +++Q  +  V      +D   GYN + + YG +++GK+ T+  
Sbjct: 61  TLKLDSQDFKFDNIFPTNSEQNEMLTV---STIKDLFDGYNQSFITYGKSNSGKSDTL-- 115

Query: 113 DERLYDGELSEGAGIIPRVLF-KLFDALDAHNDD--------------YMIKCSFIELYN 157
                    +E  G+I R+LF +LF  + +   D              +    S +E+++
Sbjct: 116 --------FNEKDGLI-RLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFS 166

Query: 158 -EELKDLL--DETPDSSMPRKLRIFDSVTXXXXXXXXXXXXXXKPPEGSTSGTKRRIRPN 214
            E++ DLL  + T D+ + + L++                      E    G K      
Sbjct: 167 SEKIYDLLSNEYTKDNPILKSLKVHQHDII----------------ENGIKGDK------ 204

Query: 215 TMYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDV 274
                                  H++NL    I    +  +  + G +            
Sbjct: 205 -----------------------HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAK 241

Query: 275 SSRSHTIFTIMLY-RKCNGES--FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSL 331
             RS++I    ++  + N +   +++S ++ +DL G +  ++   Q     E   +N  +
Sbjct: 242 EKRSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTLM 300

Query: 332 LTLGRVINSLADKNAHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKINSEET 385
            +   +I +L+D  + +P+     ++S L ++LQD +GGN+KT  I    SP+ I  EE 
Sbjct: 301 SSFQNLITTLSDPKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEEL 359

Query: 386 SSTLEYATKAKNIKN 400
              L++A   K+IKN
Sbjct: 360 IEMLKFAMGLKSIKN 374

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 124/281 (44%), Gaps = 41/281 (14%)

Query: 238 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHT---IFTIMLYRKC---N 291
           HI++L + H+    E    L+ G +          ++S   H+   IF +    +C    
Sbjct: 198 HIRDLHQIHVTSPIEIKDTLKNGYK----------NISPLHHSKSQIF-VRFEVQCIDRK 246

Query: 292 GESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----NAH 347
            +  R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    ++H
Sbjct: 247 DDVTRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH 306

Query: 348 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 407
             F++S L ++L D LGG+TK  L+  I     N+      ++   KAK IKN P +   
Sbjct: 307 --FKDSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKI 361

Query: 408 IMK-----DVLVKNVTAE----LVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEV 458
            +      D+LV+++  +    L KI  +LL T+ K     +       +N LEN   E 
Sbjct: 362 GLNAKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQEN 419

Query: 459 QECKRAIERLSTQNG---LLTKEKRITNEVNESQRLKIKKL 496
            + K  +E L    G   L        NE+NE   L +KKL
Sbjct: 420 SKLKLQLESLQQILGTMSLANPSSSNKNEMNEHDEL-LKKL 459

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 6/109 (5%)

Query: 56  INSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDER 115
           +++  Y  D +F   + +   +  I + L  D  KGYN T++ YG TS+GK++ + GD  
Sbjct: 81  VSNNEYQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD 140

Query: 116 LYDGELSEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLL 164
                 S   G+I  +  +L       N   +   S  ELY +++ DLL
Sbjct: 141 ------STNDGLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLL 183

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 12/108 (11%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           +  ++V+     Q  + + I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD----YMIKCSFIELYNEELKDLL 164
                GI+ R+   +FD LD  ++D      I  +F EL+ E + DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 116/248 (46%), Gaps = 46/248 (18%)

Query: 276 SRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 334
           SRS     I +  R    E+ + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 335 GRVINSLAD-----------KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSE 383
            +V+  L++           K+ H   R S+L + LQ ++GG++KT  +   S  K + E
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTH---RTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRE 340

Query: 384 ETSSTLEYATKAKNIKNKP-----QVGSFIMKDVLVKNVTAE----LVKIR------SDL 428
            T  TL   ++ ++I N P      + S  + D+ +KN++      L +I+      S L
Sbjct: 341 NTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTREDSYLTRIKYLEDEVSKL 400

Query: 429 LAT--KSKDGI----YMSQENYKELTNELENYKTEVQECKRAIER---LSTQNGLLTKEK 479
             T  ++K+ +     ++++N K L ++LE Y+   Q  K   E     S QNG      
Sbjct: 401 GGTIQQNKNQVSTNKSLTEKNMK-LMDQLELYRKSQQTQKSGSEEENLTSQQNG------ 453

Query: 480 RITNEVNE 487
           RI NE++E
Sbjct: 454 RIQNEMSE 461

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 11/106 (10%)

