Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11308g6.17ON69069034940.0
Kwal_56.224116.17ON68969023890.0
SAKL0E01100g6.17ON71071217880.0
Ecym_30216.17ON67469215860.0
ACR009W6.17ON68070215350.0
TDEL0G045206.17ON67970314650.0
ZYRO0C07876g6.17ON68170314180.0
KLLA0D01067g6.17ON66070013940.0
Kpol_1045.726.17ON69571913361e-175
Suva_5.56.17ON61970012531e-164
TPHA0J003106.17ON67572012201e-158
Skud_5.276.17ON61555012051e-157
YEL062W (NPR2)6.17ON61555011881e-154
Smik_5.256.17ON61550911781e-153
KNAG0M011406.17ON59469711701e-152
TBLA0G010106.17ON71074811731e-151
NCAS0H008706.17ON61269811181e-144
CAGL0L13288g6.17ON64672611121e-142
KAFR0L003806.17ON54069110531e-135
NDAI0D008606.17ON6665056553e-75
ZYRO0A13530gsingletonON58250800.58
KLTH0E11330g8.486ON19997760.78
NDAI0H006305.652ON34547742.1
NCAS0C008708.762ON66777733.3
TBLA0B093702.349ON1776178724.8
YBR208C (DUR1,2)8.520ON183576725.3
Ecym_11848.520ON183775725.9
TPHA0I002508.840ON62950708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11308g
         (690 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...  1350   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   924   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   693   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   615   0.0  
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   595   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   568   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   550   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   541   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   519   e-175
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    487   e-164
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   474   e-158
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   468   e-157
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   462   e-154
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   458   e-153
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   455   e-152
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   456   e-151
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   435   e-144
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   432   e-142
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   410   e-135
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   256   3e-75
ZYRO0A13530g Chr1 complement(1072812..1074560) [1749 bp, 582 aa]...    35   0.58 
KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa] ...    34   0.78 
NDAI0H00630 Chr8 (146568..147605) [1038 bp, 345 aa] {ON} Anc_5.652     33   2.1  
NCAS0C00870 Chr3 complement(151523..153526) [2004 bp, 667 aa] {O...    33   3.3  
TBLA0B09370 Chr2 (2225321..2230651) [5331 bp, 1776 aa] {ON} Anc_...    32   4.8  
YBR208C Chr2 complement(636703..642210) [5508 bp, 1835 aa] {ON} ...    32   5.3  
Ecym_1184 Chr1 complement(374705..380218) [5514 bp, 1837 aa] {ON...    32   5.9  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    32   8.5  

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score = 1350 bits (3494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/690 (96%), Positives = 667/690 (96%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIED 240
           ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIK          CFSIED
Sbjct: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIED 240

Query: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300
           VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV
Sbjct: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300

Query: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360
           ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI
Sbjct: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360

Query: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNS 420
           RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNS
Sbjct: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNS 420

Query: 421 DAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGL 480
           DAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGL
Sbjct: 421 DAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGL 480

Query: 481 IYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAG 540
           IYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAG
Sbjct: 481 IYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAG 540

Query: 541 FKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDIS 600
           FKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDIS
Sbjct: 541 FKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDIS 600

Query: 601 TRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVHN 660
           TRESANSMGSDIKNKVAFDVRKTLATSSAD             KRNEELILLKSVRSVHN
Sbjct: 601 TRESANSMGSDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHN 660

Query: 661 FDKICTLLGKDRERVESMLSELGPYNVLHS 690
           FDKICTLLGKDRERVESMLSELGPYNVLHS
Sbjct: 661 FDKICTLLGKDRERVESMLSELGPYNVLHS 690

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/690 (65%), Positives = 544/690 (78%), Gaps = 3/690 (0%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           MSGHFDGFVPVH I Y++FHPTEGTKVRHQFP GCLE SDITFDTIKNYVIPKPQLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LTFKYG FRLVCYPVNV+APYYARNSFSFDFVFVFPYDCATSPYE AI RLGKMFTVLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           QSQILSKAENS VYFQLK R++ KH N E     E   +L   E +Q E+ GYA  KY+E
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIED 240
           ILKDL GP+K+I++ DLITKIYRDLN+YSECLIPIDSGNAVDIK          C S ED
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300
           VP+ TVNLAKLIDVNWDPTMLKIVP+ING NSIAKVAK SDSD NLVVECI+HL+YYNCV
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360
           IL DIFQF NIYA T+ELSRFLT P LA ECQIYV  +ES H+ +LPFER PSR+   NI
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNNI 360

Query: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNS 420
             R+S+ TLD+ RKG++  ++E+SF +G+D  S ++Q+TPQS +SSI  HN SDAS GNS
Sbjct: 361 PVRNSSSTLDVQRKGREMSIKESSFTAGID-QSGRNQYTPQSHTSSIQCHNVSDASLGNS 419

Query: 421 DAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGL 480
           + G   K+  FTSKSCLFD+YRSL+QGQT++EWYKTHFEKIRAARIDVRRFITFGV+HGL
Sbjct: 420 EGGFNNKVF-FTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGL 478

Query: 481 IYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAG 540
           +YR YS+P+++N+G+ E V+ALG ++     + K L   ++P NNVLSAA+IRIGLE++ 
Sbjct: 479 LYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSS 538

Query: 541 FKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDST-DI 599
            K R  +    S AD AE++L+DVYRKLAL++ K +  +Q  NP+ ++FG  S+DS+ + 
Sbjct: 539 SKLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGET 598

Query: 600 STRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVH 659
           S ++  ++ GSD +N VAFDVR+ + +++A+             KR +EL+LLKSVR V 
Sbjct: 599 SVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVE 658

Query: 660 NFDKICTLLGKDRERVESMLSELGPYNVLH 689
           NFDKICT LG+DRE VE ML +LGPYNV+H
Sbjct: 659 NFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/712 (52%), Positives = 488/712 (68%), Gaps = 24/712 (3%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H +FYSVFHPTEGTKVR+QFP   LE +DI FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LTFKYGP+RL CYPVNV A YYARNSF+F+FVFVFPY+CATSPYEPA+ RLGKMF VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQK--------HGNTETAKGTEQPSSL----DIGEIAQP 168
           QSQILSKAEN  VYF LK++ +           G ++  K TEQ + L    D  E  + 
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 169 ENQGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXX 228
           E QG A  KY+EI+ DLE   K+++I DLITK+Y+DLN+YSEC IPIDSGN+VDIK    
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 229 XXXXXXCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVV 288
                 C S EDVPISTVNLAKLIDVNWDPTMLKIVP ING+NSIAK+AKFS SD +LV+
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 289 ECIKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPF 348
           EC+KHLIYYNCV+L DIFQFSNIYAST+ +S FLT+PTLA+ECQ YV  ++   L  LPF
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSD-LELYRLPF 359

