Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11242g6.20ON1097109756920.0
Kwal_56.224246.20ON1089108531280.0
Sklu_YGOB_Anc_6.20b6.20ON1088109122780.0
Sklu_YGOB_Anc_6.20singletonOFF84984019600.0
ZYRO0C07810g6.20ON1099110717690.0
Ecym_30246.20ON1079108217200.0
ACR006C6.20ON1071108716860.0
TDEL0G044906.20ON1093110316520.0
Suva_13.1606.20ON1090110515860.0
Smik_13.1576.20ON1090110915860.0
Skud_13.1526.20ON1090110915470.0
KLLA0D01133g6.20ON1067109414730.0
Kpol_1037.256.20ON1105110612821e-157
TPHA0J003306.20ON1107112111631e-140
CAGL0L07634g6.20ON1130110911641e-140
NCAS0H008206.20ON1146115310991e-130
YML002W6.20ON73774610651e-130
KNAG0M011606.20ON113172610491e-123
NDAI0D008006.20ON119311959921e-115
TBLA0A072606.20ON120412208881e-100
YML003WsingletonOFF2902854858e-54
KAFR0L004006.20ON9427864765e-48
KAFR0B064005.466ON52958870.13
NCAS0A024404.232ON82041744.5
TBLA0G005406.63ON36087734.6
NDAI0K028506.63ON419140726.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11242g
         (1097 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...  2197   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...  1209   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   882   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   759   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   686   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   667   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   654   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   640   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   615   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   615   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   600   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   572   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   498   e-157
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   452   e-140
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   452   e-140
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   427   e-130
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   414   e-130
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   408   e-123
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   386   e-115
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   346   e-100
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   191   8e-54
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   187   5e-48
KAFR0B06400 Chr2 complement(1324711..1326300) [1590 bp, 529 aa] ...    38   0.13 
NCAS0A02440 Chr1 complement(460788..463250) [2463 bp, 820 aa] {O...    33   4.5  
TBLA0G00540 Chr7 (112550..113632) [1083 bp, 360 aa] {ON} Anc_6.6...    33   4.6  
NDAI0K02850 Chr11 (644266..645525) [1260 bp, 419 aa] {ON} Anc_6....    32   6.6  

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score = 2197 bits (5692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1069/1097 (97%), Positives = 1069/1097 (97%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
            LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120

Query: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXXXX 180
            LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRF              
Sbjct: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSANSSLAA 180

Query: 181  XXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240
              EPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE
Sbjct: 181  STEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240

Query: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300
            DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL
Sbjct: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300

Query: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
            YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV
Sbjct: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360

Query: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420
            ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF
Sbjct: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420

Query: 421  ESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNR 480
            ESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNR
Sbjct: 421  ESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNR 480

Query: 481  QPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTE 540
            QPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTE
Sbjct: 481  QPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTE 540

Query: 541  LESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDA 600
            LESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDA
Sbjct: 541  LESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDA 600

Query: 601  MVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGL 660
            MVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGL
Sbjct: 601  MVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGL 660

Query: 661  TPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQS 720
            TPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQS
Sbjct: 661  TPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQS 720

Query: 721  YQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPXXX 780
            YQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIP   
Sbjct: 721  YQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPAES 780

Query: 781  XXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQ 840
                     KMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQ
Sbjct: 781  LAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQ 840

Query: 841  EQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTM 900
            EQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTM
Sbjct: 841  EQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTM 900

Query: 901  FQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDI 960
            FQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDI
Sbjct: 901  FQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDI 960

Query: 961  PHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSK 1020
            PHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSK
Sbjct: 961  PHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSK 1020

Query: 1021 NLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALYD 1080
            NLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALYD
Sbjct: 1021 NLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALYD 1080

Query: 1081 YKDKFASKPVNTLHIIP 1097
            YKDKFASKPVNTLHIIP
Sbjct: 1081 YKDKFASKPVNTLHIIP 1097

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score = 1209 bits (3128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/1085 (55%), Positives = 780/1085 (71%), Gaps = 4/1085 (0%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPYYLPVLLNPLINAVFNCPTP NS L+KVF+ IEK RF L+ P  E+LLEYEDLESG  
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
            LQDLCY+  FVSDHI+LL G     EEEYKTLSGKTI LR+QQ  +FT   FD RRRC++
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120