Query: 61  YTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGE 120
           Y  D V   S +   ++  I   L  +  +GY+  V+ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 121 LSEGAGIIPRVLFKLFDALDAHNDD--YMIKCSFIELYNEELKDLL 164
                G++   +  L+D +D+  +D  + +  S IE++ E++ DLL
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 95/199 (47%), Gaps = 22/199 (11%)

Query: 276 SRSHTIFTIML-YRKCNGESFRVSKMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLL 332
           S+SH I  I +  R  N +  +   ++  DLA  + I +    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 333 TLGRVINSLAD----KNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSST 388
           TL   I S+++     NA IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 389 LEYATKAKNIK-----NKPQVGSFIMKDVLVKNVTAE----LVKIRSDLLATKSKDGIYM 439
           L+   K ++I      NK  + S    D++V+++ ++    + +IR  LL T+  D    
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDMKSKEANYMNRIR--LLETELND---- 392

Query: 440 SQENYKELTNELENYKTEV 458
            + +Y E  +E  ++K E+
Sbjct: 393 LRASYGEAISETSSFKEEM 411

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 40  NEVSINTTGDTGITAQINSKTYTVDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVY 99
           N   + T  DT +  ++  ++++  +V    A +   F  +A  +  D + G NC V  Y
Sbjct: 71  NSNHVQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTY 128

Query: 100 GMTSTGKTYTMTGDERLYDGE---LSEGAGIIPRVLFKLFDALDAHN-DDYMIKCSFIEL 155
           G      +  M G +     E    S  +G++ +    +F+A+D+ +  +Y +  S  E+
Sbjct: 129 GSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEV 188

Query: 156 YNEELKDLL 164
           Y +++ DLL
Sbjct: 189 YVDKVFDLL 197

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query: 248 MDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRV---------S 298
           +D  + I LL    ++  V S  +N +   S T   + L +      F           S
Sbjct: 368 IDIDDAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNS 427

Query: 299 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI---PFRESKL 355
           +  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L      I   P  E  +
Sbjct: 428 EFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFLI 484

Query: 356 TRLLQDSLGGN 366
            R L++S  GN
Sbjct: 485 RRALKNSRLGN 495

>TPHA0A04870 Chr1 complement(1102393..1103298) [906 bp, 301 aa] {ON}
           Anc_5.131 YJR021C
          Length = 301

 Score = 36.2 bits (82), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 84/170 (49%), Gaps = 15/170 (8%)

Query: 512 KNEQELSNVVQELMRALRTMQNSLKVYEDQG-----HRFQTEMERVLYENIGSFKHSLLN 566
           +N   L +V+++L + L+ +++  +   D+       +   ++E+ + +N+G    +  N
Sbjct: 69  RNSDRLYSVMEQLNKNLKNIEHQSQTPADKDIDSEMLKILAKIEKTINDNLGKSNTTQGN 128

Query: 567 EIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQ---TPTYLQ 623
              + +    D F++  NID++ K  N I  + + S ++  R    KITE        + 
Sbjct: 129 RASRKRTRGSDDFELHNNIDSIVK--NSIEKY-SKSIVKPVRDNQTKITESLNFMNGMIF 185

Query: 624 DIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDA 673
           +  NQ+ES+  ++G+ SS    +L SI++   HL++  ++    N+  +A
Sbjct: 186 NFNNQLESVNKILGNMSS----NLKSINDRQVHLENMFSQQKIANDDTNA 231

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 107/227 (47%), Gaps = 42/227 (18%)

Query: 465 IERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQE--LSNV-- 520
           ++ LST N    K + ++ E+  S +  I+++ +NID L + I R+H   +E  LSN+  
Sbjct: 684 LDSLSTLNESTAKHRELSLELT-SIKQAIQEVDSNIDTLNNSI-RKHNTNRESLLSNIEG 741

Query: 521 --------------VQELMRAL--RTMQNSLKV----------YEDQGHRFQTEMERVLY 554
                         ++E ++AL  +T +N + +           +D    F +E+  V  
Sbjct: 742 MKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADKKETYVKDMSSEFNSELSLVEK 801

Query: 555 ENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKI 614
           E +     SLL   +KL  T E       N++T+T E+N +   +N+      +  ++++
Sbjct: 802 EELEVTSISLLEIEKKLTLTTE-------NLETVTSEMNSLNAELNSKLFPQKQDILSQM 854

Query: 615 TEQTPTYLQDIRNQVESIT---HVVGSYSSDLMMHLSSISEEYNHLK 658
           +++  +YL  +R  V+S+T     V +  +  + H+ +I +E   LK
Sbjct: 855 SQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLK 901