Query: 349 ERGPSRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIP 408
           E  P+     + R ++S+ T+  +   + +P R NS +   +  + ++  +  S SS + 
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTV-GVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMR 418

Query: 409 YHNTSDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDV 468
             + S  S   S    +   +   +KSCLFDLYRSL QG+T++EWYK +FE IR   IDV
Sbjct: 419 VRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDV 478

Query: 469 RRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPL-NNVL 527
           RRFITFG++ GLIYR Y+YPV++N+G  E ++ L + + SR  + K   +  +   NNV 
Sbjct: 479 RRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNVF 538

Query: 528 SAADIRIGLENAGFKARSEKL--KQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPI 585
           S ADI++ LE++   A +E    K  S  D AEEVL D Y+KL++ +   D++   +NP+
Sbjct: 539 STADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMDDNLYHVHNPM 598

Query: 586 SKVFGRNSEDSTDISTRE-----SANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXX 640
           S+++G +S +S+   +R+     S+++M S+ ++KVAF+  ++      D          
Sbjct: 599 SRLYGHDSGESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVS 658

Query: 641 X--XXKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
                KR+EE +LLKSV+SV  FDKIC  L KDRE VE +L E+G YN+++S
Sbjct: 659 NLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/692 (48%), Positives = 459/692 (66%), Gaps = 20/692 (2%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           MS HFDGFVP+H IFYS+FHPTEGTKVR QFP   LE S I+FDTIKNYVIPKPQLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LTFKYG +RLVCYPVN+ A YYARNSFSFDFVFVFPYD ATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQK-HGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYY 179
           QSQ+LSK E   +Y+ LK ++ +    N+E  +    P   +  +  +  +  +A  KY+
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQ--NCNDKIRRGHHEHAFEKYH 178

Query: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIE 239
           EI+K +    K+++I DLITK+Y DLN+YSECLIP+DSGNA+DIK          CFS+E
Sbjct: 179 EIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVE 238

Query: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299
           DVPI+ +NL   +DVNWDPTM+KIVP+INGINSIAK++K+SDSDV LV+EC+KHLIYY+C
Sbjct: 239 DVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDC 298

Query: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359
           V+L D+FQFSNIYA T++LS FLT+P++A ECQ+YV  +E + L  LPFE  P+ +   N
Sbjct: 299 VVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRN 358

Query: 360 IRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGN 419
               +S  T   L++   T  R  SF+S  +F    + +T      SI  H++ ++ F +
Sbjct: 359 --PTASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSIT-HSSKNSEFNH 415

Query: 420 -SDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLH 478
            ++ G+  + +P  ++SCLFDLYRSL+QGQT+++WYK +FE IR  RIDVRRFITFGV  
Sbjct: 416 ENNKGILNRTLP--TRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFR 473

Query: 479 GLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLEN 538
            LIYR YSYPV ++IG   +++ L   +++       +   N   NNV S ADI +    
Sbjct: 474 KLIYRCYSYPVAKSIG---TLDMLKRFDYASLPN-NFMSPKNNNSNNVFSTADICVDF-- 527

Query: 539 AGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTD 598
            G  ++  K       DAA+EVL D Y+KL+L+++  + + Q     SK     ++ S +
Sbjct: 528 -GEPSQFRKKPLVPNTDAADEVLRDAYKKLSLNERLPNPLDQITR--SKKLSLENDASAN 584

Query: 599 ISTRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSV 658
           +  R+ ++S       KV FD++  L+    +             KR ++ +LLKS+++V
Sbjct: 585 VDNRKLSSSTSGTA--KVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNV 642

Query: 659 HNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
            +FDKI   L  +++ VE +L   G YN+++S
Sbjct: 643 DSFDKIAIKLEINKQEVEELLKATGEYNIINS 674

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/702 (47%), Positives = 437/702 (62%), Gaps = 41/702 (5%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M   FDGFVP+H IFY++FHPTEGTKVR QFPS  LE S I FDTIKNYVIPK QLCNKL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFK+G +RLVCYPVN+ APYYARNSFSF+ VFVFPYD ATSPYEPAI RL KM  VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQILSKAENSSVYFQLKARNTQK-HGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYY 179
           QSQ+LSK E   VY+QLK   T+     TE +    +  +LD    AQ      A+ KY+
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHN----ATTKYH 183

Query: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIE 239
           EI+K +    K + I DLITK+Y DLN+YSECLIP+DSGNA+DIK          C S E
Sbjct: 184 EIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFE 243

Query: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299
           DVPI+ VNL  L+DVNWDPTMLKIVP INGINSIAK++K SDS V LV+ECIKHL+YY+C
Sbjct: 244 DVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDC 303

Query: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359
           V L D+FQFSNIYA TN L  FL +  L  ECQ+YV  +E   +  LPFE   SR   G+
Sbjct: 304 VALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFE---SRPNGGH 360

Query: 360 IRDRS-SNGTLDILRKGKQTPLRENSFNSGMDF------LSNKHQHTPQSRSSSIPYHNT 412
            R+++ S  T+  LR+   T  R +SF+S  +F      +S+  Q   QS      Y+N 
Sbjct: 361 SRNQTASTNTVYTLRRTTSTN-RADSFSSNAEFSQKSSGISSLAQSFTQSNKDY--YYNR 417

Query: 413 SDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472
           S     N ++  K  L    ++  LFDLYRSLTQGQT++EWYK ++  IR  +IDVRR I
Sbjct: 418 S----RNLESNCKRTL---PTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470

Query: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPL-NNVLSAAD 531
            FGV H LIYR YSYPV ++IG  E ++     + +      + + T     NNV S +D
Sbjct: 471 IFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTT-----DNFIPTGTSAGNNVFSTSD 525

Query: 532 IRIGLENAGFKARSEKLKQH-STADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFG 590
           IR+  + +   +RS  +    +++D AEEVL + Y+KL++ D   D +    +PI+K + 
Sbjct: 526 IRVDFDGS---SRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSI----DPIAKGYQ 578

Query: 591 RNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXX--XXXXXKRNEE 648
             S++   +       SM +    ++ FD+R    +   +               KR +E
Sbjct: 579 APSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQE 638

Query: 649 LILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
            +LL+SV+SV +FDKI   L  ++  VE +L   G YN+++S
Sbjct: 639 FLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/703 (45%), Positives = 438/703 (62%), Gaps = 37/703 (5%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M   F+GF+P+H IFY+VFHPTEGTKVR++FP G LE  +I FD IKNY+IPKPQLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT KY  +R+  YPV V +P YARN FSF+FVFVFPYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           Q+ ILSKAE   +++  K    +   + + AK   +  S ++ +     +Q YAS KY++
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIK---DDQDAKSKPEKGSHNLSK-----SQAYASEKYHK 172

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIED 240
           I+ D+E      ++ DL+ ++Y+DLN+YSECLIPID GNAVDIK            SIED
Sbjct: 173 IMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIED 232

