Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11286g6.18ON95195149980.0
Kwal_56.224146.18ON96394730930.0
TDEL0G045106.18ON96996923080.0
NDAI0I022606.18ON96798122550.0
ZYRO0C07854g6.18ON94496522480.0
NCAS0D026506.18ON95094922020.0
Suva_15.1806.18ON94895121920.0
Smik_15.1746.18ON94594621800.0
CAGL0E02695g6.18ON94694921780.0
YOR005C (DNL4)6.18ON94494721600.0
KAFR0A050506.18ON94894321520.0
Skud_15.1666.18ON94795521500.0
Kpol_1032.76.18ON96596021380.0
KNAG0F028706.18ON95495121180.0
TBLA0G010406.18ON97296821010.0
ACR008W6.18ON98196920720.0
TPHA0M002606.18ON96696420270.0
KLLA0D01089g6.18ON90792219940.0
TPHA0D045707.343ON7363923005e-27
ACL155W7.343ON6973982826e-25
NDAI0A019407.343ON7653902827e-25
TBLA0E020507.343ON7203952665e-23
CAGL0I03410g7.343ON7244252666e-23
Kwal_56.246167.343ON7153872658e-23
SAKL0F10912g7.343ON6933862612e-22
KLLA0D12496g7.343ON7004282496e-21
Suva_4.827.343ON7553902497e-21
Kpol_2001.717.343ON7264172471e-20
Smik_4.747.343ON8453862462e-20
TDEL0C020407.343ON7054252452e-20
Skud_4.937.343ON7553862452e-20
ZYRO0F11572g7.343ON7313862433e-20
YDL164C (CDC9)7.343ON7553862434e-20
KLTH0H01408g7.343ON7234262415e-20
KNAG0C037407.343ON7273602326e-19
NCAS0A141107.343ON7533902273e-18
KAFR0B008307.343ON7103902254e-18
Kpol_1050.31.416ON265101780.84
Kwal_14.25871.317ON80874800.89
Ecym_21886.228ON461106791.0
KLLA0B02200g6.228ON466128771.7
TPHA0E027706.228ON450106771.7
Ecym_50527.46ON873116771.8
SAKL0G17358g4.323ON70953752.8
NCAS0A012705.292ON688130743.9
TBLA0C032105.292ON683138734.8
NCAS0D041006.228ON449106725.9
Kwal_23.56445.292ON6891447110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11286g
         (951 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...  1929   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...  1196   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   893   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   873   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   870   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   852   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   848   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   844   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   843   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   836   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   833   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   832   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   828   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   820   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   813   0.0  
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   802   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   785   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   772   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   120   5e-27
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   113   6e-25
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   113   7e-25
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   107   5e-23
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   107   6e-23
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   106   8e-23
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   105   2e-22
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   100   6e-21
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   100   7e-21
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   100   1e-20
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...    99   2e-20
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...    99   2e-20
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...    99   2e-20
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    98   3e-20
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...    98   4e-20
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...    97   5e-20
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...    94   6e-19
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...    92   3e-18
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    91   4e-18
Kpol_1050.3 s1050 complement(5462..6214,6398..6442) [798 bp, 265...    35   0.84 
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...    35   0.89 
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    35   1.0  
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    34   1.7  
TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.2...    34   1.7  
Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar t...    34   1.8  
SAKL0G17358g Chr7 complement(1503342..1505471) [2130 bp, 709 aa]...    33   2.8  
NCAS0A01270 Chr1 (245601..247667) [2067 bp, 688 aa] {ON} Anc_5.292     33   3.9  
TBLA0C03210 Chr3 (779532..781583) [2052 bp, 683 aa] {ON} Anc_5.2...    33   4.8  
NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.2...    32   5.9  
Kwal_23.5644 s23 complement(1250655..1252724) [2070 bp, 689 aa] ...    32   10.0 

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 1929 bits (4998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 934/951 (98%), Positives = 934/951 (98%)

Query: 1   MDGNGKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRV 60
           MDGNGKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRV
Sbjct: 1   MDGNGKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRV 60

Query: 61  EIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERR 120
           EIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERR
Sbjct: 61  EIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERR 120

Query: 121 LLNWKQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTT 180
           LLNWKQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTT
Sbjct: 121 LLNWKQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTT 180

Query: 181 GLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKI 240
           GLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKI
Sbjct: 181 GLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKI 240

Query: 241 LSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQ 300
           LSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQ
Sbjct: 241 LSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQ 300

Query: 301 LHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRK 360
           LHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRK
Sbjct: 301 LHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRK 360

Query: 361 IILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEI 420
           IILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEI
Sbjct: 361 IILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEI 420

Query: 421 LSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKP 480
           LSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKP
Sbjct: 421 LSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKP 480

Query: 481 EYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFC 540
           EYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFC
Sbjct: 481 EYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFC 540

Query: 541 NVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARS 600
           NVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARS
Sbjct: 541 NVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARS 600

Query: 601 VENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVS 660
           VENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVS
Sbjct: 601 VENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVS 660

Query: 661 PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVK 720
           PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVK
Sbjct: 661 PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVK 720

Query: 721 HGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEP 780
           HGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEP
Sbjct: 721 HGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEP 780

Query: 781 KHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDL 840
           KHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQL                 MLQDDL
Sbjct: 781 KHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSSPSDFSSRISSMLQDDL 840

Query: 841 DEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTART 900
           DEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTART
Sbjct: 841 DEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTART 900

Query: 901 AYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
           AYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI
Sbjct: 901 AYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 1196 bits (3093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/947 (60%), Positives = 725/947 (76%), Gaps = 23/947 (2%)

Query: 15  KISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTV 74
           ++S+ +P NFAPSPDFRWLC+ELF +L+ I E RQ+LGKAVTVKRVE+I  FIKLWRTTV
Sbjct: 30  EVSQKKPQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTV 89

Query: 75  GDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSL 134
           GD+ +P LRL+ PYRD RAY+IKD+TL+KAVC++LNL +DSLTE+RLLNWKQYA RGTSL
Sbjct: 90  GDNIYPVLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSL 149

Query: 135 SKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKN 194
           SKFCV+EI KRRKEP   ++LTID LN+ LDEL+KEAS KK WG  GLS+S SFQ CL+N
Sbjct: 150 SKFCVEEIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKK-WGFNGLSKSPSFQNCLQN 208

Query: 195 LSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDK 254
           +SF E RYFFDI+LK RVIGGLEHKFL CWHPDAQ YLGVV+DLK+LS+ LWNP++RL K
Sbjct: 209 MSFSEQRYFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGK 268

Query: 255 RDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLS 314
            +LSINIG AFAPHLAKRLH+SYER+C+KLK DFI+EEKMDGERIQLHY+  G+ ++FLS
Sbjct: 269 NELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLS 328

Query: 315 RRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD 374
           RRG DF+HLYG  +  GVISQ+LK K+DV+DCVLDGEMVS+DK++ ++LPFGIVKS A++
Sbjct: 329 RRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAME 388

Query: 375 ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGI 434
           EL+NS+   + DGYRPLYM+FDLVYLNGVSLT++PLH+RK YL+ ILSPV ++VEIL  +
Sbjct: 389 ELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDV 448

Query: 435 RACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           RA +  AIK  ++RAIEMGSEG+I+KQ SS YE+GARND W+KIKPEYFE+LGETMDLVV
Sbjct: 449 RASEPNAIKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVV 508

Query: 495 IGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPI------IKCVSFCNVANGVSD 548
           IGRDPGKKDSLMCGL+++D      +   +    + DP+       K +SFCN+ANGVSD
Sbjct: 509 IGRDPGKKDSLMCGLILADE----TDGSSVNLASQDDPLRPKQRNPKVISFCNIANGVSD 564

Query: 549 EEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSS 608
            EFKEI RKTRG W      PPP  LLEFG+K+P EWIDP++S+V+EVKARSV+  E SS
Sbjct: 565 AEFKEIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSS 624

Query: 609 KRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKR--- 665
           K+Y+ GSTL  AYCR +R +KDW+TC +V QY+QAK AHNYH+ KRK HQ+SPR++R   
Sbjct: 625 KKYKTGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNYHKGKRKSHQISPRKQRKLA 684

Query: 666 NVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHGGLI 725
           NV E++   A +++  +    S+IF+GL FYILSDY+ SQ++RYE+  +   V K+ G +
Sbjct: 685 NVSELYPLLADDSRESIFE--SNIFQGLQFYILSDYIDSQKKRYEKDQIGTLVRKNSGHV 742

Query: 726 VKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQ 785
           + N  +R E  S LRI+SGK T+ECR+L  +GYDII P WIFDC++ G  + +EP+HCF+
Sbjct: 743 LHNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFR 802

Query: 786 TSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAPL 845
           TSR+LL+NSRQRVD++GDSF RPL  TEF +L                    ++LD  PL
Sbjct: 803 TSRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSA------PEELDGIPL 856

Query: 846 FLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAY-YV 904
           FL Q FKIY       P Q   L + + L+GG  S TL+  NLV+V  +    +  +  V
Sbjct: 857 FLFQNFKIYFARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLV 916

Query: 905 QELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
           + LR++IA  A++   + RIPH+V S WL+ C  EQCLVPEEDF  +
Sbjct: 917 EGLRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/969 (47%), Positives = 631/969 (65%), Gaps = 44/969 (4%)

Query: 10  ETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEH-RQELG-KAVTVKRVEIITCFI 67
           E   S+ +E  P NFAPSPDF WLCEELF +L+ +    R+ LG K ++V+  E+I+ FI
Sbjct: 16  ELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRYYEVISHFI 75

Query: 68  KLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQY 127
           +LWR TVG++ FPAL L  PYRD R Y+IKD+TL+KA+C  L L + S TE+RLL WK+ 
Sbjct: 76  RLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEKRLLKWKRR 135

Query: 128 AGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHS 187
           A RG  LS FCV+EI KR+ EP P R++TID LNE LD L +E + K   G  GLS+S +
Sbjct: 136 ATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERNAKG--GFKGLSDSPT 193

Query: 188 FQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWN 247
           F FCL+N+SF+ELR+FFDIVLKNRVIGG EHK L CWHPDA  YL VV+DL+ ++ +LW+
Sbjct: 194 FNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLETVASRLWD 253

Query: 248 PSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGG 307
           P  RL + DLSIN+G+AF P LAK++ +SYE+IC+KL +DF++EEKMDGERIQ+HY++ G
Sbjct: 254 PEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYG 313

Query: 308 SVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGI 367
           + ++FLSRRG+D++ LYG+ +  G ++ YL   S+VRDCVLDGEM+++D  R ++LPFG+
Sbjct: 314 AKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGM 373

Query: 368 VKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDV 427
           VKS+A   L  S  G  + G+RP+ MV DLVYLNGVSL K+PL+ RKE+L  +L P P  
Sbjct: 374 VKSSARQAL--STEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHA 431

Query: 428 VEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLG 487
           VEIL  +R  +  AI+  ++++I MGSEG+++K   + YE+GARND+W+K+KPEY E  G
Sbjct: 432 VEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKPEYLEQFG 491

Query: 488 ETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPIEHGKE-----------------G 530
           E +DLV+IGR PGKKDSLMCGL V + E   E+   IE  +E                 G
Sbjct: 492 ENLDLVIIGRTPGKKDSLMCGLAVYEGE---EDLNEIEAKRESAIVNLDSEGDELDDTDG 548

Query: 531 DPIIK-CVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPK 589
             IIK  +SFC +ANG+S +EFKEI+RKTRG+WV   ++ P   LL FGSKIP EWIDPK
Sbjct: 549 KKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPK 608

Query: 590 NSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNY 649
           NS+++EVKARS++N+E S K++ AG TLH  YCRRIR+DKDWT C S ++  Q +  H  
Sbjct: 609 NSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQER-LHKS 667

Query: 650 HRYKRKVHQVSPRRKRNVHEIFEYCAGEAKSELDT-EGSSIFEGLHFYILSDYVTSQRR- 707
                  ++   ++ ++     +  +G+A  + D  + ++IF+GL FY+LSDY+   R  
Sbjct: 668 STGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDYIDVSRNV 727

Query: 708 RYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIF 767
           R  +      ++++ G +V+N+  +    S  RI+SGK T ECR L+ RGYDI+ P WI 
Sbjct: 728 RITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILSPQWIL 787

Query: 768 DCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXX 827
           DCI     + +EP+HCF  S  L+     RVD+YGDSF  P+  TE QQL          
Sbjct: 788 DCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPI--TE-QQLDNLIDTNMKQ 844

Query: 828 XXXXXXXMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFSI-----LRRKIELYGGVVSET 882
                      +LD  PLFL     +Y+      PQ F+      L  K +L+GG ++  
Sbjct: 845 TEPNLMREANSELDVVPLFLFSTRAVYI-----PPQVFNAVDAYGLTSKFKLHGGSIASD 899

Query: 883 LEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCL 942
           +   NL+++P+      T   V E+RQ +       ++   IP+IV  +W++    E C 
Sbjct: 900 IPSCNLIIMPNENQRLGTQSLV-EMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQ 958

Query: 943 VPEEDFSSI 951
           VPEEDF+ +
Sbjct: 959 VPEEDFTPV 967

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  873 bits (2255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/981 (46%), Positives = 631/981 (64%), Gaps = 52/981 (5%)