>SAKL0H10956g Chr8 complement(947455..948789) [1335 bp, 444 aa] {ON}
           similar to uniprot|P27809 Saccharomyces cerevisiae
           YDR483W KRE2 Alpha1 2-mannosyltransferase of the Golgi
           involved in protein mannosylation
          Length = 444

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 63/139 (45%), Gaps = 21/139 (15%)

Query: 554 YENIGSFKHSLLNEIEKLKGTEED---GFDVDANIDTLTKELNRIYDFINT-----STIE 605
           YE+   ++H LL+E +     E D     D+D ++    ++ N++Y F  +     STI+
Sbjct: 228 YESGFFWRHPLLDEFDWYWRVEPDIKLYCDIDYDVFKWMQDNNKVYGFTISIHEYESTIK 287

Query: 606 ICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSI---------SEEYNH 656
              K   + TEQ P Y+ +  N ++ I++  G  S +L    S+          S  Y  
Sbjct: 288 TLWKTTKEFTEQHPEYIHE-NNMMDFISNDGGK-SYNLCHFWSNFEVASLEFWRSTAYRE 345

Query: 657 LKDYLNEH--FFKNNFQDA 673
             DYL++   FF   + DA
Sbjct: 346 YFDYLDKAGGFFYERWGDA 364

>KLTH0E13002g Chr5 complement(1149687..1152158) [2472 bp, 823 aa]
           {ON} similar to uniprot|P48582 Saccharomyces cerevisiae
           YPL084W BRO1 Cytoplasmic class E vacuolar protein
           sorting (VPS) factor that coordinates deubiquitination
           in the multivesicular body (MVB) pathway by recruiting
           Doa4p to endosomes
          Length = 823

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 96/191 (50%), Gaps = 20/191 (10%)

Query: 422 VKIRSDLLA-TKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLL----T 476
           VK++S L+A +KS + ++   E Y+   N L N  T +++  +     S +  LL    +
Sbjct: 489 VKLKSSLVAASKSDEKLFSFVEPYRHEINLLRNSNTLIKKWDQLSSFQSQEPSLLDLDDS 548

Query: 477 KEKRITNEVN--ESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534
           K + I +++     Q  K+K L +    +   + R   NE +++NV+  +M+   +  N 
Sbjct: 549 KNEEILSKIGYISEQHEKLKVLKDERSRIVQDLKRD-VNEDDITNVI--IMKRGASDANL 605

Query: 535 LKVYEDQGHRFQ---TEMERVLYEN---IGSFKHSLLNEIEKLKGTEEDGFDVDANI--- 585
            +++E +  +F+   T +E  +++    I + K SL +E+ KL G  ED  + D N    
Sbjct: 606 KQLFEKELEKFKPLSTRIEATIFKQSSIINAIKISL-DELFKLTGVNEDASENDPNSLER 664

Query: 586 DTLTKELNRIY 596
           + L K+LN+ +
Sbjct: 665 NELYKKLNQAF 675

>KAFR0F04110 Chr6 complement(802711..804972) [2262 bp, 753 aa] {ON}
           Anc_3.514 YGL205W
          Length = 753

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%)

Query: 558 GSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDF 598
           G   H+  NE+ K    E+DG  V    +TLTK LNR Y+F
Sbjct: 696 GDIYHNYFNEVLKNNPPEKDGPGVPPYYETLTKMLNRGYEF 736

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
           YBL047C
          Length = 1414

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 98/229 (42%), Gaps = 65/229 (28%)

Query: 409 MKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERL 468
           +K++ V+ +  EL    SDL   + K  IY+ ++       EL++YKT+V++    +E  
Sbjct: 727 LKEINVETLNTEL----SDL---QEKIDIYLKKQK------ELDDYKTQVEQQHAQLE-- 771

Query: 469 STQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRAL 528
           ST   L TK    TNE+NE Q               +++D Q+KN  E  NV ++ +  L
Sbjct: 772 STYQQLATK----TNELNERQ---------------NELDLQNKNIVEQENVYKQNVERL 812

Query: 529 RTMQNSLK---------------VYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKG 573
            +M + LK                + D   R Q   E+ +  ++G    +    I++ K 
Sbjct: 813 DSMFDELKKRKESFDQSNAELHQQHIDYAQRVQDLSEKKMQLSMGELPPNAKEIIDQYKP 872