Query: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300
           VP+STVNL K+IDVNWDPTMLKIVP+ING+NSI+K+AK S SD  LV+ECIKHLIYYNCV
Sbjct: 233 VPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCV 292

Query: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360
           +L DIFQFSNIYA T+ L  FLT+  L+ ECQ YV   E + LP LPF+R    + +   
Sbjct: 293 LLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATES-- 350

Query: 361 RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPY----HNTSDAS 416
                +   D  R  + +  R  S +S   F  + +   P   S    Y    H+ S  S
Sbjct: 351 ---VDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFS 407

Query: 417 FGNSD-AGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFG 475
             N++ + +  + +P  +KSCLFDLYRSL+QG ++REWY  H+  IRA RIDVRRFITFG
Sbjct: 408 SNNTNPSNMLARYLP--TKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFG 465

Query: 476 VLHGLIYRSYSYPVLRNI---GFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADI 532
           V++GLIYR YSYP+++N+     A+ +     +NH+     KH  K   P  N+ S +DI
Sbjct: 466 VINGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHT----VKH-NKAKNPSKNIFSTSDI 520

Query: 533 RIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRN 592
           + G+E   ++ +  K  +    D A+EVL +VY+KL++++  TD      +PI++++   
Sbjct: 521 KFGVE---YERQRNKHHKALNLDIADEVLRNVYKKLSVTN-STDTRPNSADPIARLYRER 576

Query: 593 SEDS-TDISTRESANSMGSDIKNKVAFDVRKTLA----TSSADXXXXXXXXXXXXXKRNE 647
           S  S  D ST        SD  +KV+FD ++ +       S+              +R  
Sbjct: 577 SLGSLADGSTNNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRER 636

Query: 648 ELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
           +LILL+SV +  + D IC  L   R  VE+++  LG Y +++S
Sbjct: 637 DLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/703 (45%), Positives = 444/703 (63%), Gaps = 49/703 (6%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GFVP+H +FY+VFHPT+GT+VR+++P G LE ++I FD IKNY+IPKPQLC+KL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT KY  +R+VCYPV V +PYYARN FSF+FVFVFPYDC TS YEPAI RLGKMF VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQILSKAENSSVYFQLK-ARNTQKHGNTETAKGTEQPSSLDIGEIAQ--PENQGYASAK 177
           Q+QILSKAEN  +YF  K A NT           TEQ   L+  +  +   ++QG A AK
Sbjct: 135 QNQILSKAENDPIYFDFKLADNT-----------TEQDGKLNAEKSFKGLTKSQGMALAK 183

Query: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFS 237
           Y EI+KDLE      ++ DL+ +I++DLN+YSECLIPID GNAVDIK          C S
Sbjct: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243

Query: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297
           IEDVPISTVNL  +IDVNWDPTMLKIVP+I+G+NSI+K+AK SDSDV+LV+EC+KHL+YY
Sbjct: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303

Query: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357
           NCVIL DIFQFSNIYA T+ + +FLT+PTLA+ECQ +V     + L  +PFER   R   
Sbjct: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER--LRKFD 361

Query: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPY--HNTSDA 415
            +  D+S N         +++  R  S +S  D  S +       R+   PY  +  S +
Sbjct: 362 LDDMDQSKN---------QESGSRTTSMSSKSDSKSKRPFFYSAPRN---PYRFNQRSQS 409

Query: 416 SFGNSDAGLKGKLMP-FTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITF 474
           SF +++  +   L     +K+CLFDLYR+L+QG T+REWY  +++ I+   IDVRRFITF
Sbjct: 410 SFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITF 469

Query: 475 GVLHGLIYRSYSYPVLRNIGFAESVEAL-GATNHSRYAKYKHLLKTNQPLNNVLSAADIR 533
           GV+ GLIYR +S+PV++ +   +    L  A N ++  K     K       V S +D++
Sbjct: 470 GVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMK 529

Query: 534 IGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNS 593
           +G           K+ Q+ + D A+EVL +VY+KL+ +++     ++ + P+S+++   S
Sbjct: 530 LG--------EGSKMHQNFSVDIADEVLRNVYKKLSNTNEPG---SRDDYPLSRIYREES 578

Query: 594 EDS-TDISTRESANSMGSDIKNKVAFDVRKT-----LATSSADXXXXXXXXXXXXXKRNE 647
             S + +S    ++    +  +KVAFD+ K        +                 K N+
Sbjct: 579 HVSLSALSGDNVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQ 638

Query: 648 ELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
           ++ILL+S+ +    DKIC  L K R  VE +L ELG Y +++S
Sbjct: 639 KIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/700 (46%), Positives = 441/700 (63%), Gaps = 50/700 (7%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M+  FDGFVP+H +FY++FHPTEG+KVR QFP   LE   I FDTIKNY+IPKPQLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LTFKYG +R+VCYPVNV A YYARNSF+F+FVFVFPYDCATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           QSQILSK+E + VYFQLK+       ++  A  + +  S+ I E    ++ G    KY E
Sbjct: 121 QSQILSKSEQNPVYFQLKS------NDSNAADQSTEMGSITISEHTDIKSTGDDGEKYLE 174

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIED 240
           I+K+L    K + I DL+ K++ DLN+YSECLIPID GN++DIK            S+ED
Sbjct: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVED 234

Query: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300
           VPI+ VNL+ +IDVNWDPTM+KIVP+INGINS+A++A  + SDV LV ECIKHL+YYNCV
Sbjct: 235 VPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCV 294

Query: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNI 360
           IL+DIFQFSNIYA T+E+  FLT P +A  CQ++V   +S     LPFE  P+     NI
Sbjct: 295 ILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFVQ-GDSLKQSLLPFEGRPN-----NI 348

Query: 361 ----RDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDAS 416
               R ++S  T+   R+         S +S  D  ++++  +  S SS    H + + S
Sbjct: 349 YPTGRKQASTSTVHSRRRDSNDTATTGSTSSVRD--THRNYLSSSSTSSYFRAHASENTS 406

Query: 417 FGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGV 476
               +  +K +++P  ++SCLFDLY+SL+QG+T+++WYK +FE IR  RIDVR+ I FG+
Sbjct: 407 LATGENQMK-RILP--TRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGI 463

Query: 477 LHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGL 536
              LIYR  SYP+++N+G  + +++L     S+  K  +   +++   N+ SAADI++  
Sbjct: 464 TRRLIYRVNSYPIVKNVGTWDILKSLV----SKEPKTHYGSGSSK---NIFSAADIKV-- 514

Query: 537 ENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSED- 595
                    E+  Q    DAA+E+L  +Y+KL+L            N +SK F R  +D 
Sbjct: 515 -----VDTKEEGNQSDKLDAADELLKSLYQKLSLKQDVP-------NTMSK-FARYYDDS 561