Query: 1   MDGNGKCPS-ETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHR-----QELGKA 54
           MDG    P+ + DT   +   PHNFAPSP FRWLC+ELF +L+ I +       +E  K 
Sbjct: 1   MDGKAVTPTLDNDTRPAT---PHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKP 57

Query: 55  VTVKRVEIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRD 114
           + V+  E+I  FI LWR TVG+D +PAL L+ PYRD R Y+++D+TLIKA+C  L L ++
Sbjct: 58  INVQYYEVIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKN 117

Query: 115 SLTERRLLNWKQYAGRGTSLSKFCVQEISKRRKEPL--PERQLTIDGLNEKLDELAKEAS 172
           S TE+RLL+WKQ AGR   LS F V EI KR+ EP      ++TID LN+ LD L++E +
Sbjct: 118 SFTEKRLLSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERN 177

Query: 173 GKKAWGTTGLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYL 232
            K + G  GLS+S +F FCL+N++F+EL++FFDI+LK+RVIGG EHKFL  WHPDAQ YL
Sbjct: 178 SKGSMGYRGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYL 237

Query: 233 GVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEE 292
            VV+DLK ++ KLW+P+V L   DL+IN+G  FAP  AK+L +SYE+IC+KLKHDF +EE
Sbjct: 238 SVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEE 297

Query: 293 KMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEM 352
           KMDGERIQLHY + G+ L FLSRRG D+++LYG+ +  G +S+YL L ++V++CVLDGEM
Sbjct: 298 KMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEM 357

Query: 353 VSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHI 412
           V++DK+R  +LPFG+VKS+A    I ++ G  N+GYRPL MVFDLVYLNGVSL  +PL+ 
Sbjct: 358 VTFDKERNALLPFGLVKSSA--RSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQ 415

Query: 413 RKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARN 472
           RK YL++I +P   +VE+L+  R  D ++IKN ++ AI +GSEGV++K  +S Y V +RN
Sbjct: 416 RKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRN 475

Query: 473 DHWVKIKPEYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHI-----------LENF 521
           D W+K+KPEY E  GE MDL+VIG+DPGKKDSLMCGL V + +             L++ 
Sbjct: 476 DDWIKVKPEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQ 535

Query: 522 GPIEHG--KEGD------PIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLS 573
             I  G  KEG+       I + VSFC++ANG+S EEFK I R T+G W    E PPP  
Sbjct: 536 DSIGEGEDKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSD 595

Query: 574 LLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTT 633
           LLEFGS++P EWIDPK+S+VIEVKARS+ N E ++K+++ G TL+  YCR+IR DKDW T
Sbjct: 596 LLEFGSRVPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKT 655

Query: 634 CTSVAQYQQA---KAAHNYHRYKRKVHQVSPRRKRNVHEI---FEYCAGEAKSELDTEGS 687
           C ++++ ++    K   N        H +   ++R    I   FE    +  + LD   S
Sbjct: 656 CYTLSELRRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQ--S 713

Query: 688 SIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTT 747
            IF+GL+FY++SD V +   R  R  +  K++  GG+IV N+  +    +  RI+ GK T
Sbjct: 714 RIFDGLYFYVISDVVDATGSRVSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYT 773

Query: 748 IECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSR 807
            EC++L++RGYDII+P W+ DCI     L +EPK+CF  S  L+  +++RVD +GDSF  
Sbjct: 774 AECQSLIDRGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEA 833

Query: 808 PLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFSI 867
            +    F +L                 +  D +D  PLFL     I +   D     F+ 
Sbjct: 834 QISEDSFSRL---IERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKD--KALFTK 888

Query: 868 LRRKIELYGGVVSETLEGANLVLV-PSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPH 926
           L+ +I LYGG  +  L   NLV++  + ++ A+      ++R  +       +    +P+
Sbjct: 889 LKVQIRLYGGKTTGDLASCNLVVIQQNEIAVAK------DVRSSLLKLTSDTDKPPVLPY 942

Query: 927 IVRSEWLDTCTTEQCLVPEED 947
           IV  EW+D+  +E C VPEED
Sbjct: 943 IVTPEWIDSSISEGCQVPEED 963

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/965 (46%), Positives = 631/965 (65%), Gaps = 49/965 (5%)

Query: 13  TSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG--KAVTVKRVEIITCFIKLW 70
           T    +N+PHNFAPSPDF+WLC+ELF ++D + +  ++ G  K++TVK  EII+ F+KLW
Sbjct: 3   TKTDDQNKPHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLW 62

Query: 71  RTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGR 130
           R TVGD+ +PAL L+ PYRD R ++IKD+TLIKA+C  L L  +S+TE+RLL WK+ AGR
Sbjct: 63  RKTVGDNIYPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGR 122

Query: 131 GTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQF 190
           G  LS FCV+EI +RR EPL   ++TID LNE LD+LA+E +  K  G   L++S  F++
Sbjct: 123 GIKLSDFCVEEIRRRRSEPLNGERITIDKLNECLDQLAEERN-TKGRGFKSLADSSVFKY 181

Query: 191 CLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSV 250
           CL+N+SF E++Y+FDI+LK+RVIGG EHKFL CWHPDA+ YL VV+DLK ++ KLW+PS 
Sbjct: 182 CLENMSFTEMKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSH 241

Query: 251 RLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVL 310
           RL   DL +N+G  FAP LAKRL++SY+++  +LK DF +EEKMDGERIQLHY++ G  L
Sbjct: 242 RLKNDDLGVNLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKL 301

Query: 311 KFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKS 370
           K+ SRRG D+++LYG+++  G +++YL+L   VR+CVLDGEM+S+D +   +LPFG+VKS
Sbjct: 302 KWFSRRGNDYTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKS 361

Query: 371 AAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEI 430
           +A D L  +  G    GYRPLYMV D +YLNGVSL  VPL+ RK+YL  IL+P P  VEI
Sbjct: 362 SARDSL--TAEGILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEI 419

Query: 431 LKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETM 490
           ++ +   D  +IK+ +++AI MGSEG+I+K   S YE+GAR D+W+KIKPEY E  GE +
Sbjct: 420 IQSMHCYDDTSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENL 479

Query: 491 DLVVIGRDPGKKDSLMCGLLV--------SDSEHILENFGPIEHGKEGDPIIKCVSFCNV 542
           DL+VIGRDPGKKDSLMCGL V        + S+  + N    E  +    + K +SFC +
Sbjct: 480 DLLVIGRDPGKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTI 539

Query: 543 ANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVE 602
           ANG+S EEFK+I RKT G W + ++  PP  +LEFGSK+P EWI P++SVV+EVKARS++
Sbjct: 540 ANGISQEEFKQIERKTAGKWKNTEDHKPP-KILEFGSKLPEEWIYPEDSVVLEVKARSLD 598

Query: 603 NSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQ--------AKAAHNYHRYKR 654
           N+E S ++++ G TLH  YCRRIR DK+WT C ++ +  Q        ++ ++N    K 
Sbjct: 599 NTESSGRKFKVGCTLHGGYCRRIREDKNWTECYTLYELWQERRKKVPLSEDSNNQKPMKS 658

Query: 655 KVHQVSPRRKRNVHEIFEY--CAGEAKSELDTEGSSIFEGLHFYILSDYVTSQ-RRRYER 711
           K      RR R V  + +   C  EAK+      SSIF+GL FY++SDY+ SQ   R  +
Sbjct: 659 K----KIRRPRIVSRLNQTLSCDDEAKT------SSIFDGLIFYVISDYMASQDSERISK 708

Query: 712 GMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCIS 771
             +   +  +GG +  N+         LRI+SGK T+EC+ L+ RGYDI+ P W+ DC++
Sbjct: 709 EQLCDLISGNGGKLTFNVISDHRVKGGLRIISGKYTLECKALIERGYDILSPQWLMDCVN 768

Query: 772 AGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXX 831
            GF + IEP+HCF  S  +   +R RVD +GDS+   ++ TE +                
Sbjct: 769 TGFLVTIEPRHCFSVSEDMEKIARTRVDHFGDSYD--VEITEDRLRDILTSKEFDSDFST 826

Query: 832 XXXMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFS-----ILRRKIELYGGVVSETLEGA 886
               +  D+++ PLFL  R  ++      IP+ FS     +L+ K+ LYGG +++ +   
Sbjct: 827 GSLDVISDVEDIPLFLFSRRIVF------IPEGFSYLDTQLLKHKVRLYGGQLTDNVNQC 880

Query: 887 NLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEE 946
           NL++VP      R    + +LR+ ++  A        IP IV   W+D    E   VPEE
Sbjct: 881 NLIIVPDGKINLR-GRIISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEE 939

Query: 947 DFSSI 951
           DF ++
Sbjct: 940 DFLAV 944

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/949 (45%), Positives = 611/949 (64%), Gaps = 33/949 (3%)

Query: 21  PHNFAPSPDFRWLCEELFHRLDAINEHR--QELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           P NF+PSP F+WLC+ELF +L+ I   R  + +GK VTV+  E+I  FI LWR TVG+D 
Sbjct: 17  PCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGNDI 76

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           FPAL L+ PYRD R ++I+D+TLIKA+C  L L R+S TE+RLL+WK  AG+G  LS+FC
Sbjct: 77  FPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQFC 136

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198
           V EI KR+ EP  + ++TID LNE LD+LA+E + K   G   L++S +F+FCL+N+SF+
Sbjct: 137 VNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSK-GRGFKKLADSPTFKFCLENMSFI 195

Query: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258
           EL++FFDI+LKNRVIGG EHKFL  WHPDAQ YL VV+DL+ ++ +LW+P +RL   DL 
Sbjct: 196 ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV 255

Query: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318
           IN G AFAP LAK+L +SYE+IC KLK+DFI+EEKMDGERIQLHY + G  LKF SRRG 
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315

Query: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378
           D+++LYG+ +  G I ++LKL  DV+DC+LDGEM++YDK + +ILPFG+VKS+A   L  
Sbjct: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLTK 375

Query: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438
             + NE  GY+PL+MVFDL+++NG SL  +PL++RKEYL  I +P P ++E+L      +
Sbjct: 376 DGIMNE--GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498
             +I+  ++ AI MGSEG+++K+  S Y V +RND W+K+KPEY E  GE MDL+VIGRD
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493

Query: 499 PGKKDSLMCGLLV-------------SDSEHILEN--FGPIEHGKEGDPIIKCVSFCNVA 543
           PGKKDSLMCGL V              D+  IL++    P+E  +    I K VSFC +A
Sbjct: 494 PGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERT---IHKFVSFCVIA 550

Query: 544 NGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVEN 603
           NG+S EEFK+I+RKTRG W    E PPP +LL+FG+++P+EWIDPK SVVIEVKARS++ 
Sbjct: 551 NGLSQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDA 610

Query: 604 SEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRR 663
           +E + +++  G TL+  YCR IR DKDW TC +++++ + K   +      +V     R+
Sbjct: 611 AESNGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQ 670

Query: 664 KRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSD-YVTSQRRRYERGMVAAKVVKHG 722
           K+N  +     + E +  L  + ++ F  L+FY++SD +      R E+  +   + + G
Sbjct: 671 KKNRRKYILDQSLEEEGGL-LKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGG 729

Query: 723 GLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKH 782
           G ++ NI  +      LRI+SGK T EC  L+ RGYD+I+P WI DC+ +   L +EPK+
Sbjct: 730 GTLIHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKY 789

Query: 783 CFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDE 842
           CF  S  L   + +RVD +GDS+  P+   +   L                    ++L +
Sbjct: 790 CFNVSTELKKLTEKRVDTFGDSYEVPITEEQLSTLLETELNLVRVQGLVTPYA-DEELIK 848

Query: 843 APLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAY 902
            PLFL Q     +L  +   +  S L+ KI+LYGG ++  +   NL+++P+         
Sbjct: 849 IPLFLFQ--DRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNG-----NQQ 901

Query: 903 YVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
            +Q  R  +  N         IP+IV   W++    E   VPEED+  I
Sbjct: 902 LLQRTRDLLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/951 (46%), Positives = 622/951 (65%), Gaps = 39/951 (4%)

Query: 20  EPHNFAPSPDFRWLCEELFHRLDAI-NEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           EPHNFAPSPDFRWLCEELF +++ +        GK+V+ +  EII+ F +LWR TVG++ 
Sbjct: 10  EPHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNI 69

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           +PAL L  PYRD R Y+IKD+ LI+ VC  L L ++S TE+RL +WKQ  G+G SLS   
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLL 129

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKE--ASGKKAWGTTGLSESHSFQFCLKNLS 196
           V+EISKRR EP   + +T+D +N  LDEL+KE  ASG+   G   L +S  F  CL+N++
Sbjct: 130 VEEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGR---GFKNLVKSKPFLHCLENMT 185

Query: 197 FLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRD 256
           F+EL++FFDI+LKNRVIGG EHK L CWHPDAQ YL VV+DL++++ KL++P +RL   D
Sbjct: 186 FVELKFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDD 245

Query: 257 LSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRR 316
           LSI +G AFAP LAK++++SYE+IC  L++DF +EEKMDGERIQ+HY+N G  +KF SRR
Sbjct: 246 LSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRR 305

Query: 317 GIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDEL 376
           GID+++LYG  +  G ISQYLK    V++CVLDGEMV++D  RK+ILPFG+VK +A + L
Sbjct: 306 GIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEAL 365

Query: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436
             +++ N ND + PLYMVFDL+YLNG SLT +PL+ RKEYL  IL P   VVEI++  R 
Sbjct: 366 SFNDINN-ND-FHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRC 423

