Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11264g6.19ON34634616180.0
Kwal_56.224216.19ON33728610171e-138
TDEL0G045006.19ON3012389451e-127
Skud_15.1676.19ON3122939441e-127
SAKL0E01144g6.19ON4302409551e-127
Ecym_30236.19ON3492369391e-126
ZYRO0C07832g6.19ON2812389311e-125
TPHA0J003206.19ON3422419321e-125
CAGL0E02717g6.19ON3252389301e-125
KLLA0D01111g6.19ON3142359261e-124
YOR006C (TSR3)6.19ON3132429251e-124
KNAG0M011506.19ON3072399241e-124
Smik_15.1756.19ON3122409241e-124
Kpol_1037.246.19ON3662959251e-123
ACR007W6.19ON3132399101e-122
Suva_15.1816.19ON3362389111e-122
NCAS0H008106.19ON3232458241e-109
NDAI0D007906.19ON4012598091e-105
KAFR0L003906.19ON3292217981e-105
TBLA0A072506.19ON3042917631e-100
Kpol_495.185.620ON229101780.22
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11264g
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   627   0.0  
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   396   e-138
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   368   e-127
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   368   e-127
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   372   e-127
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   366   e-126
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   363   e-125
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   363   e-125
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   362   e-125
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   361   e-124
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   360   e-124
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   360   e-124
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   360   e-124
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   360   e-123
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   355   e-122
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   355   e-122
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   322   e-109
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   316   e-105
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   311   e-105
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   298   e-100
Kpol_495.18 s495 complement(51004..51693) [690 bp, 229 aa] {ON} ...    35   0.22 

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/346 (89%), Positives = 308/346 (89%)

Query: 1   MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60
           MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK
Sbjct: 1   MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60

Query: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120
           RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE
Sbjct: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120

Query: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180
           VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG
Sbjct: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180

Query: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240
           LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK
Sbjct: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240

Query: 241 GHGVTQNENKDEAEVGSTWEQGXXXXXXXXXXXXXXXXXXHGPVKYDSLGNEITXXXXXX 300
           GHGVTQNENKDEAEVGSTWEQG                  HGPVKYDSLGNEIT      
Sbjct: 241 GHGVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEITLSESSD 300

Query: 301 XXXXXXXXXXXXXXFLGDNSFSNDSDIRDVTVGLSKVAIKGDVTEQ 346
                         FLGDNSFSNDSDIRDVTVGLSKVAIKGDVTEQ
Sbjct: 301 PEYSDSEELLEEPDFLGDNSFSNDSDIRDVTVGLSKVAIKGDVTEQ 346

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 198/286 (69%), Positives = 229/286 (80%), Gaps = 10/286 (3%)

Query: 8   KGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCSGKKL 67
           KGSNK R  HS++ SSG+      VE+KHGA+ +G+NFPVKLAMWDFDQCDPKRCSGKKL
Sbjct: 9   KGSNKVRTGHSNRSSSGY------VETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 68  ERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPFNKIG 127
           ERLGIIKSLRVGQKFQGIVVSPNGK VVCPND+ IVEE+GAAVVECSWARL+E+PFNKIG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 128 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQFLELN 187
           GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLATELL+HFSWGL FLELN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 188 KELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKGHGVTQN 247
           KEL+EVYQ+CTDA+S+K+AE +WLE+IE+EA ER+  +  DDLW+TGNVN +   G   +
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSPLG--ND 240

Query: 248 ENKDEAEVGSTWEQGXXXXXXXXXXXXXXXXXXHGPVKYDSLGNEI 293
               + E  ++ + G                     VKYD+LGNEI
Sbjct: 241 TESSQEESENSVDTGDEEDDDNEDDYATGNRKR--VVKYDNLGNEI 284

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/238 (73%), Positives = 206/238 (86%), Gaps = 5/238 (2%)

Query: 5   SKGKGSNKQ-RGAHSSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61
           SKGK  N++ +  HS K S+GH+S   H+ +E K G   +   FPVKLAMWDFD CDPKR
Sbjct: 2   SKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRGTEDT--KFPVKLAMWDFDHCDPKR 59

Query: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNG  VVCP+D++IVEE+GA+VVECSWARLDEV
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181
           PFNKIGG++ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELLSHFSWGL
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239
            FLELN+ELLE+YQ+CTDADS+K AE AWL +I+KE +ERK++   +D+W+TGNVN K
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRK 237