Query: 596 -STDISTRESANSMGSDIKNKVAFDV----RKTLATSSADXXXXXXXXXXXXXKRNEELI 650
            S +  T  ++    S    KV+FD     ++   T   D             K  EELI
Sbjct: 562 PSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKTVTEVPDLGDGEKVEVWKKKKE-EELI 620

Query: 651 LLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
           LL+S+ +   FDK+CT L K R  VE +L +LG YN+++S
Sbjct: 621 LLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYNIVNS 660

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  519 bits (1336), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 308/719 (42%), Positives = 407/719 (56%), Gaps = 60/719 (8%)

Query: 5   FDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLTFK 64
           FDGF P+H IFYSVFHPTEG KV +QFP   L+   I FD+I++YVIPKPQLCNKLLT K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQSQI 124
           YG +R++ YP+ +    YARN+FSF+ VFVFPY+C TSPYE  I +LGKMF VLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKAENSSVYF--------------QLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPEN 170
           LSKAE    YF              +LK        N   +  +    S         +N
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 171 QGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXX 230
             Y   KY EI + +       +I D I ++Y+DLN+YSECLIPID+GNAVDIK      
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 231 XXXXCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVEC 290
                 SIEDVPIS VNL ++IDVNWDPTMLKIVPHI+G+NSIAK+AK SDSD  LV+EC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 291 IKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFER 350
           IKH IYY CV+++DIFQFSNIYA T+ L  FLT+P +A ECQ YV   ES+ L  LP E 
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 351 ------GPSRSGQGNIRDRSSNGTLD------ILRKGKQTPLRENSFNSGMDFLSNKHQH 398
                     S   N+R +S NG +D      +  +G  +    +S  S  D   N+H+ 
Sbjct: 364 LSKLKLDSDGSDSQNLR-KSKNG-IDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRS 421

Query: 399 TPQSRSSSIPYHNTSDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHF 458
                 SSI   NT+D         L G +    ++S LFDLYRSL+QG T++EWYK +F
Sbjct: 422 -----ESSISSQNTND---------LNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENF 467

Query: 459 EKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLK 518
            +IR   ID+R+FI FG+++GL+YR  S+PV  N      V+      + +  +   L K
Sbjct: 468 FEIRNNGIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQK 527

Query: 519 TNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHV 578
             Q   ++ S +DI++G +      R+ ++ Q    D A+ VL +VY+KL L   KT+  
Sbjct: 528 --QLSQDIFSTSDIKVGED--LISGRNRRI-QTLDLDIADSVLKNVYKKLTL---KTEEE 579

Query: 579 AQGNNPISKVFGRNSEDSTDISTRESANSMGSDIK-----NKVAFDVRKTL--ATSSADX 631
              N  ++    +  E  +  S  ES+N      K     +KV+F     +  + SS D 
Sbjct: 580 NSSNRALN---SQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDV 636

Query: 632 XXXXXXXXXXXXKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
                       ++  E ILL+++ S  N DKIC LL K R  VE ML  L  + V++S
Sbjct: 637 TENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  487 bits (1253), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 290/700 (41%), Positives = 395/700 (56%), Gaps = 91/700 (13%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFKYG +R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSS-------LDIGEIAQPENQG 172
           Q+Q+LSK+E   V+F LKA  N+    +T     T  PSS           +     +  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 173 YASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXX 232
           +   KY +I+KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK        
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 233 XXCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIK 292
             C S+EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++KFS SD +LV+ECI+
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 293 HLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGP 352
           HLIYY CV L+DIFQFSNIYA ++ +  FLT+P +A +CQ YV + E + L NLP  +  
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 353 SRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNT 412
               Q          +              +  ++     ++    +  S S       T
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 413 SDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472
           S +S        + + +P  ++SCLFDLYRSL+QGQT++ WY+  F  ++   ID+RRFI
Sbjct: 421 SCSSTNTHAISKRNQFLP--TRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFI 478

Query: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLN--NVLSAA 530
           TFG+   +IYR YS+PV+ ++G             SR  K    + T +P N  N L   
Sbjct: 479 TFGLERSIIYRCYSFPVMIHVG-------------SRDTKEMTPVATKEPSNEDNSLKKR 525

Query: 531 DIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFG 590
           D    L   G K+ ++             V S+   K++   ++ + +A G N I K+  
Sbjct: 526 DYNHSLSVTGSKSTTQT-----------NVKSERPSKVSFEMQRANSLATGKNKIPKL-- 572

Query: 591 RNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELI 650
                              SD + K+                                  
Sbjct: 573 -------------------SDEEKKI---------------------------------- 579

Query: 651 LLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690
           L KS+RS  NFDKIC LLGK ++ VE+ LSELG + V++S
Sbjct: 580 LEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVINS 619

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  474 bits (1220), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 291/720 (40%), Positives = 411/720 (57%), Gaps = 77/720 (10%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M+  FDGFVP+HGIFYSVFHPTEGTKV ++FP   L  S I FD IKNYVIPKPQLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT KY  +R+V YP+ + +  YARN+FSF+ VFVFPY+C TSPYEP +ERLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQILSKAENSSVYFQLKARNT---QKHGNTETAKGTEQPS----------------SLD 161
           Q Q LSK E    YF  K  +    Q   NTE        +                S +
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 162 IGEIAQPENQGYASAKYYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAV 221
             + A  +   Y  +KY  I   ++    ++++ D++ ++++DLN YSEC IPID GNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 222 DIKXXXXXXXXXXCFSIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSD 281
           DIK            S+EDVPI TVNL K+IDVNWDPTMLKIVP+I+G+NSI K+A  S+
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 282 SDVNLVVECIKHLIYYNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESA 341
           SD  LV+ECI+H +YY CVIL+DIFQFSNIYA T+ ++ FLT+PTLA ECQIYV   E +
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 342 HLPNLPFERGPSRSGQGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQ 401
            L  LPF++G     +  +++R S            + LR+N  +    F+S++  H   
Sbjct: 361 LLSALPFKKG-----RKMVKNRRSASIASHFTSS--SSLRQNLNSKASSFISDEGHH--- 410

Query: 402 SRSSSIPYHNT---------SDASFGNSDAGLKGK-LMPFTSKSCLFDLYRSLTQGQTIR 451
           +  ++ P H++         S  S GN+D   + +  +P  +KS LFDLYRSL+QG  + 
Sbjct: 411 NDDTAYPNHDSIYENRRRSESSFSSGNNDEMHQNRNYLP--TKSTLFDLYRSLSQGVKLE 468

Query: 452 EWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNI-GFAESVEALGATNHSRY 510
           EWY+ +F  IR   ID+RRFI FG++  +IYR +SYP+ +N   F++  +     N  + 
Sbjct: 469 EWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKI 528