Query: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496
            DA+++K  ++ AI +GSEGV++K  SS+Y V +RN++W+K+KPEY E+ GE +DL++IG
Sbjct: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIG 483

Query: 497 RDPGKKDSLMCGLLVSDSEHI--LENFGPIE-------HGKEGDP---IIKCVSFCNVAN 544
           RD GKKDS M GLLV D +     +  GP E         +  +P   + K +SFC++AN
Sbjct: 484 RDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIAN 543

Query: 545 GVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS 604
           G+S EEFKEI+RKTRG W       PP S+LEFGSK+P EWI+P  S+V+E+K+RS++N+
Sbjct: 544 GISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNT 603

Query: 605 EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ-YQQAKAAHN-YHRYKRKVHQVSPR 662
           E + ++Y    TL+  YCRRIR DKDWT C ++ + Y+  +   N  H+ +    Q+ P+
Sbjct: 604 ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPSHQVENLQLQLVPK 663

Query: 663 RKRN--VHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTS-QRRRYERGMVAAKVV 719
           +++   V + F+      +S      S +F GL FY+LSDY+ S    R  R  +   +V
Sbjct: 664 KRKRALVSDPFQ------QSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIV 717

Query: 720 KHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIE 779
           KHGG ++ N+ ++   +  +R++  K T ECR L++RGYDI+ P WI DC +    L IE
Sbjct: 718 KHGGKLIHNVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIE 777

Query: 780 PKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDD 839
           P +CF  S +L   +R+RVD +GDSF   +  ++   L                  LQ  
Sbjct: 778 PSYCFSVSGKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQI- 836

Query: 840 LDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTAR 899
               PLFL     +Y+  + + P+   +L  KI L+GG +++    +NL+++P A    R
Sbjct: 837 ---IPLFLFSNRIVYIPRSKIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWR 893

Query: 900 TAYYVQELRQKIAGNAFAGNTNT--RIPHIVRSEWLDTCTTEQCLVPEEDF 948
               ++E+  +I  +  A N++T  RIP IV  EW+D   +E C VPEEDF
Sbjct: 894 -GDCLEEVHSQINEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/946 (45%), Positives = 619/946 (65%), Gaps = 26/946 (2%)

Query: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           EP NFAPSPDF+WLCEELF ++D +  +     GK+ + K  E+++ F+++WR TVG++ 
Sbjct: 10  EPQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNI 69

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L ++S TE RL +WKQ  G+G +LS   
Sbjct: 70  YPALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLL 129

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198
           V+EI+KRR EP   + +TIDG+N  LDEL+K+ S     G   L +S  F  CL+++SF+
Sbjct: 130 VEEIAKRRSEP-NGKAITIDGINSTLDELSKDRS-TSGRGFKNLVKSSPFLHCLESMSFV 187

Query: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258
           EL+YFFDI+LK+RVIGG EHKFL+CWHPDAQ YL VV+DLK+++ KL++P VRL   DL+
Sbjct: 188 ELKYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLT 247

Query: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318
           I +G AFAP LAK++++ YE+IC  L +DF++EEKMDGERIQ+HY+N G  ++F SRRGI
Sbjct: 248 IKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGI 307

Query: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378
           D+++LYG  ++ G IS +L    +VR+CVLDGEMV++D +RK+ILPFG+VK +A D L  
Sbjct: 308 DYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSF 367

Query: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438
           + + N +  + PLY+VFDL+YLNG SLT +PLH RKEYL+ IL+PV +VVE+++  R  +
Sbjct: 368 NSINNVD--FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYN 425

Query: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498
            ++IK  ++ AI +GSEGV++K  +S+Y V +RN++W+K+KPEY E+ GE +DLV+IGRD
Sbjct: 426 VESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRD 485

Query: 499 PGKKDSLMCGLLVSDSEHI----LENFGPIEHGKEGDPII-------KCVSFCNVANGVS 547
           PGKKDS M GLL+ + + +     E    I +  + + I+       K +SFC+VANG+S
Sbjct: 486 PGKKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGIS 545

Query: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYS 607
            EEFKEI+RKTRG W    E  PP S+ EFGSKIP EWI+P  S+V+E+K+RS++N+E +
Sbjct: 546 QEEFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETN 605

Query: 608 SKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYK-RKVHQVSPRRKRN 666
            ++Y    TL+  YC+RIR DKDWT C ++ +   +++A     Y+  K H    R+KR 
Sbjct: 606 MQKYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSARFNPSYQAEKSHLKLVRKKR- 664

Query: 667 VHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAAKVVKHGGLI 725
             E+      + K+E     S IF GL+FY+LSDYVT+    R  RG +   +V+HGG +
Sbjct: 665 -REVLTSNTFDQKTE-QIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRL 722

Query: 726 VKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQ 785
           + NI ++  ++  +R++S K T ECR L+NRGYDI+ P W+ DC++    + IEP +CF 
Sbjct: 723 IYNIILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFN 782

Query: 786 TSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAPL 845
            S+++   + +RVD  GDSF   +  T+   L                  +Q      PL
Sbjct: 783 VSQKMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQ----VFPL 838

Query: 846 FLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAYYVQ 905
           FL     +Y+    +  +    L  KI L+GG +++     NLV++P    T R    ++
Sbjct: 839 FLFSNRIVYIPPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKD-CIK 897

Query: 906 ELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
           E+ ++I     A +T  +IP IV  EW+D      C VPEEDF  +
Sbjct: 898 EVNEQIKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/949 (44%), Positives = 630/949 (66%), Gaps = 30/949 (3%)

Query: 12  DTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQE--LGKAVTVKRVEIITCFIKL 69
           D  K +E +  NFAPSPDF WLCE+LF ++D +   R    L K VT +  E+I+ F  L
Sbjct: 13  DELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYEVISNFTTL 72

Query: 70  WRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAG 129
           WRTTVG++ +PALRL+ PYRD R ++IKD+TLIKA+C  L L +DS TE++L+NWKQ AG
Sbjct: 73  WRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKLINWKQDAG 132

Query: 130 RGTSLSKFCVQEISKRRKEPLPER--QLTIDGLNEKLDELAKEASGKKAWGTTGLSESHS 187
           R   LSKFCV+EI KRR EP  +R  ++TID LN  LD+LA E + ++      L+ S  
Sbjct: 133 RSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERT-EQGRSFKNLANSDI 191

Query: 188 FQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWN 247
              CL +++FLE++YFFDI+LKNR +GG EHK L CWHPDAQ YL VV+DL+ ++K+LW+
Sbjct: 192 MNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLETVAKRLWD 251

Query: 248 PSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGG 307
           PS RL  +DL INIG AFAP LA +LHVSY++I  KL  DF +EEKMDGERIQ+HY N G
Sbjct: 252 PSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFG 311

Query: 308 SVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGI 367
           S +KF SRR  D+++LYG  +  G ++ ++ L  +V+DCVLD E+V++D   KI+LPFG+
Sbjct: 312 SDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGM 371

Query: 368 VKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDV 427
           VKS+A + L  S+ G +  G+ PL MVFD++YLNG +L  +P + R+EYLK+IL+P    
Sbjct: 372 VKSSAKNML--SQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHR 429

Query: 428 VEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLG 487
           +EI+K IRA D + IK  +++A+ +GSEG+I+K+  S Y + +R+D W+KIKPEY E  G
Sbjct: 430 IEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKPEYLEQFG 489

Query: 488 ETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGPI----EHGKEGDPIIK-CVSFCNV 542
           E MDLV++GRDP KKDSLM GLL  D E ++++  PI    +  +E     +  VS C +
Sbjct: 490 ENMDLVLMGRDPSKKDSLMLGLL--DYEEVIQD-SPIMVNSQSSEENSQRFRGFVSLCII 546

Query: 543 ANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVE 602
           ANG+S+EE+KEI+RKT+G W +  EK PPL  ++FGSK+P +WIDPK S+++E+KARS++
Sbjct: 547 ANGISNEEYKEIDRKTKGLW-NDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLD 605

Query: 603 NSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQ--VS 660
           N+  S +++ AG TL   YCR+IR DK+W TC ++ ++++AK+ +N+ +      Q  +S
Sbjct: 606 NTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNWRKRGSSKPQKVIS 665

Query: 661 PRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTS-QRRRYERGMVAAKVV 719
            +R+ N+       A E  +EL+   S IF+G++FY+LSDY    +R+R ++  +   +V
Sbjct: 666 KKRRYNIISSVNK-ALEDFAELEHR-SDIFDGMYFYVLSDYFDGVKRKRIKKSEIQKVIV 723

Query: 720 KHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIE 779
            +GG +V+N+  R  +L+ LRI+S + T+EC +L+ RGYDII P W+FDC+ +G  + +E
Sbjct: 724 ANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWVFDCLLSGKIMKLE 783

Query: 780 PKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDD 839
           P HCF  S++L+D + +R+DQYGD + R ++  E+  L                    + 
Sbjct: 784 PSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSL--TSEKICTTAKQQPDVQFDNS 841

Query: 840 LDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTAR 899
           L + P FL     +++L+ +   Q+ S +   ++ YGG V+  L  ANLV+V  A++  R
Sbjct: 842 LMDVPHFLFHGRIVFLLSDNNNIQKESFM---VDAYGGKVTNELSSANLVIVVGAVTQRR 898

Query: 900 TAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDF 948
               + ++R++I+      +   RIP +V   WL  C  +   V E+++
Sbjct: 899 ----INDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/947 (44%), Positives = 612/947 (64%), Gaps = 29/947 (3%)

Query: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           EP NFAPSPDF+WLCEELF ++  +        GK+ + K  EII+ F+++WR TVG++ 
Sbjct: 10  EPQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNI 69

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L ++S TE+RL +WKQ  G+G +LS   
Sbjct: 70  YPALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLL 129

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKE--ASGKKAWGTTGLSESHSFQFCLKNLS 196
           V+EI+KRR EP   + +TID +N  LD L+ +  ASG+   G   L +S  F  C++N+S
Sbjct: 130 VEEIAKRRAEP-SSKAITIDNVNHYLDSLSGDRFASGR---GFKSLVKSKPFLHCVENMS 185

Query: 197 FLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRD 256
           F+EL+YFFDIVLKNRVIGG EHK L CWHPDAQ YL V++DLK+++ KL++P VRL   D
Sbjct: 186 FVELKYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDD 245

Query: 257 LSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRR 316
           LSI +G AFAP LAK++++SYE+IC  L  DF++EEKMDGERIQ+HY+N G  +KF SRR
Sbjct: 246 LSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRR 305

Query: 317 GIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDEL 376
           GID+++LYG  ++ G ISQ+L+    V++CVLDGEMV++D KR++ILPFG+VK +A + L
Sbjct: 306 GIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEAL 365

Query: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436
             + + N +  + PLYMVFDL+YLNG SLT +PLH RK+YL  ILSP+ ++VEI++  R 
Sbjct: 366 SFNSINNVD--FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRC 423

Query: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496
              ++IK  ++ AI +GSEGV++K  +S+Y V +RN++W+K+KPEY E+ GE +DL+VIG
Sbjct: 424 YGVESIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIG 483

Query: 497 RDPGKKDSLMCGLLVSDSEHILENFGP----IEHGKEGDPII-------KCVSFCNVANG 545
           RD GKKDS M GLLV D E   ++ G     ++H  +   I        K +SFC++ANG
Sbjct: 484 RDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANG 543

Query: 546 VSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSE 605
           +S EEFKEI+RKTRG W    E  PP S+LEFGSKIP EWIDP  S+V+E+K+RS++N+E
Sbjct: 544 ISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTE 603

Query: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKR 665
            + ++Y    TL+  YC+RIR DK+WT C ++    +++   +   Y+ +  Q+   RK+
Sbjct: 604 TNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPSYQAERSQLGLIRKK 663

Query: 666 NVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAAKVVKHGGL 724
               +      + + +L    S+IF GL FY+LSDYVT     R  R  +   +V+HGG 
Sbjct: 664 RKRVLISDSFHQNRKQLPI--SNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721

Query: 725 IVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCF 784
           ++ N+ ++   +  +R++S KTT EC+ L++RGYDI+ P W+ DCI+    + IEP +CF
Sbjct: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781

Query: 785 QTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAP 844
             S+++   + +RVD  GDSF   +  T+   L                  +  ++   P
Sbjct: 782 NVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELE----IDSEVRRFP 837

Query: 845 LFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTARTAYYV 904
           LFL    +I  +    I  +  I+  KI+L+GG +++     NL+++P      R    +
Sbjct: 838 LFLFSN-RIAYVPRRKISTEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKD-CM 895

Query: 905 QELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
            E+ +KI     A +T  +I  +V  EW+D    E C VPEEDF  +
Sbjct: 896 NEVHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/943 (45%), Positives = 601/943 (63%), Gaps = 23/943 (2%)

Query: 21  PHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFP 80
           P NFAPSP F+WLCEELF +L+ +   R    K +T++  EIIT F+ LWRTTVGDD +P
Sbjct: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70

Query: 81  ALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFCVQ 140
           AL L  PYRD R Y++KD+TLIKA+C  L L ++S TE+RLLNWKQ A R   LS  CV 
Sbjct: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130

Query: 141 EISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFLEL 200
           E+ KR+ EP+ +  +T+D LN  LD L+++    K  G   LSES  F +C++ +SF+EL
Sbjct: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQD-RNIKGRGYKNLSESSIFTYCIEKMSFMEL 189