Query: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXXXX 180
               ELL+NFNEY +G +T+PIIHVDFPLTGRLARRDEW  F+  +               
Sbjct: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180

Query: 181  XXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240
              +   SLEQ+LR +P YG+ L+ I++ QR +L+SS     +LA+HF+QTC+KAL  ++ 
Sbjct: 181  HGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVRA 240

Query: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300
              +F+  PNL + +HEY+E+NLYDD+WAQLTNSL+DSEIE+ SD+S+L++IS+SQVPSFL
Sbjct: 241  YPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFL 300

Query: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
            YP++ +KFD+R +TQ EKN++ AVE  R++ VTN HS+KAKVI+ETLQT+SRSL ++D+ 
Sbjct: 301  YPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRA 360

Query: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420
            +++DADTLVSL VVVVC A+VKDL+SHLFYLQEF KD+N +TFGILAYGMSTLEAVL YF
Sbjct: 361  VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYF 420

Query: 421  ESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNR 480
            ES EK+  LEK+C +N S+W+++++G + L +     + D+L+ RT  G SCL++CLQ+R
Sbjct: 421  ESPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHR 480

Query: 481  QPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTE 540
            +   F  +    E  FPLEDLL+DET +GSNLLI ML++GC  L+   I  L  +CTK E
Sbjct: 481  RTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDE 540

Query: 541  LESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDA 600
            L +FLNH N+YQRS GHYLMHA  LI  VG  +NWEQRDCNGHTPLFAI+R YD  DY  
Sbjct: 541  LIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFD 600

Query: 601  MVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGL 660
            MV  AY++A     ++  +FR+S H D+KGNTLLHVIKS+VS++L DP ++VN+ N KGL
Sbjct: 601  MVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGL 660

Query: 661  TPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQS 720
            TP+MVY RYNR+ N+++IL+D+RLII K Q+G+YL+CFDY+KNP VL ELGK+A +LP  
Sbjct: 661  TPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASYLPFE 720

Query: 721  YQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPXXX 780
            + I  H++K EGDEWVLW+T+ G     P KV +RSL+FIQ+FL  FS  + MTF+P   
Sbjct: 721  FSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDE 780

Query: 781  XXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAEHVQ 840
                     + +I+ +N+++TK FL+R SV LS++ ++  F   F + + +L ++     
Sbjct: 781  LLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDSNLNLSSSRGLGS 840

Query: 841  EQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTM 900
             +       M+EPEEV SIQ I+KFN +EI A+K+  L++KKLA+F  LKGKDL  +   
Sbjct: 841  SESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMT 900

Query: 901  FQSHGNNFTKIIGRSTNVFGSLKHSLPQC-EFGYLANNTALLELSSRLLVQKIDKILNHD 959
            F +     T+  G+  +    L    P   +F  +ANN AL EL S LL + I ++LN D
Sbjct: 901  FGAKCKYVTQ--GKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDD 958

Query: 960  IPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVGRINRSS 1019
            IP WW TYGEL+SLR EY K+FPD  RP V+EN+G   SYIETKR +LEQ    RIN +S
Sbjct: 959  IPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKRTKLEQSYAARINHTS 1018

Query: 1020 KNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALY 1079
              L   S  + + NE LAVELNNFINFK EF  SA IKEHA  NIK L+EQLVC EEALY
Sbjct: 1019 VRLSEISTKINQDNERLAVELNNFINFKNEFLKSA-IKEHADTNIKRLREQLVCSEEALY 1077

Query: 1080 DYKDK 1084
            DYK K
Sbjct: 1078 DYKHK 1082

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1091 (40%), Positives = 668/1091 (61%), Gaps = 13/1091 (1%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPY+LP+LLNPL+N+VFNCPTP  SPL+K+F  +  QRF LV P   ILL Y+DL++GSS
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
            LQDLCY+  FV++HI++L       ++E+KTL+GKT+ +R+Q   + TG+GF ++RRC++
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXXXX 180
              TEL  NFN+Y +GS  +P+IH+D PL     + DE    + +                
Sbjct: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDE---LQVFGVRSTNTSSLPLSTDL 177