Query: 511 AKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLAL 570
            K K    T     N+ S +DI+ G++       ++K       D A+ VL++VY+KL+ 
Sbjct: 529 VKNKSQSYTY----NIFSTSDIKFGVD---LYTDTKKKLHTLDVDVADRVLNNVYKKLST 581

Query: 571 SDKKTDHV-AQGNNPISKVFGRNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSA 629
           + + T  +  QG +P SKV  +N     D+            + N +  +  K       
Sbjct: 582 NGRPTTSINGQGQHP-SKVAFKNQSYDNDLPG----------LMNNLGIEATK------- 623

Query: 630 DXXXXXXXXXXXXXKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLH 689
                           N+++ LL +++S  N D IC+ L   RE VE++L+EL  Y +++
Sbjct: 624 ---------FSREININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  468 bits (1205), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 260/550 (47%), Positives = 355/550 (64%), Gaps = 25/550 (4%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFKYG +R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSS--LDIGEIAQPENQGYASAK 177
           Q+Q+LSK+E  +V+F LKA  N+    +T  A  T  PSS        +  + +   S++
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFS 237
           Y ++ KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK          C S
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S SD +LV+ECI+HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357
            CV L+DIFQFSNIYA ++ +  FLT+  +A++CQ YVA+ E + + +LP  +    +  
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSA-- 358

Query: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPY----HNTS 413
               DR S  +L + RK K + +  N  +    F SN       S +SS          S
Sbjct: 359 ----DRDS-PSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQS 413

Query: 414 DASFGNSDAGL---KGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRR 470
             S  +S+      + + +P  ++SCLFDLYRSL+QG+T++ WY++    ++   IDVRR
Sbjct: 414 QTSLSSSNLRANDNRNRFLP--TRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRR 471

Query: 471 FITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAA 530
           FITFG+   +IYR YS+PV+ N+   E  E             + L K NQ       A+
Sbjct: 472 FITFGLERRIIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQ------DAS 525

Query: 531 DIRIGLENAG 540
              +G +N+G
Sbjct: 526 FSVVGSKNSG 535

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/550 (46%), Positives = 354/550 (64%), Gaps = 17/550 (3%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+T KNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFKYG +R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSS--LDIGEIAQPENQGYASAK 177
           Q+Q+LSK+E   V+F LK   N+    +T     T  PSS        ++ + +   S++
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFS 237
           Y +++KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK          C S
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S+SD  LV+ECI+HLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357
            CV L+DIFQFSNIYA ++ +  FLT+P +A++CQ YV + E + + NLP  +     G 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKS---LGS 357

Query: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASF 417
           G+    S + ++    K    P   +S  +     S   Q++  + S S  Y +   +  
Sbjct: 358 GD--QDSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQT 415

Query: 418 GNSDAGL-----KGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472
             S + +     + + +P  ++SCLFDLYRSL+QGQT++ WY++ +  ++   ID+RRFI
Sbjct: 416 SCSSSNIHVINNRNRFLP--TRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFI 473

Query: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADI 532
           TFG+   +IYR YS+PV+ N G  E  E             K L K N   N++LSA   
Sbjct: 474 TFGLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNH--NHLLSATGS 531

Query: 533 RIGLENAGFK 542
           R   ++   K
Sbjct: 532 RNTAQSGNLK 541

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  458 bits (1178), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 247/509 (48%), Positives = 343/509 (67%), Gaps = 15/509 (2%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFKYG +R+VCYPV + +P YARN FSF+FVFVFPYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSS--LDIGEIAQPENQGYASAK 177
           Q+Q+LSK+E   V+F LKA  N+    +T     T   SS        +  + +   +++
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFS 237
           Y +++KD E P    +I DL+ +I++DLN+YSECLIPID GNAVDIK          C S
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S+SD +LV+ECI+HLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357
            CV L+DIFQFSNIYA ++ +  FLT+P +A +CQ YV + E + + +LP  +  + SG 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLT-SGD 359

Query: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASF 417
            +    S + ++    K    P    S  +     S   Q++  + S S  Y +   +  
Sbjct: 360 LD----SPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQT 415

Query: 418 GNSDAGL-----KGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472
             S + +     + + +P  ++SCLFDLYRSL+QGQT++ WY++ +  I+   ID+RRFI
Sbjct: 416 SCSSSNIHISNNRNRFLP--TRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFI 473

Query: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEA 501
           TFG+   +IYRSYSYPV+ ++G  E+ E 
Sbjct: 474 TFGLEKRIIYRSYSYPVMLSVGPRETKET 502

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 50/85 (58%), Gaps = 7/85 (8%)

Query: 606 NSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVHNFDKIC 665
           N++ S   +KV+FD++K  +  + +               +EE IL +SVRS  NFDKIC
Sbjct: 538 NNIKSGRPSKVSFDMQKASSLITGESTIPKLSD-------DEERILEESVRSAENFDKIC 590

Query: 666 TLLGKDRERVESMLSELGPYNVLHS 690
            LLGK +  VE+ L+ELG + +++S
Sbjct: 591 VLLGKPKLEVENYLNELGEFKIINS 615

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  455 bits (1170), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 272/697 (39%), Positives = 381/697 (54%), Gaps = 112/697 (16%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M   F+GFVP+H +FY++FHPTEG+KV +QFP G L+  DI FD IKNY+IPKPQLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT KYG +R+V YPV V +  YARN F F+FVFVFPY+CATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYAS-AKYY 179
           QSQ+LS+AE     F                KG + P   +  +   P      S  K +
Sbjct: 121 QSQVLSRAERDDSLF----------------KGDKLPFDNNSAKNQAPLTHALISKTKSF 164

Query: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXC-FSI 238
              K  EG    I++ DLI +IY+DLN+YSECLIPID GNA+DIK             SI
Sbjct: 165 SPDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSI 224

Query: 239 EDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYN 298
           EDVP+  V L K+ID+NWDPTM+ I+P ING+NSI  +A+ SDSD  LV+ECIKHLIYY 
Sbjct: 225 EDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYK 284

Query: 299 CVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQG 358
           CVI+TDIFQFSNIYA ++ ++ FLT+PT+A +CQ YV   +S+ L ++P +   S  G  
Sbjct: 285 CVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQT--SVPGSR 342

Query: 359 NIRDRSSN-----GTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTS 413
           N + + SN     G L      + +      ++     +SNK +      S   P    S
Sbjct: 343 NNKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYS-----MSNKKRSESSLSSEGTPGAGRS 397

Query: 414 DASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFIT 473
           D              + + ++  LFDLYRSL+QG T+ +WY T+F  IR+  IDVR+FI 
Sbjct: 398 D-----------DHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQ 446

Query: 474 FGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIR 533
           FG +  +IYR  SYPVL     +   + +G +  +  A +          N   S +DI+
Sbjct: 447 FGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSKMAEKAPHSK--------NAFFSTSDIK 498