Query: 201 RYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSIN 260
           RYFFDI+LK RVIG  EHK L  WHPDA+ YL VV+DLK +  +LWNP++RL   +LSIN
Sbjct: 190 RYFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSIN 249

Query: 261 IGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDF 320
           IG+AFAPHLAK+L +SY++IC KLK+DF +EEKMDGERIQ+HY++ G+ +KFLSRRG+D+
Sbjct: 250 IGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 321 SHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSE 380
           ++LYG+ ++ G I+ YLKL  DV++CVLDGEMV+YD+ + I+LPFG+VKSAA++ L   E
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 381 VGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAK 440
           +  ++  Y PL MVFDLV+LNG SL + PL+ RK+YL  +L P    V+I+   R  +  
Sbjct: 370 ISGQD--YHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNEN 427

Query: 441 AIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRDPG 500
            I+  ++ AI +GSEG+++K  +S Y +G+RND W+KIKPEY E  GE MDL+VIGRD  
Sbjct: 428 IIRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSA 487

Query: 501 KKDSLMCGLLVSDSE-------------HILENFGPIEHGKEGDPIIKCVSFCNVANGVS 547
           KKDS  CGL V D E             +++ +    E+ +    I K VSFC +ANG+S
Sbjct: 488 KKDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGIS 547

Query: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYS 607
             E+KEI RKTRG W   +E PPP  L+EFG+++P+EWI+P++SVV+E+KARS++N+E S
Sbjct: 548 QNEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESS 607

Query: 608 SKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKRNV 667
            KR++AG TL+  YCRRIR+D DW +  S+A+ ++ +   +Y     K   +  +++R  
Sbjct: 608 CKRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRKK 667

Query: 668 HEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYV-TSQRRRYERGMVAAKVVKHGGLIV 726
             +          ++ T  S IF+GL FYILSDY  T++  R  +  +   ++++GG I 
Sbjct: 668 QLLTPLNQNLNPRDIQT-TSKIFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726

Query: 727 KNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQT 786
            NI  + E  S LRI+ GK T EC  L+ RGYDI+ P W+ DC+     + IEP HCF  
Sbjct: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786

Query: 787 SRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAPLF 846
           S  L+  + +RVD+YGDS+   L  +    +                  L  D ++ P F
Sbjct: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSL--DFEKVPYF 844

Query: 847 LLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSA-LSTARTAYYVQ 905
           L  R K +V+  +           KI+LYGG V + +   N+V+ P A ++  R +  ++
Sbjct: 845 LFWRRKAFVMEHNFDKSSIRETILKIQLYGGKVVKNISECNIVIFPKAEITVIRES--MK 902

Query: 906 ELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDF 948
            +R  +A           +P IV  EW+D    +   VPEED+
Sbjct: 903 FIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDY 945

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/955 (45%), Positives = 610/955 (63%), Gaps = 43/955 (4%)

Query: 20  EPHNFAPSPDFRWLCEELFHRLDAIN-EHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           EP NFAPSPDF+WLCEELF R+D +        GK+ + K  EII+ F++ WR  VG++ 
Sbjct: 10  EPQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNI 69

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           +PAL L  PYRD R Y+IKD+ LI+ +C  L L R+S+TE+RL +WKQ   R  +LS   
Sbjct: 70  YPALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLL 129

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198
           V+EI+KRR EP   + +TIDG+N+ LDEL+KE S     G   L  S  F  CL+++SF+
Sbjct: 130 VEEIAKRRPEP-NGKSITIDGVNDYLDELSKERS-ISGRGFKDLVNSKPFLSCLESMSFV 187

Query: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258
           EL+YFFDIVLKNRVIGG EH+FL CWHPDAQ YL VV+DLK+++ KL++P VRL   DLS
Sbjct: 188 ELKYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLS 247

Query: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318
           I +G AFAP LAK++ + YE+IC  L +DF++EEKMDGERIQ+HY+N G  +KF SRRGI
Sbjct: 248 IKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGI 307

Query: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378
           D+++LYG  ++ G ISQYLKL + V++CVLDGEMV++D  RK+ILPFG+VK +A   L  
Sbjct: 308 DYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSC 367

Query: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438
           S++ N +  +RPLYMVFDL+YLN +SL  +PLH RK+YL  IL+P  +VVEI++  R  D
Sbjct: 368 SDINNSD--FRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYD 425

Query: 439 AKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGRD 498
            +++KN ++ AI +GSEGV++K  +S+Y + +RN +W+K+KPEY E+ GE +DL++IGRD
Sbjct: 426 VQSVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRD 485

Query: 499 PGKKDSLMCGLLVSDSEHILENFGPIEHGK-------EGDPI------IKCVSFCNVANG 545
            GKKDS M GLLV D   + E    +   +       E D I       K +SFC+VANG
Sbjct: 486 SGKKDSFMLGLLVIDEREMEERDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFCSVANG 545

Query: 546 VSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSE 605
           +S EEFKEINR+TRG W    +  PP S+L+FGS+IP EWI+P +S+V+E+K+RS++N+E
Sbjct: 546 ISHEEFKEINRRTRGHWKRTSDFSPP-SILQFGSRIPAEWIEPSDSIVLEIKSRSLDNTE 604

Query: 606 YSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQ---AKAAHNYHRYKRKVHQVSPR 662
            S +RY    TL+  YCRRIR DKDWT C ++AQ  +    K+  N      ++     +
Sbjct: 605 TSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPNQQDENFQLQLAHKK 664

Query: 663 RKRNV-----HEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRR-RYERGMVAA 716
           RKR +     H+I E              SSIF GL FY+LSDYVT     R  R  +  
Sbjct: 665 RKRALISDPFHQIRE----------QKLISSIFAGLFFYVLSDYVTKDTGVRITRAGLED 714

Query: 717 KVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQL 776
            +VKHGG ++ N+ ++   +  +R++S KTTIECR L++RGYDI+ P W+ DCI+    +
Sbjct: 715 AIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774

Query: 777 GIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXML 836
            IEP +CF  S +L + + +RVD  GDSF   +   +   L                  +
Sbjct: 775 FIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIG----I 830

Query: 837 QDDLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALS 896
             +    PLFL     +Y+       ++  +L  KI L+GG ++      NL+++P  + 
Sbjct: 831 DSEAQVIPLFLFSNRIVYIPRTKTGLREEKLLEMKIRLFGGEITGQQSLCNLIIIP-YVD 889

Query: 897 TARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
           ++R    ++++ ++I     A +T  ++  IV   W+D    E C VPEEDF  +
Sbjct: 890 SSRRKDCIEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/960 (45%), Positives = 609/960 (63%), Gaps = 32/960 (3%)

Query: 9   SETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG--KAVTVKRVEIITCF 66
           S+ DT+ I E  PHNF+PSPDF+WLC+ELF +LD I    +EL   K   ++  +II  F
Sbjct: 21  SKADTNDIEE--PHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNF 78

Query: 67  IKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQ 126
           I +WR TVG+D +PAL L  PYRD R Y+IK+  LI+ VC  L L ++S TERRL+ WK 
Sbjct: 79  IDIWRRTVGNDIYPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKH 138

Query: 127 YAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESH 186
            A R   LS FCV+EI KR+ EP  + ++TID LNE LD L  E  G K   +  +SES 
Sbjct: 139 RADRNVRLSTFCVEEIKKRKGEPREKIKITIDKLNECLDNLVLE-RGYKGSKSQKISESE 197

Query: 187 SFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLW 246
           +F+FC +N++++EL+YFFDI+LK++++GGLEHKFL CWHPDAQ YL VV+DLKI+S KLW
Sbjct: 198 TFKFCFENMTYVELKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLW 257

Query: 247 NPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNG 306
           NP  RL   DL+INI HAF P  AKRL  SY+ I  +LK+DF +EEKMDGERIQLHY+N 
Sbjct: 258 NPEFRLKYDDLTINIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNY 317

Query: 307 GSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFG 366
           G+ LKFLSRRG+D+S+LYG     G I +YL    DV++C+LDGEMV+YD  +  ILPFG
Sbjct: 318 GAKLKFLSRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFG 377

Query: 367 IVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPD 426
           +VKS+A+  L  S++  E DGY PLYM FDLVYLNG SL+ +PLH RK YL ++L P PD
Sbjct: 378 LVKSSAMQSLSVSDI--EPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPD 435

Query: 427 VVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDL 486
            VEIL  +   D+  IK+ +++AIE+GSEG+I+K+  S Y V  R+D W+KIKPEY E  
Sbjct: 436 FVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQF 495

Query: 487 GETMDLVVIGRDPGKKDSLMCGLLVS---DSEHILE-NFGPIEHGKE--GDPIIKCVSFC 540
           GE MDL+VIGRDPGKKDSLMCGL+++   + E I   +  P +  +        K +SFC
Sbjct: 496 GENMDLIVIGRDPGKKDSLMCGLILTGDNEPEEITSLDSNPTDTAESFLKPDKRKIISFC 555

Query: 541 NVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARS 600
           N+ANG+S +EF++I+R T G W+ + ++ PP  L EFG+K P+EWI P++SVV+E+KARS
Sbjct: 556 NIANGISQKEFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARS 615

Query: 601 VENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAK----AAHNYHRYKRKV 656
           +E +E +  +Y  GSTL   YCR+IR DKDW +C +  ++ +++    A  NY   K  +
Sbjct: 616 LETNESARIKYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLI 675

Query: 657 HQVSPRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVT-SQRRRYERGMVA 715
            +    +KR  + + E    E   +   E + IF GLHFY++SDY+  +   R  +  + 
Sbjct: 676 GRKKRPKKRMFNSLTE--IFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLC 733

Query: 716 AKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQ 775
             V++H G +V N   R + L+ LRI+S K T E  +L+ RGYDII P WI DCIS    
Sbjct: 734 NLVLEHNGKLVHNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKL 793

Query: 776 LGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXM 835
           + + P HCF  S  L++ ++ RVD+YGDS+   L   +F+ L                  
Sbjct: 794 VRLLPSHCFNVSSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQVLKSESADKRITE- 852

Query: 836 LQDDLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSAL 895
             ++  + P+ L    + ++    L       L+ K+ELYGG +   +   N+++  +  
Sbjct: 853 -GENHLKIPILLFCNRRFFI-PETLPSTPIYELKSKVELYGGKLVNKISDCNVIVFTNTH 910

Query: 896 STARTAYYVQELRQKIAGNAFAGNTNTR----IPHIVRSEWLDTCTTEQCLVPEEDFSSI 951
           +  R     +E+ +KI       + N+     +P IV + W+D C +E   VPEED+ ++
Sbjct: 911 TENR-----KEVMKKIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/951 (43%), Positives = 602/951 (63%), Gaps = 24/951 (2%)

Query: 18  ENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG-KAVTVKRVEIITCFIKLWRTTVGD 76
           E  P NFAPSPDF+WLC+ELF + D +    + +  K +TV+  E+++ F++LWR TVG+
Sbjct: 6   EEGPTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGN 65

Query: 77  DFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSK 136
           +F+P L L  PYRD R Y+IKD TLIKA+C  L+L + S TE++LLNWKQ A R   LS 
Sbjct: 66  NFYPVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSS 125

Query: 137 FCVQEISKRRKEPLPERQ--LTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKN 194
           FCV EI KR+  P P ++  +T+D LN  LD+LA   S +   G+  L++S  F+FCL+N
Sbjct: 126 FCVAEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSR-GQGSRTLADSSHFKFCLEN 184

Query: 195 LSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDK 254
           +SF+EL+YFFDI+LK R+IGG EHK L  WHPDA  Y  VV+DL  ++KKL+ PSVRL  
Sbjct: 185 MSFIELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRN 244

Query: 255 RDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLS 314
            DL++ IG AFAPHLAKRL++SYE+I  KL  DF +EEKMDGERIQ+HY++ G+ +KFLS
Sbjct: 245 EDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLS 304

Query: 315 RRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD 374
           RRG D+++LYG + + G I+ YLKL  +V++C+LDGEMV+YD+++++ILPFG+VKS+A +
Sbjct: 305 RRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKN 364

Query: 375 ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGI 434
            L    +   N  Y PL+M FDLVYLNG SL  +PL+ RK+YL +IL+     V+I+   
Sbjct: 365 FLSKESIS--NGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFA 422

Query: 435 RACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           R  + ++I   +  AI +GSEG+I+K+ +S Y V +RND W+KIKP+Y +  GE MDL++
Sbjct: 423 RCNNLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLII 482

Query: 495 IGRDPGKKDSLMCGLLVSDSE---HIL---ENFGPIEHGKEGDP-------IIKCVSFCN 541
           IGRDPGKKD+ MC L V+  +    +L   EN       ++ +P       I+K VSFC 
Sbjct: 483 IGRDPGKKDAFMCALGVTIDDPQPRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCT 542

Query: 542 VANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSV 601
           +ANG+S+ EFKEI++KTRG W  + +  PP   L+FG+K PVEWIDPK S+V+EVK+RS+
Sbjct: 543 IANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSL 602

Query: 602 ENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAH--NYHRYKRKVHQV 659
           +N+E + K+YRAG TL   YCR +R DKDWTTC +V+++++ +       +  +      
Sbjct: 603 DNTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYKLPKVNAGESITTSN 662

Query: 660 SPRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQR-RRYERGMVAAKV 718
             R+KRN   I    +   K   + E S IF+ LHF +LSDY+      R +R  +   +
Sbjct: 663 KGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLI 722

Query: 719 VKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGI 778
           + +GG ++ N+  +      LRI+     +EC  L+ RGYDI+ P W+ DCI +   L +
Sbjct: 723 IDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKL 782

Query: 779 EPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQD 838
           E  HCF  S+ L++ S  RVD+Y DSF   + TT   +L                 +  +
Sbjct: 783 ERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENLDFE 842

Query: 839 DLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGANLVLVPSALSTA 898
                PL    R  +++    L  + ++ +  + +L+GG V+ T+E  NL+++P+     
Sbjct: 843 LRGLPPLLFFDR-SVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDED 901

Query: 899 RTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEEDFS 949
           +    +Q++R K+A      N+  RIP IV  EWL     E   VPEE++S
Sbjct: 902 KIQ-VLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYS 951

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/968 (42%), Positives = 607/968 (62%), Gaps = 35/968 (3%)

Query: 8   PSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQE------LGKAVTVKRVE 61
           P  T T +     P NFAPSPDF+WLC+ELF ++D I E  +         K ++ +  +
Sbjct: 10  PVSTTTKESPATTPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFD 69

Query: 62  IITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRL 121
            IT FIKLWRTT+GDD FPALRL+ PYRD R Y+IKD TLI+A+C  L L ++S+ ERRL
Sbjct: 70  TITHFIKLWRTTIGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRL 129

Query: 122 LNWKQYAGRGTSLSKFCVQEISKRRKEPLPER--QLTIDGLNEKLDELAKEASGKKAWGT 179
           + WK  A R  +L+ FC+ EISKR+ EP   +  +++ID LNE LD+L            
Sbjct: 130 IRWKYKADRYETLATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKR 189

Query: 180 TGLSESHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLK 239
           + L +  +F+FCL+N++F+EL+YFFDI++KN+++G LE+ FL  WHPD++ YL VV+DL+
Sbjct: 190 SNLLQVETFKFCLENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLR 249

Query: 240 ILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERI 299
            LS KLWNPS++++  DLSI +G+ FAP LAKRL +SY+ I ++L +DF +EEKMDGERI
Sbjct: 250 TLSNKLWNPSIKINNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERI 309

Query: 300 QLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKR 359
           QLHY+N G  +KF SR G D+++LYG + + G I+++L+L  +V++CVLDGEMV++D   
Sbjct: 310 QLHYMNYGETVKFFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTS 369

Query: 360 KIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKE 419
           K +LPFG+VKS+A  +L   ++  +ND + PL+MVFD++YLNG SL  +PL  RKE+L  
Sbjct: 370 KKVLPFGLVKSSASSQLNKKDI--DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNT 427

Query: 420 ILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIK 479
           +L+P  D VEIL  IR  D+  IK  +  AI +GSEG+++KQ  S Y   AR+++W+K+K
Sbjct: 428 VLTPYKDYVEILSSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVK 487

Query: 480 PEYFEDLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHIL-ENF---GPIE---------- 525
           PEY E+ GE MDL+VIGRD GKKD L+CG+LV++ +  L EN      IE          
Sbjct: 488 PEYLEEFGENMDLIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDL 547

Query: 526 HGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEW 585
             K    I K +SFC +ANG+S  E KEINR TRG+W +Y  + PP+ +LEFG+K PVEW
Sbjct: 548 DTKPSQGIKKVISFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEW 607

Query: 586 IDPKNSVVIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSV--AQYQQA 643
           I P++SVV+E+KARS++ ++ +  +Y  G TL+  YCR+IR DKDWT+C ++    Y + 
Sbjct: 608 IYPQDSVVLEIKARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDLTYNEI 667

Query: 644 KAAHNYHRYKRKVHQVSPRRKRNVHEIFEYCAGEAKSELDTEG-SSIFEGLHFYILSDYV 702
           K     ++ K+ + +   R+K  +       AG   +  D    S +F GL+FYI+SDY+
Sbjct: 668 KRHEKKNKNKQTLIRSYSRKKSKIIS----PAGMLPNGTDLRLISDLFHGLYFYIISDYI 723

Query: 703 -TSQRRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDII 761
             S  +R +R  + + ++K+GG ++ N+  +   +S LRI+S K+TIEC +LV RGYD+I
Sbjct: 724 PDSDAQRIDREDICSLIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVI 783

Query: 762 DPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXX 821
           +  W+FDC+ AG  L +EP HC   S  LL  +  R+D++GDS+   L  ++  +L    
Sbjct: 784 NLSWLFDCLQAGVILPLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSN 843

Query: 822 XXXXXXXXXXXXXMLQDD-LDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVS 880
                        + +D+ +D  P+FL    K +++  D++      L  +I+LYGG + 
Sbjct: 844 INKVNRSNSNLLLINKDEGVDSIPIFLFTNRKFFLIKEDILLGDRDTLIFQIKLYGGSLV 903

Query: 881 ETLEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQ 940
             LE  N+++      +      + +LR K+       N    IP  V   W+       
Sbjct: 904 TKLEDCNIIV--GVCGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAG 961

Query: 941 CLVPEEDF 948
             +  ED+
Sbjct: 962 YQLSPEDY 969

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/969 (42%), Positives = 607/969 (62%), Gaps = 44/969 (4%)

Query: 5   GKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIIT 64
           G  P+        +  P NF+PSPDF WLC+ELF +L+ +   +++LGK   V+ +EI +
Sbjct: 35  GGTPTGEHEINAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITS 94

Query: 65  CFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNW 124
            F+ LWR TVG+D +PAL L  PY D R+Y +KD TL+KA+CK + L R+S TERRLL+W
Sbjct: 95  NFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHW 154

Query: 125 KQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSE 184
           KQ A RG  LS FCV+E+ KRR+EP+  ++++ID +N  LD+L  E++  K W    L+E
Sbjct: 155 KQNAPRGVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGK-WSYISLAE 213

Query: 185 SHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKK 244
           S +F +CL+++S++ELR+FFDIVLK  ++ GLE   L+CWHPDA+ Y  VV+DL+I++  
Sbjct: 214 SPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHT 273

Query: 245 LWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYV 304
           L++P+ RL+K DLS+ IG+AFAPH+A+R+ + YE++ +KL +DF +EEKMDG+RIQ+HY+
Sbjct: 274 LYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYM 333

Query: 305 NGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILP 364
           + G+ + + SR GI++++LYG+  ++G IS +LK    V++C+LDGEMVSYDK+ + ILP
Sbjct: 334 DYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILP 393

Query: 365 FGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPV 424
           FG+ KS A  ++     G+    YRPLY VFDL+YLNG  LT   +  RKEYL++IL P 
Sbjct: 394 FGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPS 453

Query: 425 PDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFE 484
            +VV +L G R  DA+AI   +  A+  GSEG+++K+A S Y VG R+D W+KIKPEY E
Sbjct: 454 KNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLE 513

Query: 485 DLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGP------IEHGKEGDPII---- 534
           + GE MDLVVIGRD G+KDS +C L V+D     E   P       +   + +PII    
Sbjct: 514 NFGENMDLVVIGRDKGRKDSFICALAVTDDS---EKNNPSSYESGSDSDSDSEPIIVQPK 570

Query: 535 --KCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSV 592
             K +SFC++ANG+S+EEFKEI+R TRG+W  Y E+ PP   +EFG+K P EWIDPKNSV
Sbjct: 571 IEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSV 630

Query: 593 VIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRY 652
           V+EVKARS++N E  S  Y+ GSTL++AYC+RIR+DK+W+T ++VA+Y  A+ A +Y   
Sbjct: 631 VLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNV 690

Query: 653 KRKVH----QVSPRRKRNVHEIFEYCAGEAKSELDTEGSS---IFEGLHFYILSDYVTSQ 705
            +       + SPR++R  H +          ++D    S     +G +FY+ S Y   Q
Sbjct: 691 SQNAKFGKDRSSPRKRRTFHLV---------GDIDVTKPSKADFLKGYYFYVTSGYFDLQ 741

Query: 706 -RRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPC 764
            ++  +   +   VV  GG  + N+ +R   L  L I+  K T E + L+ RGYDII P 
Sbjct: 742 SKKNIDASEIGEAVVSCGGTYIHNLRIRAS-LDKLYILGCKDTRELKMLIERGYDIIHPE 800

Query: 765 WIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXX 824
           W+ DC+  G  L IEPK+ +  S  L+  +R + D+YG+S+  P+     + L       
Sbjct: 801 WLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKAL-----AN 855

Query: 825 XXXXXXXXXXMLQDDLDEAP-LFLLQRFKIYVLAADLIPQQFS-ILRRKIELYGGVVSET 882
                     M  D + E   L + + +  Y+L        +S I++  IE  GG V+  
Sbjct: 856 KQVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTND 915

Query: 883 LEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCL 942
           LE A +V+   A+    +   +Q +R  I       N    IP IV SEW++ C   Q L
Sbjct: 916 LELATIVV---AVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYL 972

Query: 943 VPEEDFSSI 951
           V E+++++I
Sbjct: 973 VDEDEYAAI 981

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/964 (42%), Positives = 596/964 (61%), Gaps = 39/964 (4%)

Query: 17  SENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELG-KAVTVKRVEIITCFIKLWRTTVG 75
           SE EP NF+PSPDF+WLC ELF +LD +    + +  +   ++   +I  FI LWR TVG
Sbjct: 12  SEREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINNFIHLWRVTVG 71

Query: 76  DDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLS 135
           +D +PALRL+ PYRD R Y+I++ TLI+ VC  L L ++S+TE+RL  WKQ A R  +LS
Sbjct: 72  NDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWKQKARRSINLS 131

Query: 136 KFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKE-ASGKKAWGTTG--LSESHSFQFCL 192
            FC+QEI KR  EP+ + ++TID LN  LD L+ E +S K   G++G  LS+  S ++C 
Sbjct: 132 SFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKLSQLESIKYCF 191

Query: 193 KNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRL 252
           +N+SF+EL YFFDI++K R+IGGLEHKFL  WHPDA  YL VV++L I+++KLWNP+ RL
Sbjct: 192 ENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVTEKLWNPNFRL 251

Query: 253 DKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKF 312
           + +DL+I + +AF P LAK++++SYE +  ++ + F +EEKMDGERIQ+HY++ G  +K+
Sbjct: 252 NSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKY 311

Query: 313 LSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAA 372
            SRRG D+++LYG++ +   IS+YL+L  DV++C+LDGEMVSYDK R  ILPFG+VKS A
Sbjct: 312 FSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGA 371

Query: 373 VDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILK 432
            + L     G END   PL++VFD+++LNG  LT +PL+ RKEYL  IL+P    +EILK
Sbjct: 372 ANSL--KIDGLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILK 429

Query: 433 GIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDL 492
              A D+++I++ +Q AI +GSEG+++K+  S Y VG RN+ W+K+KPEY E  GE +DL
Sbjct: 430 FSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDL 489

Query: 493 VVIGRDPGKKDSLMCGLLVSDSEHILE------------------NFGPIEHGKEGDPII 534
           +VIGRDPGKKDSLMCG+ V ++E   E                  N  P +       I 
Sbjct: 490 IVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRIT 549

Query: 535 KCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVI 594
           K +SFC +ANG+S+EEFKEI+RKT G W  + ++ PP   LEFG+++PVEWI+P +SVV+
Sbjct: 550 KFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVL 609

Query: 595 EVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKR 654
           EVKARS+EN+E    +++ G TL+ AYCRRIR DKD+  C +   +     A N  R   
Sbjct: 610 EVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFNDCYT---FSDLVIATNKKRSSS 666

Query: 655 KVH--QVSPRRKRNVHEIFEYCAGEAKSELDTEG--SSIFEGLHFYILSDYVTSQ---RR 707
           +++      ++KR+              + D  G  S IF+GL F+++SDYV S    R 
Sbjct: 667 ELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTSKIFDGLSFFVISDYVDSNSSFRL 726

Query: 708 RYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIF 767
           R +  +   KV  +GG ++ N+  +  +  Y+RI+S K T EC  L+ RGYDII P WI 
Sbjct: 727 RIDELINIIKV--NGGQLIFNLVSQNLNEKYVRIMSCKKTFECNELIKRGYDIIHPKWIL 784

Query: 768 DCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXX 827
           DCI+    L  EP HCF  S+ L   S+QRVD  GDS+ + +   E + L          
Sbjct: 785 DCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSYQKYITEEELELL--ISSKTPKE 842

Query: 828 XXXXXXXMLQDDLDEAPLFLLQRFKIYVLAADLIPQQFSILRRKIELYGGVVSETLEGAN 887
                       +++ P+FL    K Y        +        I+LYGG     +   N
Sbjct: 843 QLYSNPLQFDQQIEKIPIFLFSNKKAYTPKQCFSEKLLKETNLYIKLYGGTSVNNINDCN 902

Query: 888 LVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCLVPEED 947
           ++++    S +     +  +R++++ +A + N    IP IV  +W++    +   V EED
Sbjct: 903 VIIIGDEHSKSSNE-KISSIRKELSIHAVSSNNVIPIPRIVSYKWIEKSIAQGTQVVEED 961

Query: 948 FSSI 951
           F  I
Sbjct: 962 FPII 965

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/922 (44%), Positives = 587/922 (63%), Gaps = 43/922 (4%)