Query: 181  XXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240
                 +S EQ+ R HP  GD+ S + + QR  ++++    D+L   F +   +A   I+ 
Sbjct: 178  TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237

Query: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300
            ++ F     L   +H YVE+NLYDD W Q+T   +D EIE   D+++L+ I+ISQVP+  
Sbjct: 238  ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297

Query: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
            YP  + KF ++ VT  EK+L +A +C +RL  ++SHS K K+I++TLQT++   E  D  
Sbjct: 298  YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357

Query: 361  I---SVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVL 417
            I   ++DADTL+ L+V+VVC+++VK+LKSHLFYLQ F+ D N+I FG++AY +STLEAVL
Sbjct: 358  IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417

Query: 418  SYFESRE---KLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLS 474
             YFE  E   K++ LE +C  N  +W+ L+   +   SL     +DILR RT  G SCLS
Sbjct: 418  CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKS--YRDILRIRTAGGESCLS 475

Query: 475  ICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFR 534
            +C+Q    +    L   FEH  PLED+L+D+T+ GS LL+Q L+ G + ++   +E+L +
Sbjct: 476  VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535

Query: 535  SCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYD 594
            SCT  EL  +LN  NR++R++ HYL   L +  K+G F +WE +D +GHTPLFAI R+YD
Sbjct: 536  SCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595

Query: 595  HTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNS 654
            H DY  MV  A+++A  W  ++G+ F  S H+D KGNTLLHV+K+N+ ++L+   ++VN 
Sbjct: 596  HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655

Query: 655  FNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHA 714
             NKKGLTP+MVY +YNRLDN+K ILRD RLI++K Q   +L CFDY+KNPV+  ELG HA
Sbjct: 656  VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715

Query: 715  FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMT 774
                +  ++ AH  +FE + W LW+TL G       + ++ +++ IQ  L  + + N M+
Sbjct: 716  AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775

Query: 775  FIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVN 834
            F+P            K  ++S+ +LE   FL   ++VL LIC++EEF+     P+  LVN
Sbjct: 776  FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVN 835

Query: 835  AAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDL 894
                   +  N +   IEPEE+ SIQ  ++FN +E+  I+    +L+KL+IF  LK +D+
Sbjct: 836  WIRESGRKRTNVS-RRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDI 894

Query: 895  ERSHTMFQSHGNNFTKI-IGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKID 953
             ++  M  S         I ++  + G  +          L +N   L+  +  LV KID
Sbjct: 895  NQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVGKID 954

Query: 954  KILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIETKRVRLEQGLVG 1013
            ++L   +  WWK Y EL+  R++YNKNFP+ V+P + +N G   +Y+E KR +LE+ L  
Sbjct: 955  QLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKRSKLEEKLSA 1014

Query: 1014 RINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVC 1073
            +I    + L   +  +++ +E+LA EL+ ++ FK  +  +  I++     I  L++ +  
Sbjct: 1015 QIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKINTLKDTMRH 1074

Query: 1074 LEEALYDYKDK 1084
             + +L +YK++
Sbjct: 1075 FKRSLKNYKEQ 1085

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/840 (43%), Positives = 536/840 (63%), Gaps = 11/840 (1%)

Query: 1   MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
           MPY+LP+LLNPL+N+VFNCPTP  SPL+K+F  +  QRF LV P   ILL Y+DL++GSS
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
           LQDLCY+  FV++HI++L       ++E+KTL+GKT+ +R+Q   + TG+GF ++RRC++
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 121 LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXXXX 180
             TEL  NFN+Y +GS  +P+IH+D PL     + DE    + +                
Sbjct: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDE---LQVFGVRSTNTSSLPLSTDL 177

Query: 181 XXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240
                +S EQ+ R HP  GD+ S + + QR  ++++    D+L   F +   +A   I+ 
Sbjct: 178 TQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAFELIRH 237

Query: 241 DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300
           ++ F     L   +H YVE+NLYDD W Q+T   +D EIE   D+++L+ I+ISQVP+  
Sbjct: 238 ERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPF 297

Query: 301 YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
           YP  + KF ++ VT  EK+L +A +C +RL  ++SHS K K+I++TLQT++   E  D  
Sbjct: 298 YPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDAD 357