Query: 534 IGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKV-FGRN 592
                                D  + + + +Y +                  SKV F + 
Sbjct: 499 F--------------------DDGDRLFNSLYARF-----------------SKVSFEKR 521

Query: 593 SEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILL 652
            E++ +   R+S +++G                T+ AD              + E+L LL
Sbjct: 522 RENARE---RKSFDAVG---------------GTNGADKETMILT-------KEEKLQLL 556

Query: 653 KSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLH 689
            ++ ++ +FDKIC  LG+ R  + ++++++G Y V++
Sbjct: 557 GALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  456 bits (1173), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 290/748 (38%), Positives = 408/748 (54%), Gaps = 98/748 (13%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M  HF+GFVP+H +FYS+FHPTEGTKVR++FP G L+  +I FDTIKNY+IPKPQLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT KYG +RLV YPV + +  YARN FSF+FVFVFP +C TSPYEP I RLGKMF VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           Q+Q+LS+AEN SVYF     N+    ++E      Q  +  I   ++   + ++ +K   
Sbjct: 121 QNQLLSRAENDSVYFD----NSHSLLSSEQDSIMHQDKNTSILGFSR---KRFSFSKRPT 173

Query: 181 ILKDLEGPSKK----IAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCF 236
            L   E P  +     ++ DLI +I++DLN+YSECLIPID GN+VDIK            
Sbjct: 174 DLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISI 233

Query: 237 SIEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIY 296
           S EDVP++ V+L+ ++DVNWDPTMLKIVP I+ INSI+++A  S+SDV+ VVECI+HL+Y
Sbjct: 234 SYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVY 293

Query: 297 YNCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSG 356
           Y  VIL+DIFQF+NIYA T+ L  FLT+  LA +CQ YV   ++++   LP E       
Sbjct: 294 YQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLE------- 346

Query: 357 QGNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDAS 416
                 +S N  LD            N      D L     + P+         N+  + 
Sbjct: 347 ------KSINTDLDEYSNSGSAIYPNNEILENDDRLRWPMYYKPR---------NSQSSL 391

Query: 417 FGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGV 476
                +G +       +KSCLFDLYRSL+QG  + +WY  H+  I   +ID+RRFITFG+
Sbjct: 392 SSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGL 451

Query: 477 LHGLIYRSYSYPVLRNIGF-------------------AESVEALGATNHSRYAKY---- 513
           + GL+YR Y+ P+++N G                     +      +T + R+       
Sbjct: 452 VRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDS 511

Query: 514 -KHLLKTNQPLNNVLSAA-----DIRIGLENAGFKARSEKLKQHSTADAAE--------- 558
             H LK ++ +NN  S       D+     N    + +  +K +S+ DA+E         
Sbjct: 512 DIHDLKDDE-INNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKR 570

Query: 559 ---------EVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESANSMG 609
                    +VLSD++RKLA  D         + P S +  R  +   D S   +    G
Sbjct: 571 QILNSGIADKVLSDIHRKLAKFD---------DTPRSPIVKRKEDTFRDFSNGSNIVGYG 621

Query: 610 -SDIKNKVAFDVRKTLATSSAD-------XXXXXXXXXXXXXKRNEELILLKSVRSVHNF 661
            S+  NKV+F++ +   T+  +                    K +   +LL+S+R   N 
Sbjct: 622 SSNTGNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNM 681

Query: 662 DKICTLLGKDRERVESMLSELGPYNVLH 689
           DKIC  L K R+ VE +LSE+G Y +++
Sbjct: 682 DKICIKLQKPRKEVEELLSEIGDYVIIN 709

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  435 bits (1118), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 276/698 (39%), Positives = 373/698 (53%), Gaps = 109/698 (15%)

Query: 3   GHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKLLT 62
            HF+GF+P+H IFYS+FHPTEGTKV ++FP   L    I FDTIKNY+IPK QLCN+LLT
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 63  FKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEEQS 122
           FKY  +R+V YP+ + APYYARN FSF+FVFVFPY+C TSPYEP+I RLGKMF +LEEQS
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 123 QILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYEIL 182
           QILSKAEN  +YF+     T+    T T      PS  +        +    S    +  
Sbjct: 130 QILSKAENDPIYFKSDYVPTEP---TTTIIPQISPSHRN-KRNNDHNDNNDGSRFETDFF 185

Query: 183 KDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKX-XXXXXXXXXCFSIEDV 241
            + E    K ++ DLI +IY+DLN+YSECLIPID GN ++IK             S+EDV
Sbjct: 186 GEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245

Query: 242 PISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVI 301
           P+S +NL  +IDVNWDPTML IVP+ING+N I+K+AK + +D  LV+ECIKHL+YYNCVI
Sbjct: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305

Query: 302 LTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIR 361
           +TDIFQFSN+YA T+ +  FLT+  +A +CQ YV     + L +LPFE            
Sbjct: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE------------ 353

Query: 362 DRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNSD 421
              +NG      K   TP    + +       + + H   S   +I    TS +      
Sbjct: 354 ---NNGN-----KQPSTPKHSRTTSLSSSMSGSVNSHE-HSYMDTIQKSETSLSLSSTDP 404

Query: 422 AGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLI 481
                +L    +K+CLFDLYRSL+ G T+R WY+++   I    +DVR+FI FG++ GLI
Sbjct: 405 NNPHFELAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLI 464

Query: 482 YRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADI---RIGLEN 538
           YR +SYP+ +                           +N+ +  +    DI   R+ + +
Sbjct: 465 YRCHSYPIPQR-------------------------PSNEGIQRIERLNDIDAHRLQIRS 499

Query: 539 AGFKARSEKLKQHS--------TADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFG 590
           +G  ARS                 D A+E+L +VY+KL    K                 
Sbjct: 500 SGSAARSNSGSGSGSSASPSSINVDGADELLKNVYKKLERHSK----------------- 542

Query: 591 RNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELI 650
                      +E   SM +D K + +                           + E  +
Sbjct: 543 ------VSFMDKEKNESMKTDEKGRPS------------------------TMTKEERSV 572

Query: 651 LLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVL 688
           LLKS+ S+ N DKIC  LGK R++VE  L ELG Y ++
Sbjct: 573 LLKSIESLENLDKICVKLGKSRQQVERWLDELGNYKII 610

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  432 bits (1112), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 288/726 (39%), Positives = 400/726 (55%), Gaps = 118/726 (16%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GFV +H IFYS FHPTEG+KV+  FP   LE S I FD+IKNYVIPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           +TFKYG +R+ CYPV V +  YARN FSF+FVFVFP++C TSPYEPAIERLGKMF VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           Q+QILSK+EN ++ F LK+ +   + + +++         DI  I   + Q     +   
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGD---DISSIMTTQ-QKDKYERLNN 176

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXCFSIED 240
           I+ +++       I DL+ ++Y+DLN YSECLIPID GNAVDIK            SIE 
Sbjct: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236