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 184/293 (62%), Positives = 222/293 (75%), Gaps = 27/293 (9%)

Query: 3   KSSKGKGSNKQRGAHSSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60
           K+ + K   +QRGA      +GH++   H+H+E K+  ++  K FPVKLAMWDFD CDPK
Sbjct: 7   KTHEPKNERQQRGA------NGHSARQNHKHMEMKYDKSEKMK-FPVKLAMWDFDHCDPK 59

Query: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120
           RCSGKKLERLG+I+SLRVGQKFQG+VVSPNG+ VVCPND  IVE++GA+VVECSWARL+E
Sbjct: 60  RCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEE 119

Query: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180
           VPFNKIGG+ ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG++D A+ELLSHFSWG
Sbjct: 120 VPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWG 179

Query: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240
           L FL+LNKELLE+YQRCTDADS+KKAE  WLE++E E QERK+     D+W+ GN+N ++
Sbjct: 180 LGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNIN-RR 238

Query: 241 GHGVTQNENKDEAEVGSTWEQGXXXXXXXXXXXXXXXXXXHGPVKYDSLGNEI 293
           G+GV      DE E G   EQ                     P++YD+LGN I
Sbjct: 239 GNGV----QSDELESGEDSEQSGLENSEQ-------------PIEYDALGNAI 274

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  372 bits (955), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 177/240 (73%), Positives = 208/240 (86%), Gaps = 6/240 (2%)

Query: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKS-GKNFPVKLAMWDFDQCDPK 60
           GKG NK     SS+P   ++GH+S   H+ +E K G + S G  FPVKLAMWDFD CDPK
Sbjct: 2   GKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDPK 61

Query: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120
           RCSGKKLERLG+IKSLRVGQKFQGIVVSPNG+ VVCPNDR IVEE+GA+VVECSWARLDE
Sbjct: 62  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLDE 121

Query: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180
           VPF +IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+ELLS+FSWG
Sbjct: 122 VPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSWG 181

Query: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240
           L FLELNKELLE+YQ+CTDADS+K AE+AWL++IE+EAQ+RK ++  +D+W+ GNVN ++
Sbjct: 182 LGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRRR 241

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  366 bits (939), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 174/236 (73%), Positives = 198/236 (83%), Gaps = 4/236 (1%)

Query: 7   GKGSNKQRGA-HSSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCS 63
           GKG NK     HS K S+GH+S   HR +E+K+ A + G  FPV LAMWDFD CDPKRCS
Sbjct: 2   GKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQ-GSKFPVTLAMWDFDHCDPKRCS 60

Query: 64  GKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPF 123
           GKKLERLG+IKSLRV QKFQGIVVSPNGK+VVCPNDR I E+ G +VVECSWARL+E+PF
Sbjct: 61  GKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIPF 120

Query: 124 NKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQF 183
            KIGGR+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA  LLSHFSWGL F
Sbjct: 121 EKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLGF 180

Query: 184 LELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239
           LELNKE+LE+YQ+CTD DSIK AE+AWL+QIE EA ER+ +   +D+W+ GNVN K
Sbjct: 181 LELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  363 bits (931), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/238 (71%), Positives = 205/238 (86%), Gaps = 7/238 (2%)

Query: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHG--ANKSGKNFPVKLAMWDFDQCDP 59
           GKG NK     S++P   ++GH S   H+H+E KHG  +N +  NFPVKL MWDFD CDP
Sbjct: 2   GKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCDP 61

Query: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119
           KRCSGKKLERLG+I+SLRVGQKFQG+VV+PNG  VVCPND++IVEE+GA+VVECSWARLD
Sbjct: 62  KRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARLD 121

Query: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179
           EVPFN+IGGR+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGR+D A+ELLS+FS+
Sbjct: 122 EVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFSY 181

Query: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237
           G  FLE+N ELLE+YQ+CTDA+S+K AE AWLE+IEKE ++RKA+   +D+W+TGNVN
Sbjct: 182 GPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVN 239

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  363 bits (932), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 197/241 (81%), Gaps = 10/241 (4%)

Query: 7   GKGSNKQRGAHSSKPSSG----HTST-HRHVESKH-----GANKSGKNFPVKLAMWDFDQ 56
            KG NK     S KPS G    HT T H+ +E K      GAN     FPVKLAMWDFD 
Sbjct: 2   AKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFDH 61