Query: 361 I---SVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVL 417
           I   ++DADTL+ L+V+VVC+++VK+LKSHLFYLQ F+ D N+I FG++AY +STLEAVL
Sbjct: 358 IEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVL 417

Query: 418 SYFESRE---KLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLS 474
            YFE  E   K++ LE +C  N  +W+ L+   +   SL     +DILR RT  G SCLS
Sbjct: 418 CYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSL--KSYRDILRIRTAGGESCLS 475

Query: 475 ICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFR 534
           +C+Q    +    L   FEH  PLED+L+D+T+ GS LL+Q L+ G + ++   +E+L +
Sbjct: 476 VCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQ 535

Query: 535 SCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYD 594
           SCT  EL  +LN  NR++R++ HYL   L +  K+G F +WE +D +GHTPLFAI R+YD
Sbjct: 536 SCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYD 595

Query: 595 HTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNS 654
           H DY  MV  A+++A  W  ++G+ F  S H+D KGNTLLHV+K+N+ ++L+   ++VN 
Sbjct: 596 HPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENIDVNE 655

Query: 655 FNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHA 714
            NKKGLTP+MVY +YNRLDN+K ILRD RLI++K Q   +L CFDY+KNPV+  ELG HA
Sbjct: 656 VNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHA 715

Query: 715 FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMT 774
               +  ++ AH  +FE + W LW+TL G       + ++ +++ IQ  L  + + N M+
Sbjct: 716 AEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRNPMS 775

Query: 775 FIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVN 834
           F+P            K  ++S+ +LE   FL   ++VL LIC++EEF+     P+  LVN
Sbjct: 776 FLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASDLVN 835

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1107 (35%), Positives = 631/1107 (57%), Gaps = 45/1107 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            M Y++PVLLNPL+N+VFNC  P +S  +K+F +++ +RF L+ P  E LL + D ESGSS
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LQDLCYSASFVSDHILLL-------GGGGCSHEE-EYKTLSGKTITLRNQQKALFTGEGF 112
            + DLC +  FV+ HILLL       GG   S  + EYKTL+ K + +R+    + T EGF
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 113  DARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXX 172
              RRR ++   EL++NFN+Y  GS  + ++H+D PL G L R+ + P   A         
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180

Query: 173  XXXXXXXXXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAA-LSSSTYNADNLAAHFMQTC 231
                      +  +S E +LR HP + + L+      R+  L+   Y        F    
Sbjct: 181  KGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPY-----EELFRMIV 235

Query: 232  EKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNI 291
            ++  A +  D+ FR  P+L   I +YVE+NL+DD W ++ NS +  EI+ +     L+ +
Sbjct: 236  KQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP----LKFL 291

Query: 292  SISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVS 351
            SI+++ + LY    +KF ++ VT +EKN+  A+     LP+T++H+ KA  ++ TLQ++S
Sbjct: 292  SINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLS 351

Query: 352  ----RSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILA 407
                + ++I    I++DADTL+S  V+VVC+ +VK++KSHLFYL++F+KD NSI FGIL 
Sbjct: 352  NTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILG 411

Query: 408  YGMSTLEAVLSYFES---REKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRT 464
            Y +STLEAV+ YF+     +KL+ L+   +     +  ++D       L+ S+ +  L  
Sbjct: 412  YAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEF 471

Query: 465  RTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSL 524
            RTP G S LS C+ N +  L   L   +E  FPLED+L+DETV+GS LLIQ L    S  
Sbjct: 472  RTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEA 531

Query: 525  SGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHT 584
            +   +E+L  SCT+ EL  ++N  ++ +R+  HYL H ++++  +GK+INW+ +D NGHT
Sbjct: 532  AQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHT 591

Query: 585  PLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVV 644
            PLF I R YD  +Y+AM+  A++SA  W    G+ F+ S H+DNKGNTLLH+IK+NVS++
Sbjct: 592  PLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSIL 651

Query: 645  LDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNP 704
            LD   V++N  NKKGLTP+M+Y RYNR DN+K+I+RD+R+I+ K Q+ S+L  FDY +NP
Sbjct: 652  LDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNP 711