Query: 574 ----------TEEDGFDVDA------NIDTLTKELNRIYDFINTSTIEI 606
                     +E +  D++A      N  TL K LN   D IN  + EI
Sbjct: 873 DMTSTTTNLTSELNSLDINASPANPTNDSTLNKSLNSNIDNINEKSREI 921

>Ecym_8277 Chr8 (559750..562704) [2955 bp, 984 aa] {ON} similar to
           Ashbya gossypii AAL171W
          Length = 984

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 508 DRQHKNEQELSNVVQELMRALRTMQNSLKVYED--QGH---RFQTEMERVLYENIGSFKH 562
           D  H     +   + ELMR LR  +N  + +E   QGH    +    +R LY+N    K+
Sbjct: 38  DVYHSTGSLIHKSIHELMRDLRLSKNIGRYFEPSLQGHAGPEYIYWDDRFLYDNTNMLKN 97

Query: 563 SLLNEIEKLKGTEEDGF 579
            +++ I   +G EE+ F
Sbjct: 98  DIVSPIFDAEGDEENSF 114

>NCAS0B00720 Chr2 (105858..109676) [3819 bp, 1272 aa] {ON} Anc_8.765
           YOR296W
          Length = 1272

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%)

Query: 696 LREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFE 755
           LR + NE   T  +I+ +SLK+   E +  +  +   V   ++S  +NI    ++  G E
Sbjct: 633 LRRLCNEATLTEDKIIKKSLKDEKWESIHDDARISFSVTDIFKSINQNIKMFQEIEWGDE 692

Query: 756 KDIGSVVRDVFEKINEGLQFSESAVGD 782
             I  V+  +     +GLQF    V D
Sbjct: 693 YQIAKVLTKLLNSFLDGLQFYSKFVLD 719

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1227

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 106/240 (44%), Gaps = 25/240 (10%)

Query: 423 KIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLS-TQNGLLTKEKRI 481
           K R DLL  K KD    S+  YK L +ELE  + ++Q+   +I+ ++ T   L  K + I
Sbjct: 679 KTRLDLLK-KLKD----SRSQYKSLVSELELMRQKIQDIDASIDTVNGTTRSLSNKRETI 733

Query: 482 TNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVY-ED 540
              ++ S R K+        FL + +       Q L    ++    +R  +  +  Y E+
Sbjct: 734 LTNMD-SWRAKLNNKKTEKIFLEESM-------QALIVKAEKTETNIRVSEEKISTYLEE 785

Query: 541 QGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEEDGFDVDANIDTLTKELNRIYDFIN 600
               F  E+ R     + + K S+L+   KL  T E    +  NID+L   L       N
Sbjct: 786 LSQDFDNELSRAKQAELENLKSSILDIQNKLYMTSEALEGLTNNIDSLNATL-------N 838

Query: 601 TSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMM---HLSSISEEYNHL 657
           +  I   ++   K+ E   +++  ++++V+S+  V  +  + L +    LS I EE  ++
Sbjct: 839 SKLIPQQKELKAKLAETGDSFIAGLKSEVQSMLIVKTTLDNQLEISNEELSGIQEEIKNM 898

>TBLA0I02180 Chr9 (505818..506138) [321 bp, 106 aa] {ON} Anc_3.313
           YBL028C
          Length = 106

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 560 FKHSLLNE-IEKLKGTEEDGFDVDANIDTLTKELNRI-YDFINTSTIEICRKFMNKITEQ 617
            K  L+++ +++LK    DG +V+ N+D L KE  ++ Y  I TS     +   NK+  +
Sbjct: 37  LKQDLIDQKLKELKSKNPDGMEVEINVDDLKKEETKVDYSKIKTSGWRASQYKKNKMARK 96

Query: 618 T 618
           T
Sbjct: 97  T 97

>Kwal_26.8400 s26 complement(766497..767216) [720 bp, 239 aa] {ON}
           YNL100W - Hypothetical ORF [contig 60] FULL
          Length = 239

 Score = 31.2 bits (69), Expect = 9.2,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 620 TYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQD 672
           T+   IRN   S+ H    Y ++L    S+ + E+ + +DY+++H   +++++
Sbjct: 49  TWFGGIRN---SVVHKYNIYKTELETQKSAATNEWKNARDYVSQHILTDSYEE 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,547,031
Number of extensions: 4225000
Number of successful extensions: 18009
Number of sequences better than 10.0: 931
Number of HSP's gapped: 18111
Number of HSP's successfully gapped: 1407
Length of query: 941
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 822
Effective length of database: 39,836,145
Effective search space: 32745311190
Effective search space used: 32745311190
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)