Query: 241 VPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCV 300
           VPIS VNL K++DVNWDP ML I+P+INGIN+I ++++ S ++ +LV+ECI+HL+YY C+
Sbjct: 237 VPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCI 296

Query: 301 ILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPF--ERGPSRSGQG 358
           +LTDIF+FSN+YA T+ L  FL +P +A ECQ YV    ++ + +L      G   +  G
Sbjct: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356

Query: 359 NIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNT------ 412
           +I  R+                  NS ++ + +  N +   PQSRSSS+    T      
Sbjct: 357 DIGSRN------------------NSVSTSL-YSFNGNDSRPQSRSSSVDQSQTNFYKNK 397

Query: 413 ----SDASFGNSDAGLK-GKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARID 467
               S  S GNS+ G    K +P  ++S LFDLYRSL+QG T++EWY  + + IR  RID
Sbjct: 398 KQSESSISTGNSNNGQNIHKHLP--TRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRID 455

Query: 468 VRRFITFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVL 527
           VRRFITFGVL  +IYR  +Y V            + +T+H      ++L K N+ L N +
Sbjct: 456 VRRFITFGVLRRIIYRCETYSV------------INSTDH-----LQNLWKLNE-LENPI 497

Query: 528 SAADIRIGLENAGFKARSEKLKQHSTADAAEEVLSDVYRKL--------ALSDKKTDHV- 578
           S  +I            S+    H  + AA+E L + Y+KL        AL    T H  
Sbjct: 498 SMENI------------SKLQSNHIDSLAADEALMNAYKKLSLKVPSKGALKSHNTSHSS 545

Query: 579 --------------AQGNNPISKV-FGRNSEDSTDISTRESANSMGSDIKNKVAFDVRKT 623
                         A+ N  +SKV F    ED        +    GS+IK  +     K 
Sbjct: 546 FSLTPTAPEMENSQAKRNKRLSKVSFEALPED-------RNGFRWGSNIKTPIQETTWKK 598

Query: 624 LATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVHNFDKICTLLGKDRERVESMLSELG 683
           L+                   + +  I+LK++      DKIC LL   R+ V ++L ELG
Sbjct: 599 LS-------------------KMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELG 639

Query: 684 PYNVLH 689
              +++
Sbjct: 640 ELKLIN 645

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  410 bits (1053), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 258/691 (37%), Positives = 361/691 (52%), Gaps = 152/691 (21%)

Query: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60
           M+  F+GF P+H IF+S+FHPTEG+KV +QFP   L+  +I FD+IKN+VIPKPQLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120
           LT +Y  +RLV YPVNV +  YARN FSF+FVF+F YDC T PYEPAIERLGKMF  LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           QSQILSK++ +S +F        K G                                  
Sbjct: 121 QSQILSKSQRTSAFF--------KDG---------------------------------- 138

Query: 181 ILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKXXXXXXXXXXC-FSIE 239
             +D++    K +I DL+ ++Y+DLN+YSECLIPID GN ++IK             SIE
Sbjct: 139 --EDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIE 196

Query: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299
           DVP+S VNL K++D+NWDPTML I+P I+G+NSI  ++  SDSD NLV+ECIKHLIYYNC
Sbjct: 197 DVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNC 256

Query: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359
           VI+TDIFQFSNIYA ++ ++ FL +P +A  CQ YV     + + +LP      +  + N
Sbjct: 257 VIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL--ASEQDDEIN 314

Query: 360 IRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGN 419
             D +                 ++++ + +   ++ HQ T           +T  +S G 
Sbjct: 315 NSDMTQKALSSSRSSFSSYFSHKSAY-ARVSETAHHHQST-----------STLSSSEGQ 362

Query: 420 SDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHG 479
            D   +G+++P  SK  LFDLYRSL  G T+  WYK +F  I+   IDVR+FI FGV++ 
Sbjct: 363 QDNPRQGQVLP--SKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINK 420

Query: 480 LIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENA 539
           +IYR + YP++ +  F                    LL   Q    VLS +DI+      
Sbjct: 421 IIYRVHQYPIMEHKTFKSP-----------------LLSDRQNDKIVLSTSDIKF----- 458

Query: 540 GFKARSEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDI 599
                          D  + +L+ +Y KL+                              
Sbjct: 459 ---------------DVGDRILNSIYNKLS------------------------------ 473

Query: 600 STRESANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVH 659
                          KV FD  K L +   +               +E+ IL  ++    
Sbjct: 474 ---------------KVTFDRDKKLESKIGN---------SRNLGESEKNILFNALERHE 509

Query: 660 NFDKICTLLGKDRERVESMLSELGPYNVLHS 690
           +FD+IC+ LGK +  VES++SE+G Y  ++S
Sbjct: 510 SFDRICSKLGKSKNEVESIISEIGEYMTINS 540

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  256 bits (655), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 176/505 (34%), Positives = 253/505 (50%), Gaps = 71/505 (14%)

Query: 191 KIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKX-XXXXXXXXXCFSIEDVPISTVNLA 249
           +I++ DLI +IY+DLN+YSECLIPID GN VDIK             SIEDVP+S V+L 
Sbjct: 226 RISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLT 285

Query: 250 KLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVILTDIFQFS 309
           K+ DVNWDPTMLK++P INGIN I+K++K S+S   LV+ECIKHLIYYNCVI+TDIFQFS
Sbjct: 286 KITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFS 345

Query: 310 NIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGNIRDRSSNGTL 369
           N Y++T+ +S FLT+P +A  CQ YV     + L  LPF      S Q +   R  +   
Sbjct: 346 NTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFHIETETSVQSSSAYRHHHN-- 403

Query: 370 DILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASFGNSDAGLKGKLM 429
               + ++TP    SF S +   + +   +   R  S     TS  S  +          
Sbjct: 404 ----RHEKTP----SFGSSITSNNGRSSFSADDRKQS----ETSLNSSNDPSNSNLISTA 451

Query: 430 PFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSY-- 487
              +K  LF+LYRSL Q   ++ WYK ++  I    ID+R+FI FG++ GLIYR +SY  
Sbjct: 452 HLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPI 511

Query: 488 ---PVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKAR 544
              PV+     A+S     +++    +          P+               + F   
Sbjct: 512 VITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPI---------------SRFPGL 556

Query: 545 SEKLKQHSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRES 604
              +      D  ++++   Y KL   +K  +H     +   K+  +N E+        S
Sbjct: 557 GSHVPSSGVRDTRDKLMKSFYEKL---EKGKNHSKVSFS--DKIAFQNDEND------HS 605

Query: 605 ANSMGSDIKNKVAFDVRKTLATSSADXXXXXXXXXXXXXKRNEELILLKSVRSVHNFDKI 664
           A S  +D K+K    +++                      RN   ILL S+ ++ N DKI
Sbjct: 606 ATSSDNDDKSKSQLTLKQ----------------------RN---ILLDSISNMDNMDKI 640