Query: 57  CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWA 116
           CDPKRCSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D+  VEE GA+VVECSWA
Sbjct: 62  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSWA 121

Query: 117 RLDEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSH 176
           RLDEVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA ELL H
Sbjct: 122 RLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLEH 181

Query: 177 FSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNV 236
           FSWGL FLELNKELLE+YQ+CTD++S+KK E+ WLE+I+KE QERK+++   D+WL GN 
Sbjct: 182 FSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGNT 241

Query: 237 N 237
           N
Sbjct: 242 N 242

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 197/238 (82%), Gaps = 5/238 (2%)

Query: 5   SKGKGSNKQRGAHSSKPSSG----HTS-THRHVESKHGANKSGKNFPVKLAMWDFDQCDP 59
           +KGKG NK      S  S G    HT   HRH+E K+       +FPVKLAMWDFD CDP
Sbjct: 2   AKGKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDP 61

Query: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119
           KRCSGKKLERLG+IKSLRVGQKFQGIVVSPNGKSVVCP+DR IVE +GA+VVECSWARL+
Sbjct: 62  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLE 121

Query: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179
           EVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA ELLSHFSW
Sbjct: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSW 181

Query: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237
           GL FLELNK+LLE YQ+CTD++SIKK E+ WL+QI++E QERK +   +D+W+ GN N
Sbjct: 182 GLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTN 239

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 201/235 (85%), Gaps = 5/235 (2%)

Query: 7   GKGSNKQRGAH--SSKPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKRC 62
           GKG NK+      S K S+GH+S   H+ +E KH  + + K FPVKLAMWDFD CDPKRC
Sbjct: 2   GKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSK-FPVKLAMWDFDHCDPKRC 60

Query: 63  SGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVP 122
           SGKKLERLG+IKSLRVGQKFQG+VVSPNGK+VVCP+D+ +VEENGA+VVECSWARLDEVP
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120

Query: 123 FNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQ 182
           FNKIGG+NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LLS+FSWG  
Sbjct: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180

Query: 183 FLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237
           FLELNKELL++YQ+CTD DS+K AE+ WL++IE+EA ERK +   +D+W+ GNVN
Sbjct: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVN 235

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  360 bits (925), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 206/242 (85%), Gaps = 7/242 (2%)

Query: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61
           GKG NK     + +P   ++GH+S   HR +E K+  N     FPVKLAMWDFD CDPKR
Sbjct: 2   GKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYD-NSEKMKFPVKLAMWDFDHCDPKR 60

Query: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D  IVE++GA+VVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181
           PFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKG 241
            FLELNKELLE+YQ+CTD DS+K+AE+ WL+++EKE QERK+R   +D+W+ GN+N ++G
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNIN-RRG 239

Query: 242 HG 243
           +G
Sbjct: 240 NG 241

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/239 (71%), Positives = 201/239 (84%), Gaps = 6/239 (2%)

Query: 5   SKGKGSNKQRGAHSS----KPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCD 58
           +KGKG NK RG  +S    K S+GH+S   H+ +E +      G  FPVK+AMWDFD CD
Sbjct: 2   AKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCD 61

Query: 59  PKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARL 118
           PKRCSGKKLERLG+I SL+VGQKFQGIVVSPNG+ VVCP+DR IVEE GA+VVECSWARL
Sbjct: 62  PKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARL 121

Query: 119 DEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFS 178
           DEVPFN+IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA++LLS+FS
Sbjct: 122 DEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFS 181

Query: 179 WGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237
           WGL FLELNKELLEVYQ+CTD +S+KKAE+ WL +IE+EAQ+RK      D+W+ GNVN
Sbjct: 182 WGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/240 (70%), Positives = 204/240 (85%), Gaps = 6/240 (2%)

Query: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61
           GKG NK     + +P   ++GH+S   HR +E K+  N     FPVKLAMWDFD CDPKR
Sbjct: 2   GKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKY-ENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNGK VVCP+D  +VE++GA+VVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181
           PFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ELLSHFSWG+
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKG 241
            FLELNKELLE+YQ+CTDADS+K+AE+ WL+++EKE QERK++   +D+W+ GN+N + G
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  360 bits (925), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 184/295 (62%), Positives = 221/295 (74%), Gaps = 24/295 (8%)