Query: 705  VVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTL-VGSVPNAPAKVIQRSLKFIQSF 763
            +VL EL   A           H++K+E   W   +T+ +G+  +   K ++  +K +Q+ 
Sbjct: 712  LVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNL 771

Query: 764  LISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEH 823
                 K +  +F+P            K ++ SI +LET +F    +    ++ R +    
Sbjct: 772  FQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK 831

Query: 824  IFNNPSGSLVNAAEHVQEQEANSTYGM-----IEPEEVASIQKIMKFNRTEILAIKSGAL 878
            +    S  LV+     Q+++ N++  +     +EPEE+  +   ++FNR E+ A+K   +
Sbjct: 832  LVLRES-RLVSWIRS-QDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLM 889

Query: 879  MLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNT 938
             +KKL IF  LK  DL  S+      G  +   + +   +F  L+  +  C FG  A  T
Sbjct: 890  TMKKLLIFLKLKNTDLTHSYQFLSLFGTEYN--LAQDRLLFKDLE--INCCAFGEEATMT 945

Query: 939  -----ALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENT 993
                 A LE  +  L+ +++++L+ DIP WWK YG+++ +   Y + FP+    R    T
Sbjct: 946  FVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPN--ISRNDSGT 1003

Query: 994  GFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVS 1053
            G I+S+ E KR ++E  L   +    K + R    +  ++E LA EL+ ++ FK+ F+++
Sbjct: 1004 GIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKSNFFIN 1063

Query: 1054 ATIKEHAAMNIKWLQEQLVCL-EEALY 1079
              ++     NI  L+ +LV + + ALY
Sbjct: 1064 GILRRAVRENINILKGRLVEMRKRALY 1090

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1082 (34%), Positives = 585/1082 (54%), Gaps = 20/1082 (1%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPY+LPVLLNPL+NAVFNCPTP  SPL+K+F  ++ QRF L+ P+ ++LL+Y+DL+SG  
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
            L +LCY+  FV+ HIL+        E+EY+TL+G ++ +R+Q   + +       R+C+V
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCRV 117

Query: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXXXX 180
               E+L NFN+Y      +P++H+D PL G L R DE   F +Y                
Sbjct: 118  KSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISE 177

Query: 181  XXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE 240
               P    E+ +R +P  G +L    +  R  + +     D L   F          I+E
Sbjct: 178  NHIP---FEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKE 234

Query: 241  DQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFL 300
            D++FR +  L     EYVE+N+Y+D W +L       E +  S +S  + IS++ V + L
Sbjct: 235  DKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATIL 294

Query: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
            YP     FD+R VT+VEK + +A +C  +L +TNSH+ KAK++V T Q ++  +E     
Sbjct: 295  YPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSID 354

Query: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420
             ++DADTL+ L++VV+C+++VK+LKSHL YL+EFA   + + FG+  Y +ST+EAVL+YF
Sbjct: 355  PTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYF 414

Query: 421  ES---REKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICL 477
            E+    EKLK L     +N  +W+ +  G     +++ S  K+ L +R+    S LSIC+
Sbjct: 415  EAGDGTEKLKKLISLSEANRVFWDLIRSGV----AVSLSSYKNSLISRSSNCESSLSICI 470

Query: 478  QNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCT 537
               + +L   +   ++    LEDLL D     S LLIQ L+ G   ++   I+++  +CT
Sbjct: 471  HAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCT 530

Query: 538  KTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTD 597
              E   ++N  N   R+  HYL  A  +I K+G +++W ++D N HTPLF I R YD   
Sbjct: 531  NNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLH 590

Query: 598  YDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNK 657
            Y  M+  +++    +C  +G+ F  + H+D  GN+LLH++K  +  +L  P +NVN  N 
Sbjct: 591  YSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNI 650

Query: 658  KGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFL 717
            KG+TP+M+YA+YNR++NI+ IL DKRLI+ K QN   L   DY+KNP++L  +G H    
Sbjct: 651  KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710

Query: 718  PQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIP 777
                 + A  IKFE + W LW+T+  S  +     +++S+K IQ  L  ++K + M F+P
Sbjct: 711  SLYGLLSADGIKFEDNCWYLWITVKFS--DNSYSTLRQSVKNIQGLLQFYNKKHPMNFLP 768