Query: 19  NEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIITCFIKLWRTTVGDDF 78
           N+  NF+PSP+F+WLC+EL  ++   +  +  +GK VTV+ +EIIT FIKLWR+TVG+  
Sbjct: 2   NDCENFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYI 61

Query: 79  FPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNWKQYAGRGTSLSKFC 138
           +PALRL+ P+RD R Y++K+ TLIKA+C+ L L + S TE RLL WKQ A RG  LS FC
Sbjct: 62  YPALRLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFC 121

Query: 139 VQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSESHSFQFCLKNLSFL 198
           V+EI KR+K+     ++TID LN  LDE+++E +GK+  G   L++S +F +CL +++F+
Sbjct: 122 VEEIRKRQKDYEGANRITIDELNGYLDEVSQEGNGKRM-GYMALTDSRAFNYCLNHMTFM 180

Query: 199 ELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLS 258
           E+++FFDI+LK RV+ GLE+ FL  WHPDA  YL VV+DL +LS++L+NP+ RL + DLS
Sbjct: 181 EMKFFFDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLS 240

Query: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318
           I I HAF P LAKR H+SYER+ SKL+HDFI+EEKMDGER+Q+HY+N G  +K+LSRRG+
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGV 300

Query: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378
           DFS+LYG+  + G IS  LKL  +V+DC+LDGEM++YD ++ I+LPFG+VKS+A+++ I 
Sbjct: 301 DFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQ-IQ 359

Query: 379 SEVGN--ENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436
           SE+      + Y+PL++ FDLVYLNG SLT + L  RK+YL +IL+PV   VEI++ ++A
Sbjct: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419

Query: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIG 496
            +A+AIK+ +++AI MGSEG+++K   S Y VG+RN  W+KIKPEY E  GE MDL++IG
Sbjct: 420 INAEAIKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIG 479

Query: 497 RDPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
           R+ GKKDS  CGL +SD   + E               + +SFC +ANG+S+EEFK+I R
Sbjct: 480 REQGKKDSFFCGLSISDPNEVAEK-------------PRFISFCTIANGLSNEEFKDIER 526

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRYRAGST 616
           KT G W  + E PP  +LL FG+K+P EWI P++SVV+EVKAR+++  E   ++YR+G T
Sbjct: 527 KTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYRSGCT 586

Query: 617 LHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRYKRKVHQVSPRRKRNVHEI-FEYCA 675
           LH  YC++IR DKDW T  S ++++  K A N++  KRK HQV+  +KR           
Sbjct: 587 LHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYN-KRKSHQVTDGKKRASKRAKIGIVN 645

Query: 676 GEAKSELDTEGSSIFEGLHFYILSDYV-TSQRRRYERGMVAAKVVKHGGLIVKNIDMRPE 734
               + L    S+ F    F ++SDY  +++RRR  +  + + +++HGG IV   D    
Sbjct: 646 SSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIVYTSDENNL 705

Query: 735 HLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQLGIEPKHCFQTSRRLLDNS 794
               L I+  K T EC+ L+N    II P WIF CI  G++        F   R  L++S
Sbjct: 706 PQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIF---RGELESS 762

Query: 795 RQRVDQYGDSFSRPLDTTEFQQLXXXXXXXXXXXXXXXXXMLQDDLDEAPLFLLQRFKIY 854
                 Y D      +T     L                      L E PLFL    K+ 
Sbjct: 763 MDCSQFYTD-----FNTASLNHLLETANRGIKNPDSDLL------LPEVPLFLFSNLKLA 811

Query: 855 VLAADLIPQQFSILRRK--IELYGGVVSETLEGANLVLVPSALSTARTAYYVQELRQKIA 912
           VL ++ +    SIL  +  I+ +GG +   +E A++++V +   +    +    LRQKIA
Sbjct: 812 VLNSENVLDT-SILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLF---SLRQKIA 866

Query: 913 GNAFAGNTNT--RIPHIVRSEW 932
             A   +T +  RIP +V   W
Sbjct: 867 SKAVKESTESTPRIPRMVDISW 888

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  120 bits (300), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 102/392 (26%), Positives = 174/392 (44%), Gaps = 44/392 (11%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E + +    +FI E K DGER Q+H + GG  ++  SR G + +
Sbjct: 356 GIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE-MRIYSRNGENMT 414

Query: 322 HLYGQEVARGVISQYLKLKSD---------VRDCVLDGEMVSYDKKRKIILPFGIVKSAA 372
             Y +   +  +     + +D         V+D +LD E+V++D ++K ILPF ++ +  
Sbjct: 415 ERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRK 474

Query: 373 VDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILK 432
                   V  ++   R     FDL+YLN   +    L  R+E L+++   VP   +   
Sbjct: 475 -----RKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEFQYAT 529

Query: 433 GIRACDAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGET 489
            +   D   ++ F+ +A++   EG++VK      S YE   R+ +W+K+K +Y + +G++
Sbjct: 530 SLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDS 589

Query: 490 MDLVVIGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVS 547
           +DLVV+G     GK+     G L+       + F                + C +  G S
Sbjct: 590 LDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFE---------------TCCKIGTGFS 634

Query: 548 DEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS--- 604
           DE    ++   + + +      PP++ +   S  P  W   K  V+ EV    +  S   
Sbjct: 635 DEMLGNLHTLLQPTEIDN----PPMTYIYDSSAEPDVWFQAK--VLFEVLTADLSLSPVY 688

Query: 605 EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTS 636
           +  + RY  G +L      RIR DKD T  T+
Sbjct: 689 KAGNSRYDKGISLRFPRFLRIREDKDVTDGTT 720

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  113 bits (282), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 105/398 (26%), Positives = 175/398 (43%), Gaps = 57/398 (14%)

Query: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318
           +  G    P LAK      E +       F  E K DGER Q+H +  G++ +  SR   
Sbjct: 327 LTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTI-RIYSRNSE 385

Query: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD--EL 376
           + +  Y  E+      Q+L      R  ++D E V++D +++ ILPF ++ +      EL
Sbjct: 386 NMTERY-PEIQ---FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVEL 441

Query: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436
            + +V       R     FDL+YLNG SL K  L  R+++L  +L  VP  ++    I  
Sbjct: 442 KDVKV-------RVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITT 494

Query: 437 CDAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLV 493
            +   ++ ++++++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL 
Sbjct: 495 MELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLA 554

Query: 494 VIGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEF 551
           V+G     GK+     G L+      LE F                + C +  G S+E  
Sbjct: 555 VLGAYYGRGKRTGTYGGFLLGCYNPDLEEFE---------------TCCKIGTGFSEEVL 599

Query: 552 KEINRKTRGSW-------VSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS 604
           + ++ + + +        VSY +  PP             W +P  +++ EV    +  S
Sbjct: 600 QSLHAQLKDTVIAAPRGDVSYDDSSPPDV-----------WFEP--AMLFEVLTADLSLS 646

Query: 605 E-YSSKR--YRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
             Y + R  Y  G +L      RIR DK  T  TS  Q
Sbjct: 647 PVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQ 684

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 99/390 (25%), Positives = 174/390 (44%), Gaps = 39/390 (10%)

Query: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317
           S+  G    P LAK      E +       F  E K DGER Q+H +  G+ ++  SR G
Sbjct: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGT-MRIYSRNG 452

Query: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377
            + +  Y  E+    I  ++K +++ +  +LD E V++DK+++ ILPF ++ +    +++
Sbjct: 453 ENMTERY-PEIH---IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508

Query: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437
             +V       R     FD++  N   L    L  R+E L  + +P P   +    +   
Sbjct: 509 AKDVK-----VRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTS 563

Query: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           +   ++ F+ +++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 564 NLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 623

Query: 495 IGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552
           +G     GK+     G L+       +N G  E            + C +  G SDE  +
Sbjct: 624 LGAYYGRGKRTGTYGGFLLGCYN---DNTGEFE------------TCCKIGTGFSDEMLQ 668

Query: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609
           +++ K + + +      P  + +   S  P  W +P  S++ EV    +  S   +  S 
Sbjct: 669 QLHEKLKATVID----GPKATYIYDSSAEPDVWFEP--SLLFEVLTADLSLSPIYKAGSS 722

Query: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            Y  G +L      RIR DK     TS  Q
Sbjct: 723 AYDKGVSLRFPRFIRIREDKGVEDATSSEQ 752

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 101/395 (25%), Positives = 168/395 (42%), Gaps = 47/395 (11%)

Query: 257 LSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRR 316
           + +  G    P LAK      E + +     F  E K DGER Q+H +  GS ++  SR 
Sbjct: 348 IKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGS-MRIYSRN 406

Query: 317 GIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDEL 376
           G D +  Y +      I  YL   +     +LD E V++D + + ILPF ++ +      
Sbjct: 407 GEDMTQRYPELN----IQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRK---- 458

Query: 377 INSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRA 436
               V  ++   R     FD++  N  SL    L  R++ L  I  P P   +    +  
Sbjct: 459 -RKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTT 517

Query: 437 CDAKAIKNFMQRAIEMGSEGVIVKQASST---YEVGARNDHWVKIKPEYFEDLGETMDLV 493
            +   ++ F+ +AI+   EG++VK    T   YE   R+ +W+K+K +Y + +G+++DL 
Sbjct: 518 SNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLC 577

Query: 494 VIGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEF 551
           V+G     GK+     G L++      E F                + C +  G SDE  
Sbjct: 578 VLGAYYGRGKRTGTYGGFLLACYNQDTEEFE---------------TCCKIGTGFSDEML 622

Query: 552 KEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENSEYSSKRY 611
           + +    + + +    + P  + +   S  P  W +P  ++V EV    +  S      Y
Sbjct: 623 QTLYNGLKETAI----ESPRANFVFDSSAEPDVWFNP--TMVFEVLTADLSLSPI----Y 672

Query: 612 RAGSTLHSA-----YCR--RIRNDKDWTTCTSVAQ 639
           +AGST++       + R  RIR DK     TS  Q
Sbjct: 673 KAGSTVYGKGISLRFPRFIRIRTDKSVNDATSSEQ 707

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 105/425 (24%), Positives = 181/425 (42%), Gaps = 49/425 (11%)

Query: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282
           C  P+ ++ +    D  I+         +LD+   +I  G    P LAK      E +  
Sbjct: 328 CQVPNYELVINACLDYGIM---------KLDEH-CTIQPGIPLKPMLAKPTKAINEVLDR 377

Query: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342
                F  E K DGER Q+H +  G+ ++  SR G + +  Y  E+    I  +L   + 
Sbjct: 378 FQGQTFTSEYKYDGERAQVHLLKDGT-MRIYSRNGENMTERY-PEIQ---IKDFLADPAS 432

Query: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNG 402
               +LD E V++DK++  ILPF ++ +    ++  +EV       R     FD++  N 
Sbjct: 433 TTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVK-----VRVCLFAFDILLHND 487

Query: 403 VSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQ- 461
           + L   PL  R+E L E+  PV    +    +   +   ++ F+  +++   EG++VK  
Sbjct: 488 MRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMM 547

Query: 462 --ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHI 517
               S YE   R+ +W+K+K +Y E +G+++DL V+G     GK+     G L+      
Sbjct: 548 DGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNAD 607

Query: 518 LENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEF 577
            E+F                + C +  G S+E  + +  K   + +      P  + +  
Sbjct: 608 SEDFE---------------TCCKIGTGFSEEMLQTLYEKLSPTVID----GPKGTYVFD 648

Query: 578 GSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTC 634
            S  P  W +P  +++ EV    +  S   +  S  Y  G +L      RIR+DK     
Sbjct: 649 SSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDA 706

Query: 635 TSVAQ 639
           TS  Q
Sbjct: 707 TSSEQ 711

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 171/387 (44%), Gaps = 41/387 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F  E K DGER Q+H +  GS ++  SR G + +
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 407

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y  E+    IS ++    +    +LD E V++DK + +ILPF ++ +     ++  +V
Sbjct: 408 ERY-PEIN---ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
                  R     FD++  N   L    L  R+ YL+ IL PVP  +++   +       
Sbjct: 464 K-----VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518

Query: 442 IKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           ++ ++ ++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V+G  
Sbjct: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 578

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G SDE  + +  
Sbjct: 579 YGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQNLYE 623

Query: 557 KTRGSWVSYKEKPPPLSLLEFG-SKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYR 612
           K     +S  E P P +   +  S  P  W++P  S++ EV    +  S   +     Y 
Sbjct: 624 K-----LSPTEIPEPKAFYVYSESAQPDVWLEP--SMLFEVLTADLSLSPVYKAGGSSYG 676

Query: 613 AGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            G +L      RIR+DK     TS  Q
Sbjct: 677 KGISLRFPRFIRIRDDKSVEDATSSEQ 703

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 101/386 (26%), Positives = 170/386 (44%), Gaps = 39/386 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F  E K DGER Q+H +  GS +   SR G + +
Sbjct: 326 GIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGS-MNIYSRNGENMT 384

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y +   R     YL         +LD E V++D ++  ILPF I+ +          V
Sbjct: 385 ERYPELHIR----DYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRK-----RKGV 435

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
             ++   R     FD++  NG SL    L  R+EYL+ +L PV    +    + + + + 
Sbjct: 436 EAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLED 495

Query: 442 IKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           ++ +++++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V+G  
Sbjct: 496 VQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 555

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G SDE    +  
Sbjct: 556 YGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLVSLYE 600