Query: 7   GKGSNKQRGAHSSKPS---SGHTS--THRHVE-SKHGANKSGKN-FPVKLAMWDFDQCDP 59
            KG NKQ  A + KPS   +GH+S   H+H+E  K+G N S  + FPVKLAMWDFD CDP
Sbjct: 2   AKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCDP 61

Query: 60  KRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLD 119
           KRCSGK+LERLG+IKSLRVGQKFQG+VVSPNGK V+CPNDR IVEE GA+VVECSWARLD
Sbjct: 62  KRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARLD 121

Query: 120 EVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSW 179
           EVPFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A ELLS+FSW
Sbjct: 122 EVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFSW 181

Query: 180 GLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN-H 238
           GL FLE+N+ELL++YQ+CTD++S+KKAE+ WL +IE+E QERK +    D+W+ GN N +
Sbjct: 182 GLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNRN 241

Query: 239 KKGHGVTQNENKDEAEVGSTWEQGXXXXXXXXXXXXXXXXXXHGPVKYDSLGNEI 293
             G    +  N  EA  G  +E+                   +   +YD+LGN I
Sbjct: 242 MNGDDDEEEGNSYEALSGDDYEE----------------ENNNKSARYDNLGNII 280

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/239 (69%), Positives = 196/239 (82%), Gaps = 2/239 (0%)

Query: 1   MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60
           MAK    K   +Q+ A  S   +G  S  R  E KHG  K  + FP KLAMWDFD CDPK
Sbjct: 1   MAKGKNKKTEERQKPAKGSSKHNG-KSNQRRTELKHGHTKETE-FPAKLAMWDFDHCDPK 58

Query: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120
           RCSGKKLERLG+IKSLR+GQKFQGIVVSPNGK+VVCPND+ IVE++G +VVECSWARLDE
Sbjct: 59  RCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDE 118

Query: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180
           +PF+KIGGR+ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELLSHFSWG
Sbjct: 119 IPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWG 178

Query: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239
             FLELN+ELLE YQ+CTD  SIK AE+AWL+++E+EA++R+ +   +D+W+ GNVN K
Sbjct: 179 PGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 203/238 (85%), Gaps = 6/238 (2%)

Query: 7   GKGSNKQRGAHSSKP---SSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCDPKR 61
           GKG NK     + +P   ++GH+S   H+ +E K+  N    NFPVKLAMWDFD CDPKR
Sbjct: 26  GKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYD-NSEMTNFPVKLAMWDFDHCDPKR 84

Query: 62  CSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121
           CSGKKLERLG+IKSLRVGQKFQGIVVSPNG  VVCP+D  +VE++GA+VVECSWARL+EV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 122 PFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGL 181
           PFNKIGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+D A+ LLSHFSWGL
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 182 QFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHK 239
            FL+LN+ELLE+YQ+CTD++S+KKAE+ WL+++EKE QERK+++  +D+W+ GNVN K
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  322 bits (824), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/245 (62%), Positives = 194/245 (79%), Gaps = 14/245 (5%)

Query: 7   GKGSNKQRGAHSSKP-----SSGHTSTHRH--VESKHGANKSGKN---FPVKLAMWDFDQ 56
           GKG NK+R    SK      ++GH+S H H  +E +   N+   N    PVKL MWDFD 
Sbjct: 2   GKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFDH 61

Query: 57  CDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWA 116
           CDPKRCSGKKLERLG+IKSL++GQ+FQG+++SPNGK VV P D +I++E GAAVVECSWA
Sbjct: 62  CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWA 121

Query: 117 RLDEVPFNKI----GGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATE 172
           RLDE+PF+K+    GG+NERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR D A +
Sbjct: 122 RLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAAD 181

Query: 173 LLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWL 232
           LLS+FSWG+ FL LN+EL E+Y +CTD+DSI++A++AWL +I++EA+ERK +   +D+WL
Sbjct: 182 LLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIWL 241

Query: 233 TGNVN 237
            GN N
Sbjct: 242 MGNTN 246

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  316 bits (809), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 153/259 (59%), Positives = 190/259 (73%), Gaps = 28/259 (10%)

Query: 7   GKGSNKQRGAHSSKP-----SSGHTSTHRH----------VESKHGAN---------KSG 42
           GKG NK R      P     ++GH+S H H            S    N          S 
Sbjct: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105

Query: 43  KNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNI 102
           K  PVKL MWDFD CDPKRCSGKKLERLG+IKSL++GQ+FQG+++SPNGK VV P+D +I
Sbjct: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165