Query: 665 CTLLGKDRERVESMLSELGPYNVLH 689
           C  LG+ R ++E  LSE G Y V++
Sbjct: 641 CVKLGRPRSQIEEWLSEFGDYKVIN 665

>ZYRO0A13530g Chr1 complement(1072812..1074560) [1749 bp, 582 aa]
           {ON} similar to uniprot|P05066 Saccharomyces cerevisiae
           YOR386W PHR1 DNA photolyase involved in
           photoreactivation repairs pyrimidine dimers in the
           presence of visible light induced by DNA damage
           regulated by transcriptional repressor Rph1p
          Length = 582

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 326 TLAAECQIY-VAYNESAHLPNLPFERGPSRSGQGNIRDRSSNGTLDILRK 374
           +L A  Q+  + YNE A LP+L F+     + QGN+ + S    +  LRK
Sbjct: 276 SLVATSQVKKIQYNEKAFLPDLDFQLPAEFTAQGNVAEASEEAAISRLRK 325

>KLTH0E11330g Chr5 complement(1013019..1013618) [600 bp, 199 aa]
           {ON} similar to uniprot|Q12041 Saccharomyces cerevisiae
           YDR253C MET32 Zinc-finger DNA-binding protein, involved
           in regulating expression of the methionine biosynthetic
           genes
          Length = 199

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 43/97 (44%), Gaps = 7/97 (7%)

Query: 123 QILSKAENSSV--YFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYYE 180
           QI+S  EN SV  YF     N +    TE+A   E+P S        PEN G    K   
Sbjct: 51  QIMS--ENKSVLNYFDQLLNNVESLSGTESAPQGEKPGSKKRRRSEGPENSGKDDLKVNT 108

Query: 181 ILKDLEGPSKKIAIG--DLITKIYRDLNDYSECLIPI 215
            ++D  G +KK   G  DL+ +   DL  +    +PI
Sbjct: 109 SVEDDAG-AKKFPCGKCDLVFRRSSDLRRHERAHLPI 144

>NDAI0H00630 Chr8 (146568..147605) [1038 bp, 345 aa] {ON} Anc_5.652
          Length = 345

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 553 TADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDI 599
           T D A +VL +   KL LS ++   VAQG +P +KVF      ++DI
Sbjct: 251 TYDFAHDVLVNWRHKLLLSTREPIKVAQGPSPFNKVFMVGDNPASDI 297

>NCAS0C00870 Chr3 complement(151523..153526) [2004 bp, 667 aa] {ON}
           Anc_8.762 YMR232W
          Length = 667

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 148 TETAKGTEQPSSLDIGEIAQPENQGYASA---KYYEILKDLEGPSKK---IAIGDLITKI 201
           T   +  ++P+SLD+ EI +P N+   S      ++ +  LE P+ +   + + D+I ++
Sbjct: 60  TNFYENIKRPASLDLSEIGEPLNKKLYSPLNLDRFQKVVQLETPTNEGTTVPLLDIIRRL 119

Query: 202 YRDLNDYSECLIPIDSG 218
           Y    +Y+E L   DS 
Sbjct: 120 YESELEYAEFLTIADSA 136

>TBLA0B09370 Chr2 (2225321..2230651) [5331 bp, 1776 aa] {ON}
           Anc_2.349 YMR162C
          Length = 1776

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 75/178 (42%), Gaps = 7/178 (3%)

Query: 438 FDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRNIGFAE 497
           FD+   L+      E+ +  FE       D +  +TF   H +I     + + +N  +  
Sbjct: 162 FDMTEHLSDSDDPFEYDRFDFEDSNDPNFDKKNLMTFNTFHQIII----FKLRKNFWYDL 217

Query: 498 SVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQHSTADAA 557
           SV  +   +H  +     LL T   +NN      + +  E    K ++   K +S A+ A
Sbjct: 218 SVGDIVLLSHDDWVPADLLLLTTDNINNECYVETMALDGE-TNLKCKTSHPKINSLANDA 276

Query: 558 EEVLSDVYRKLALSDKKTD-HVAQGNNPISKVFGRNSEDSTDISTRESANSMGSDIKN 614
           ++ L+++  ++ + D   D +  +GN  +S    RN   S +  T  + +S  S+  N
Sbjct: 277 DK-LANMQVEITVEDPNIDLYNFEGNLDLSPHIKRNQNPSNNTITIRNDDSNSSNKSN 333

>YBR208C Chr2 complement(636703..642210) [5508 bp, 1835 aa] {ON}
            DUR1,2Urea amidolyase, contains both urea carboxylase and
            allophanate hydrolase activities, degrades urea to CO2
            and NH3; expression sensitive to nitrogen catabolite
            repression and induced by allophanate, an intermediate in
            allantoin degradation
          Length = 1835

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 252  IDVNWDPTMLKIVPHINGINSIAKVAKFSDS-DVNLVVECIKHLIYYNCVILTDIFQFSN 310
            I   +DPT+ KI+ H  G +    ++K + + +   V  CI ++ Y   +I +D F  + 
Sbjct: 1007 ISPEYDPTLAKIIVH--GKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAK 1064

Query: 311  IYASTNELSRFLTEPT 326
            +  STN L+ +  EPT
Sbjct: 1065 V--STNILNSYQYEPT 1078

>Ecym_1184 Chr1 complement(374705..380218) [5514 bp, 1837 aa] {ON}
            similar to Ashbya gossypii ADR051C
          Length = 1837

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 5/75 (6%)

Query: 252  IDVNWDPTMLKIVPHINGIN-SIAKVAKFSDSDVNLVVECIKHLIYYNCVILTDIFQFSN 310
            I   +DPT+ K++ H    N +I K+AK  D  V  +  CI ++ Y   +I +++F+ + 
Sbjct: 1008 ISAEYDPTLAKVIVHAKDRNEAILKMAKALDEVV--IQGCITNIDYLRSIITSEMFKTAK 1065

Query: 311  IYASTNELSRFLTEP 325
            +  +T  L  +  +P
Sbjct: 1066 V--ATKVLDSYAYKP 1078

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 8   FVPVHGIFYSVFHPTEGTKVRHQFPSGCLEL-SDITFDTIKNYVIPKPQL 56
           + P+HG+ Y +F         H+  S CL L  DI +  +K  ++P P  
Sbjct: 260 YTPMHGVGYQIF---------HRISSTCLNLVEDIDYVCVKEQIVPDPSF 300

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,104,511
Number of extensions: 3048741
Number of successful extensions: 9594
Number of sequences better than 10.0: 51
Number of HSP's gapped: 9861
Number of HSP's successfully gapped: 60
Length of query: 690
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 573
Effective length of database: 40,065,477
Effective search space: 22957518321
Effective search space used: 22957518321
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)