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRA 613
           K + S +   E+P    + +  S  P  W +P  +++ EV    +  S   +  +  Y  
Sbjct: 601 KLKPSSL---EQPKAFYVYD-SSAEPDVWFEP--TMLFEVLTADLSLSPIYKAGNSAYGK 654

Query: 614 GSTLHSAYCRRIRNDKDWTTCTSVAQ 639
           G +L      RIR+DKD    TS  Q
Sbjct: 655 GISLRFPRFIRIRDDKDVEDATSSEQ 680

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 105/428 (24%), Positives = 184/428 (42%), Gaps = 55/428 (12%)

Query: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282
           C  P+ ++ + V     I++    N  ++L         G    P LAK      E +  
Sbjct: 305 CQVPNYEMIINVALQYGIMN---LNQHIKL-------RPGIPLQPMLAKPTKSISEVLDR 354

Query: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342
                F  E K DGER Q+H    GS +K  SR G D +  Y  E+    +  Y+K    
Sbjct: 355 FQGTKFTCEYKYDGERAQVHLCRDGS-MKIYSRNGEDMTERY-PEID---VKHYVKDLGA 409

Query: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVD--ELINSEVGNENDGYRPLYMVFDLVYL 400
            +  ++D E V++D+++  ILPF ++ +      EL + +V       R     FD++ L
Sbjct: 410 TKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKV-------RVCLYAFDILCL 462

Query: 401 NGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK 460
           N   L     H R++ L +  +      +    +   +   ++ ++ ++++   EG++VK
Sbjct: 463 NDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVK 522

Query: 461 Q---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSE 515
                 S YE   R+ +W+K+K +Y E +G+++DLVV+G     GK+     G L+    
Sbjct: 523 MLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYN 582

Query: 516 HILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLL 575
              E F                + C +  G SDE  +++  K + + V +     P + +
Sbjct: 583 LDSEEFE---------------TCCKIGTGFSDEMLQDLYTKLKDTTVEH-----PSTNV 622

Query: 576 EFGSKIPVE-WIDPKNSVVIEVKARSVENSEYSSKRYRA---GSTLHSAYCRRIRNDKDW 631
            + S  P + W +P  S++ EV    +  S      + A   G +L      RIR+DK+ 
Sbjct: 623 IYDSSAPADVWFEP--SMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNV 680

Query: 632 TTCTSVAQ 639
           T  TS  Q
Sbjct: 681 TDATSSDQ 688

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 96/390 (24%), Positives = 171/390 (43%), Gaps = 39/390 (10%)

Query: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317
           ++  G    P LAK      E +       F  E K DGER Q+H ++ G+ ++  SR G
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGT-MRIYSRNG 442

Query: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377
            + +  Y  E+    I+ +++     ++ +LD E V++DK++  ILPF ++ +    ++ 
Sbjct: 443 ENMTERY-PEIK---ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498

Query: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437
            S+V       R     FD++  NG  L    L  R+E L ++   VP   +    I   
Sbjct: 499 LSDVK-----VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTD 553

Query: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           +   ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 554 NLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613

Query: 495 IGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552
           +G     GK+     G L+       ++ G  E            + C +  G SDE  +
Sbjct: 614 LGAYYGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDESLQ 658

Query: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609
           +++ +   + +      P  + +   S  P  W +P  + + EV    +  S   +  S 
Sbjct: 659 QLHERLTPTIID----GPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGST 712

Query: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            +  G +L      RIR DK     TS  Q
Sbjct: 713 TFAKGVSLRFPRFLRIREDKGVEDATSSEQ 742

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 105/417 (25%), Positives = 177/417 (42%), Gaps = 43/417 (10%)

Query: 235 VTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKM 294
           V + +I+ +   N  +     +  +  G    P LAK      E + +    +F  E K 
Sbjct: 328 VPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKY 387

Query: 295 DGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQ-EVARGVISQYLKLKSDVRDCVLDGEMV 353
           DGER Q+H ++ G  ++  SR G + +  Y +  +   ++        +V   +LD E+V
Sbjct: 388 DGERGQVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVV 445

Query: 354 SYDKKRKIILPFGIVKSAAVD--ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLH 411
           ++D ++  ILPF ++ +      EL + +V       R     FD++Y NG  L    L 
Sbjct: 446 AWDNEQNKILPFQVLSTRKRKGVELKDVKV-------RVCLFAFDILYYNGEGLITKTLR 498

Query: 412 IRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK---QASSTYEV 468
            R++ L E+   VP   +    +   +   I+ F+ +AI+   EG++VK      S YE 
Sbjct: 499 ERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEP 558

Query: 469 GARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHILENFGPIEH 526
             R+ +W+K+K +Y   +G+++DL V+G     GK+     G L+              +
Sbjct: 559 SKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGC------------Y 606

Query: 527 GKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKI-PVEW 585
            ++      C   C +  G SDE   ++    R   +       P S   F S   P  W
Sbjct: 607 NQDSGEYETC---CKIGTGFSDEMLTKLYELFREEEIEV-----PKSFYNFDSSAEPDIW 658

Query: 586 IDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            +PK  V+ EV    +  S   +  S  Y  G +L      RIR+DK     TS  Q
Sbjct: 659 FEPK--VLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQ 713

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 96/386 (24%), Positives = 169/386 (43%), Gaps = 39/386 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y  E+    I+ +++     ++ +LD E V++DK +  ILPF ++ +    ++  ++V
Sbjct: 537 ERY-PEIK---ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
                  R     FD++  N   L  + L  R+EYL ++   VP   +    I   +   
Sbjct: 593 K-----VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647

Query: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           ++ F+  ++    EG++VK    + S YE   R+ +W+K+K +Y E +G+++DL V+G  
Sbjct: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 707

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G SDE  + ++ 
Sbjct: 708 YGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQLLHA 752

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRA 613
           +   + +      P  + +   S  P  W +P  + + EV    +  S   +  S  +  
Sbjct: 753 RLTPTIID----GPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFDK 806

Query: 614 GSTLHSAYCRRIRNDKDWTTCTSVAQ 639
           G +L      RIR DK     TS  Q
Sbjct: 807 GVSLRFPRFLRIREDKGVEDATSSDQ 832

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/425 (23%), Positives = 179/425 (42%), Gaps = 49/425 (11%)

Query: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282
           C  P+ +I +    D  I+          LDK    +  G    P LAK      E +  
Sbjct: 310 CQVPNYEIVINACLDYGIM---------ELDKH-CRLRPGIPLKPMLAKPTKSITEVLDR 359

Query: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342
                F  E K DGER Q+H +  G+ ++  SR G + +  Y +   R  ++     K+ 
Sbjct: 360 FQGQTFTSEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEISIRDFVADLEHTKTL 418

Query: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNG 402
           + DC    E V++DK ++ ILPF ++ +         +V  ++   R     FD++  NG
Sbjct: 419 ILDC----EAVAWDKVQQKILPFQVLSTRK-----RKDVEAKDVKVRVCLFAFDIICHNG 469

Query: 403 VSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQ- 461
                  L  R+E L ++  PV    +    +     + ++ F+ ++++   EG++VK  
Sbjct: 470 ERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKML 529

Query: 462 --ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHI 517
               S YE   R+ +W+K+K +Y + +G+++DL V+G     GK+     G L+      
Sbjct: 530 DGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN-- 587

Query: 518 LENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEF 577
            ++ G  E            + C +  G SDE  +++  +   + +      P  + +  
Sbjct: 588 -QDSGEFE------------TCCKIGTGFSDEMLQQLYERFSKTTLD----GPKATYVFD 630

Query: 578 GSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTC 634
            S  P  W +P  + + EV    +  S   +  +  Y  G +L      R+R+DK     
Sbjct: 631 SSAEPDVWFEP--TTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDA 688

Query: 635 TSVAQ 639
           TS AQ
Sbjct: 689 TSSAQ 693

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 96/386 (24%), Positives = 169/386 (43%), Gaps = 39/386 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y  E+    I+ +++  +  ++ +LD E V++DK++K ILPF I+ +    ++   +V
Sbjct: 447 ERY-PEIK---ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDV 502

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
                  +     FD++  N   L    L  R+E+L ++   VP   +    I   +   
Sbjct: 503 K-----VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDE 557

Query: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V+G  
Sbjct: 558 LQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 617

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G SDE  + ++ 
Sbjct: 618 YGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQLLHE 662

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRA 613
           +   + +      P  + +   S  P  W +P  + + EV    +  S   +  S  +  
Sbjct: 663 RLTPTIID----GPKATFVFDASAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDK 716

Query: 614 GSTLHSAYCRRIRNDKDWTTCTSVAQ 639
           G +L      RIR DK     TS  Q
Sbjct: 717 GVSLRFPRFLRIREDKGVEDATSSDQ 742

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 172/386 (44%), Gaps = 40/386 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F+ E K DGER QLH +  G+ ++  SR G + +
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGT-MRIYSRNGENMT 424

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y +   R  +S            +LD E V++DK++  ILPF ++ +         +V
Sbjct: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTRK-----RKDV 474

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
             ++   R     FDL+  NG  L    L  R++ L+++  PV         +   + + 
Sbjct: 475 DAKDVKVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534

Query: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           +++F+ ++++   EG++VK      S YE   R+ +W+K+K +Y   +G+++DL V+G  
Sbjct: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAY 594

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G S+E  +++  
Sbjct: 595 YGRGKRTGTYGGFLLGCYN---QDTGEYE------------TCCKIGTGFSEELLQQLYD 639

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRA 613
           + + + +   E P    + +  ++ P  W +P  +++ EV A  +  S   +  S +Y  
Sbjct: 640 RLKPTAM---EAPAAFYVYD-SAQQPDVWFEP--TLLFEVLAADLSLSPVYKAGSAQYDK 693

Query: 614 GSTLHSAYCRRIRNDKDWTTCTSVAQ 639
           G +L      RIR+DK     TS  Q
Sbjct: 694 GISLRFPRFLRIRDDKSVEEATSSEQ 719

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 167/386 (43%), Gaps = 39/386 (10%)

Query: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 388 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 446

Query: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381
             Y  E+    I+ +++     ++ +LD E V++DK +  ILPF ++ +    ++  ++V
Sbjct: 447 ERY-PEIN---ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDV 502

Query: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441
                  +     FD++  N   L    L  R+EYL ++   VP   +    I   +   
Sbjct: 503 K-----VKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDE 557

Query: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR- 497
           ++ F+  ++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V+G  
Sbjct: 558 LQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 617

Query: 498 -DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINR 556
              GK+     G L+       ++ G  E            + C +  G SDE  + ++ 
Sbjct: 618 YGRGKRTGTYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQLLHD 662

Query: 557 KTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSKRYRA 613
           +   + +      P  + +   S  P  W +P  + + EV    +  S   +  S  +  
Sbjct: 663 RLTPTIID----GPKATFVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSATFDK 716

Query: 614 GSTLHSAYCRRIRNDKDWTTCTSVAQ 639
           G +L      RIR DK     TS  Q
Sbjct: 717 GVSLRFPRFLRIREDKGVEDATSSDQ 742

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 103/426 (24%), Positives = 182/426 (42%), Gaps = 51/426 (11%)

Query: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282
           C  P+ QI         ++   L +  + LDK  + +  G    P LAK      E +  
Sbjct: 328 CQVPNYQI---------VIETALEHGIMELDKHCV-LTPGIPLKPMLAKPSKSISEVLDR 377

Query: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342
                F  E K DGER Q+H +  GS ++  SR G + +  Y  E+    IS ++   + 
Sbjct: 378 FQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERY-PEIR---ISDFIADPAR 432

Query: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNG 402
               +LD E V++DK++  ILPF ++ +          V  E+   R     FD++  N 
Sbjct: 433 THTLILDCEAVAWDKEKNTILPFQVLSTRK-----RKGVAVEDVKVRVCLFAFDILCYND 487

Query: 403 VSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK-- 460
             L   PL  R+  L+  L PVP  +++   +       +++++ +A+    EG++VK  
Sbjct: 488 EPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKIL 547

Query: 461 -QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHI 517
               S YE   R+ +W+K+K +Y + +G+++DL V+G     GK+     G L+      
Sbjct: 548 EGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYN-- 605

Query: 518 LENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEF 577
            ++ G  E            + C +  G S+E  + +  +   + +     P P +    
Sbjct: 606 -QDSGEYE------------TCCKIGTGFSEEMLQTLFDRLSPTAI-----PTPKAFYVH 647

Query: 578 GSKIPVE-WIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTT 633
               P + W +P  +++ EV    +  S   +  +  Y  G +L      R+R+DK    
Sbjct: 648 SESAPPDVWFEP--TLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEE 705

Query: 634 CTSVAQ 639
            TS  Q
Sbjct: 706 ATSSEQ 711

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 86/360 (23%), Positives = 159/360 (44%), Gaps = 39/360 (10%)

Query: 288 FILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCV 347
           F  E K DGER Q+H +  G+ ++  SR G + +  Y +   R  ++     KS + DC 
Sbjct: 386 FTCEYKYDGERAQVHLLEDGT-MRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDC- 443

Query: 348 LDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTK 407
              E V++DK++  ILPF ++ +    ++  +E+       R     FD++  N   L  
Sbjct: 444 ---EAVAWDKEQNKILPFQVLSTRKRKDVDINEIK-----VRVCLFAFDILLHNDEKLIN 495

Query: 408 VPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQ---ASS 464
             L  R++ L  I   V    +    +   + + +++F+ ++++   EG++VK      S
Sbjct: 496 KSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEES 555