Query: 103 VEENGAAVVECSWARLDEVPFNKI----GGRNERLLPYLVAANQVNYGRPWRLNCVEALA 158
           ++E GAAVVECSWARLDE+PF+K+    GG+NERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225

Query: 159 ACFAIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEA 218
           ACFAI+GR D A++LLS+FSWGL FL+LN+EL E+Y +CTD+DS+K A++ WL++IE+EA
Sbjct: 226 ACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEA 285

Query: 219 QERKARNPGDDLWLTGNVN 237
            ERK +    D+W+ GN N
Sbjct: 286 TERKLQAQETDIWMMGNTN 304

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  311 bits (798), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 147/221 (66%), Positives = 179/221 (80%), Gaps = 6/221 (2%)

Query: 22  SSGHTSTH--RHVESKHGANKSGKNFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVG 79
           S+GH S H  + +E K   ++   +FPVKLAMWDFD CDPKRCSGKKLERL +I+SL++ 
Sbjct: 23  SNGHHSRHNNKKMEFKQHVSRE-TSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81

Query: 80  QKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPFNKIGG-RNERLLPYLV 138
           QKFQGI VSPNGK  V P DR +V E G AVVECSWAR+DE+PF+K    + +RLLPYLV
Sbjct: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141

Query: 139 AANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCT 198
           AANQVNYGRPW+LNCVEA+AAC AIVG +DLA ELLSHFSWG+ FL+LN+ELLE+YQ+CT
Sbjct: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201

Query: 199 DADSIKKAEDAWLEQIEKEAQERKARNPGD--DLWLTGNVN 237
           D+D I+ A+DAW++QIEKE QERKA N     D+W++GNVN
Sbjct: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVN 242

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  298 bits (763), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 161/291 (55%), Positives = 191/291 (65%), Gaps = 13/291 (4%)

Query: 7   GKGSNKQRGAHSSKPSSGHTSTHRHVESKHGAN-KSGK-NFPVKLAMWDFDQCDPKRCSG 64
            KG NK     S++ S+      R  ESKH  + KS K NFPVKLAMWDFD CDPKRCSG
Sbjct: 2   AKGKNKGHEERSNRKSN----NSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCDPKRCSG 57

Query: 65  KKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDEVPFN 124
           KKLER G+ +SLRVGQ+F G+VVSPNGK VV P DR  +E+ G AVVECSWARLDEVPFN
Sbjct: 58  KKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFN 117

Query: 125 KIGGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWGLQ 182
           K+GG+  NE LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A+++L  FSWG  
Sbjct: 118 KLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHA 177

Query: 183 FLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKKGH 242
           FLELN ELL++Y  CTD+ S++KA+D WLE+IE E +ERK +    D WL GN N K  +
Sbjct: 178 FLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKNLN 237

Query: 243 GVTQNENKDEAEVGSTWEQGXXXXXXXXXXXXXXXXXXHGPVKYDSLGNEI 293
               +    E  + +                       H  +KYDSLGN I
Sbjct: 238 DFDNSSESTEDNISTV----SSADERYDALGNLISNDSHS-LKYDSLGNVI 283

>Kpol_495.18 s495 complement(51004..51693) [690 bp, 229 aa] {ON}
           complement(51004..51693) [690 nt, 230 aa]
          Length = 229

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 46/101 (45%), Gaps = 6/101 (5%)

Query: 27  STHRHVESKHGANKSGKNFPVKLAMWDF--DQCDPKRCSGKKLERLGIIKSLRVGQKFQG 84
           +T  H ++ +G N +G       A WD+  D+ D +   G +L+  G++    V ++   
Sbjct: 68  NTSNHPKNTNGTNGNGDTLSSNQAYWDYFHDEEDWELFKGMQLDSNGVVTFNFVNEEIDF 127

Query: 85  IVVSP----NGKSVVCPNDRNIVEENGAAVVECSWARLDEV 121
              SP    N   V  P++ N +  NG  +   + + ++++
Sbjct: 128 NCTSPDKEINNFDVTDPSNTNFIATNGIDMTMMTASNVEQI 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,702,707
Number of extensions: 1411391
Number of successful extensions: 3192
Number of sequences better than 10.0: 23
Number of HSP's gapped: 3243
Number of HSP's successfully gapped: 23
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)