Query: 465 TYEVGARNDHWVKIKPEYFEDLGETMDLVVIGR--DPGKKDSLMCGLLVSDSEHILENFG 522
            YE   R+ +W+K+K +Y   +G+++DL V+G     GK+     G L+       ++ G
Sbjct: 556 HYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYN---QDTG 612

Query: 523 PIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIP 582
             E              C +  G SDE  ++++ + + + +      P  + +   S  P
Sbjct: 613 EFETA------------CKIGTGFSDEVLQQLHERLKSTVIDL----PKATYVFDPSAEP 656

Query: 583 VEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
             W +P  +++ EV    +  S   +  S  Y  G +L      R+R DK     TS  Q
Sbjct: 657 DVWFEP--TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQ 714

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 93/390 (23%), Positives = 167/390 (42%), Gaps = 39/390 (10%)

Query: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317
           S+  G    P LAK      E +       F  E K DGER Q+H ++ G+ ++  SR G
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGT-MRIYSRNG 441

Query: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377
            + +  Y +   R  I+  L   + + DC    E V++D ++  ILPF ++ +       
Sbjct: 442 ENMTERYPEIHIRDFIADPLVTSTLILDC----EAVAWDNEQNKILPFQVLSTRK----- 492

Query: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437
             +V  ++   +     FD++  N   L    L  R++ L+E+   V    +    + + 
Sbjct: 493 RKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSS 552

Query: 438 DAKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           +   ++ F+ +++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V
Sbjct: 553 NLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 612

Query: 495 IGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552
           IG     GK+  +  G L+       ++ G  E            + C +  G SDE  +
Sbjct: 613 IGAYYGRGKRTGMYGGFLLGCYN---QDTGEFE------------TCCKIGTGFSDEMLQ 657

Query: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609
           ++  +   + +      P  + +   S  P  W +P  +++ EV    +  S   +  S 
Sbjct: 658 QLYTRLTPTVLD----GPKATFVYDSSAEPDVWFEP--TLLFEVLTADLSLSPIYKAGSS 711

Query: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            Y  G +L      R R DK     TS  Q
Sbjct: 712 TYDKGISLRFPRFIRTREDKGVEDATSSEQ 741

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/390 (23%), Positives = 167/390 (42%), Gaps = 39/390 (10%)

Query: 258 SINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRG 317
           S+  G    P LAK      E         F  E K DGER Q+H +N GS ++  SR G
Sbjct: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDGS-MRIYSRNG 397

Query: 318 IDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELI 377
            + +  Y  E+    ++ ++K  +  +  ++D E V++D++ K ILPF ++ +       
Sbjct: 398 ENMTERY-PEIN---VTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRK----- 448

Query: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437
             +V  ++   R     FD++  N   L    L  R+E L  +   V       K +   
Sbjct: 449 RKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTN 508

Query: 438 DAKAIKNFMQRAIEMGSEGVIVK---QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVV 494
           +   ++ F+ ++++   EG++VK      S YE   R+ +W+K+K +Y + +G+++DL V
Sbjct: 509 NLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCV 568

Query: 495 IGR--DPGKKDSLMCGLLVSDSEHILENFGPIEHGKEGDPIIKCVSFCNVANGVSDEEFK 552
           +G     GK+     G L+       ++ G  E              C +  G SDE  +
Sbjct: 569 LGAFYGRGKRTGTYGGFLLGCYN---QDTGEFETA------------CKIGTGFSDEVLQ 613

Query: 553 EINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSVVIEVKARSVENS---EYSSK 609
            +  + + + +      P  + +   S  P  W +P  +++ EV    +  S   +  + 
Sbjct: 614 SLYDRLKSTTID----GPKATYIYDSSAQPDVWFEP--TLLFEVLTADLSMSPIYKAGAS 667

Query: 610 RYRAGSTLHSAYCRRIRNDKDWTTCTSVAQ 639
            Y  G +L      R+R DK     TS  Q
Sbjct: 668 TYSKGISLRFPRFIRLREDKSVEEATSSEQ 697

>Kpol_1050.3 s1050 complement(5462..6214,6398..6442) [798 bp, 265
           aa] {ON} complement(5462..6214,6398..6442) [798 nt, 266
           aa]
          Length = 265

 Score = 34.7 bits (78), Expect = 0.84,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 6/101 (5%)

Query: 47  HRQELGKAVTVKRVEIITCFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVC 106
           HR   G +  +  + +I CF+ +W  T+   F P +R     R P  Y I D + I    
Sbjct: 29  HRSIYGLSYDMYILSLINCFLSIW-CTLNYKFSPLIRQQLGNRYPLFYSIDDNSDIPISL 87

Query: 107 KALNLSRDSL-----TERRLLNWKQYAGRGTSLSKFCVQEI 142
             L L   +L       R+L+ ++        +SKFC+  I
Sbjct: 88  ALLILDITTLFISLFVLRQLIMYRSSKHVHQGISKFCISVI 128

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 656 VHQVSPRRKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVA 715
           +H+ +P RKR +H I  YC   A   L T  ++I + L + ILS+ + S  RR E    +
Sbjct: 609 LHKWNPDRKRFLHNIQAYCT--AFLILQTSPANIPQFLVYLILSEKLESVWRRREW---S 663

Query: 716 AKVVKHGGLIVKNI 729
             ++   G++++N+
Sbjct: 664 PSILMLAGIVLQNL 677

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 48/106 (45%), Gaps = 18/106 (16%)

Query: 392 YMVFDLVYLNGVSLTKVPLHIRKEYL-KEILSPVPDVVEILKGIRACDAKAIK------N 444
           Y++FD + +NG SL + P   R  +L KE   P  D+  +      C     K      N
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPD--HCSNFPFKLSMKHMN 201

Query: 445 FMQRAIEMGS---------EGVIVKQASSTYEVGARNDHWVKIKPE 481
           F    +++ S         +G+I    +++Y VG ++ + +K KP+
Sbjct: 202 FSYDLVKIASTLDKLPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 53/128 (41%), Gaps = 22/128 (17%)

Query: 392 YMVFDLVYLNGVSLTKVPLHIRKEYL-KEILSPVPDVVEILKGIRACDAKAIKNFMQR-- 448
           Y++FD + +NG SL + P   R  +L KE   P  D+         C     K  M+   
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPD--RCSTFPFKISMKHMN 202

Query: 449 -------------AIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495
                        ++   S+G+I     + Y +G ++ + +K KPE    +  T+D  +I
Sbjct: 203 FSYDLAKVAKTLDSLPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE----VENTVDFKLI 258

Query: 496 GRDPGKKD 503
              P  +D
Sbjct: 259 IEPPVVED 266

>TPHA0E02770 Chr5 (580118..581470) [1353 bp, 450 aa] {ON} Anc_6.228
           YGL130W
          Length = 450

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 18/106 (16%)

Query: 392 YMVFDLVYLNGVSLTKVPLHIRKEYL-KEILSPVPDVVEILKGIRACDAKAIKNFMQRA- 449
           Y++FD + +NG +LT  P   R  +L KE   P  D+  I      C     K  M++  
Sbjct: 143 YLMFDCLTMNGRNLTHSPTSSRLAHLGKEFYKPYFDMRSIFPD--RCINFPFKISMKQMN 200

Query: 450 --------------IEMGSEGVIVKQASSTYEVGARNDHWVKIKPE 481
                         +   S+G+I    ++ Y VGA++ + +K KPE
Sbjct: 201 FSYDLVNVYKTLDKLPHLSDGLIFTPVNTPYVVGAKDSYLLKWKPE 246

>Ecym_5052 Chr5 (112351..114972) [2622 bp, 873 aa] {ON} similar to
           Ashbya gossypii ADR369C
          Length = 873

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 14/116 (12%)

Query: 663 RKRNVHEIFEYCAGEAKSELDTEGSSIFEGLHFYILSDYVTSQRRRYERGMVAAKVVKHG 722
           RKR + +  +    E   EL  +   +FEG   YI      + R   +R  +  ++V HG
Sbjct: 64  RKRQLQKAQDERLCEEYEELGEKFRRVFEGCKVYI------NGRTDPDREQLRKEIVLHG 117

Query: 723 GLIVKNIDMRPE--HLSYLRIVSGKTTIECRNLVNRGYDIIDPCWIFDCISAGFQL 776
           G  V+ +  + +  H+    + + K  IE RN     + ++ P WI  C+  G  L
Sbjct: 118 GQFVQYLTKKSDVTHIVAQNLSAAKC-IEFRN-----FKVVQPGWIGACVRIGKML 167

>SAKL0G17358g Chr7 complement(1503342..1505471) [2130 bp, 709 aa]
           {ON} similar to uniprot|Q7LHI0 Saccharomyces cerevisiae
           YLR440C SEC39 Protein of unknown function proposed to be
           involved in protein secretion
          Length = 709

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 32/53 (60%)

Query: 394 VFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFM 446
           V  ++Y NG +L+++P+   +  +K+IL+   D V +  GI+A   K+  N++
Sbjct: 298 VLTILYENGHNLSRIPIQNVEHEIKKILAIADDDVTLESGIKASTLKSYANYL 350

>NCAS0A01270 Chr1 (245601..247667) [2067 bp, 688 aa] {ON} Anc_5.292
          Length = 688

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 18/130 (13%)

Query: 378 NSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRAC 437
           N  V  E DG R L+  F           K+P+HIR+   K   +P   ++ +  G    
Sbjct: 498 NLPVHYELDGPRHLFESF-----------KLPIHIRRSTFKLPSNPQTPIIMVGPGTGVA 546

Query: 438 DAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIK---PEYFEDLGETMDLVV 494
             +A      + +E  ++ + + +    Y  G+RN      K   P Y E LG++ +++V
Sbjct: 547 PFRAFIRERVKFLETNNDNLTLGKHLLFY--GSRNHDDFLYKEEWPIYAEKLGDSFEMIV 604

Query: 495 IGR--DPGKK 502
                DPGKK
Sbjct: 605 AHSRLDPGKK 614

>TBLA0C03210 Chr3 (779532..781583) [2052 bp, 683 aa] {ON} Anc_5.292
           YHR042W
          Length = 683

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 18/138 (13%)

Query: 386 DGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNF 445
           DG R LY  +           K+P+++RK   +   +P   V+ I  G         + F
Sbjct: 503 DGPRGLYSNY-----------KLPVYVRKSTFRLPTNPSTPVIMIGPGTGVA---PFRGF 548

Query: 446 MQRAIEMGSEGVIVKQASSTYEVGARN--DHWVKIK-PEYFEDLGETMDLVVI-GRDPGK 501
           ++  + M      +K        G+RN  D+  K + P+Y E LG T +++V   R PG 
Sbjct: 549 IRERVAMLKNEPNIKFGKQLLFYGSRNEDDYLYKNEWPKYSESLGNTFEMIVCHSRLPGS 608

Query: 502 KDSLMCGLLVSDSEHILE 519
           K   +   L  + + +L+
Sbjct: 609 KKVYVQDKLNENRQEVLK 626

>NCAS0D04100 Chr4 (774815..776164) [1350 bp, 449 aa] {ON} Anc_6.228
           YGL130W
          Length = 449

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 44/106 (41%), Gaps = 18/106 (16%)

Query: 392 YMVFDLVYLNGVSLTKVPLHIRKEYL-KEILSPVPDVVEILKGIRACDAKAIKNFMQRA- 449
           Y++FD + +NG SL + P   R  +L K+   P  D+  I      C+    K  M+   
Sbjct: 144 YLMFDCLAINGRSLMQSPTSSRLAHLGKDFFKPYYDLRSIYPN--HCNTFPFKISMKHMD 201

Query: 450 --------------IEMGSEGVIVKQASSTYEVGARNDHWVKIKPE 481
                         +   S+G+I       Y +G ++ + +K KPE
Sbjct: 202 FSYALVKVANSLDKLPHLSDGLIFTPVKMPYNIGGKDSYLLKWKPE 247

>Kwal_23.5644 s23 complement(1250655..1252724) [2070 bp, 689 aa]
           {ON} YHR042W (NCP1) - NADP-cytochrome P450 reductase
           [contig 11] FULL
          Length = 689

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 61/144 (42%), Gaps = 12/144 (8%)

Query: 407 KVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTY 466
           K+P+H+R+   +   +P   V+ I  G         + F++  ++   +   V       
Sbjct: 517 KLPIHVRRSAFRLPSNPATPVIMIGPGTGVA---PFRGFVRDRVKFVEQQSNVTLGKHIL 573

Query: 467 EVGAR--NDHWVKIK-PEYFEDLGETMDLVVI-GRDPGKKDSLMCGLLVSDSEHILENFG 522
             G+R  ND+  + + PEY + LG+  ++VV   R PGK    +   L+   + I +   
Sbjct: 574 FYGSRDQNDYLYQEEWPEYSKKLGDAFEMVVAHSRLPGKPKCYVQDKLIEKEQEIFDLI- 632

Query: 523 PIEHGKEGDPIIKCVSFCNVANGV 546
                K+G  I  C     +A GV
Sbjct: 633 ----TKKGAFIYVCGDAKGMAQGV 652

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,992,011
Number of extensions: 4452013
Number of successful extensions: 10715
Number of sequences better than 10.0: 49
Number of HSP's gapped: 10715
Number of HSP's successfully gapped: 51
Length of query: 951
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 832
Effective length of database: 39,836,145
Effective search space: 33143672640
Effective search space used: 33143672640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)