Query: 778  XXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAAE 837
                        K  I+ +  LE   FL   + +LS+I ++ E+  +       L     
Sbjct: 769  IDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLR 828

Query: 838  HVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERS 897
                +   +    IEPEEV+SIQ  +KFN +E   IK    +L+KL +F  LK +D+E +
Sbjct: 829  TNNFKPRANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECA 888

Query: 898  HTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKIDKILN 957
              +        +  +G S  V  +   S               + +    L  KI  +L+
Sbjct: 889  QRIIYQQMEIVSNSVGPS--VEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLD 946

Query: 958  HDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVA---ENTGFISSYIETKRVRLEQGLVGR 1014
              +  WW+ YGEL SLR EY +NFP D +       E+ GF  SYIE KR + E  L  R
Sbjct: 947  SKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQAR 1006

Query: 1015 INRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCL 1074
            +      L   S  L++ +E+LA E++ F+ FK   + S  +K +A + IK  +  L  +
Sbjct: 1007 LRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVI 1066

Query: 1075 EE 1076
            EE
Sbjct: 1067 EE 1068

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1087 (34%), Positives = 604/1087 (55%), Gaps = 31/1087 (2%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPY+LPVLLNPL+NAVFNCP P  SPL+K+F   + ++F LV P  E+LL+Y+D  +   
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120
            L +LCY+  FV+ H L+        E E++T++GK++ +R  Q  + T +   + ++C++
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIR-PQSGIITAQP--SAKKCRI 117

Query: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYR-FXXXXXXXXXXXXX 179
               ELL +FN+Y  G + + ++++D PL G      E       R F             
Sbjct: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVG------EIELITPLRVFGPQEQPLQYQRIT 171

Query: 180  XXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQ 239
               +    LEQ LR HP  G++L  + +  +  +     +   L   F +  EK    I+
Sbjct: 172  QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIK 231

Query: 240  EDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSF 299
             D++FR + NL   +  YVE+N+Y+D W +L      +E +    + I R+IS++Q+ + 
Sbjct: 232  LDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS 291

Query: 300  LYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDK 359
            +YP +  KF++  VT++EK + +A EC  +L +TNSH  KA++++ T Q ++        
Sbjct: 292  IYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATL 351

Query: 360  VISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSY 419
               +DADTL+ L+VVVVC+A+VK+LKSHL YL+EFA++S+ + FG+L Y +STLEAV+ Y
Sbjct: 352  DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY 411

Query: 420  FE---SREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSIC 476
            F+   S  KL+ L   C  N  +W  +  G +P+   N  E +++L +RTP+  S LS+C
Sbjct: 412  FDIGGSSIKLERLITQCQRNKIFWNLIEQG-IPI---NLKEHEEVLISRTPSCESVLSLC 467

Query: 477  LQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSC 536
            +Q  + ++F  +   ++  F LED+L D      +LLIQ L  G   ++   I++L  +C
Sbjct: 468  IQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANC 527

Query: 537  TKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHT 596
            T TE+ +++N  +   R+ GHYL    +++ ++GKF++W+++D N HTPLF + R YDH 
Sbjct: 528  TNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHP 587

Query: 597  DYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFN 656
             Y  ++ + ++    + + +GK+F  + H+D  GNTLLH+IK  + + L  P  NVN  N
Sbjct: 588  SYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCN 647

Query: 657  KKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFF 716
             +G+TP+MVYA+YNR++NI+ IL DKRLI+ K Q+   L   DY+KNP++L  +G     
Sbjct: 648  TRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAK 707

Query: 717  LPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFI 776
                  +  HNIK+E + W LW+T   S+     K    +LK IQS L  ++K + M+F+
Sbjct: 708  NSLYGCLSVHNIKYEENAWYLWIT--SSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFL 765

Query: 777  PXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAA 836
            P            K  IIS+  LE    L   +  LS+I ++E+++++F+     L    
Sbjct: 766  PIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWL 825

Query: 837  EHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLER 896
                 ++  +    IEPEE+ SIQ  +KF+ TE   ++    +LKKL IF   K  D+E 
Sbjct: 826  RASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIEC 885

Query: 897  SHTMFQSHGNNFTKIIG----RSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKI 952
            S  +  S G     ++     R++         +   E    A +   + L S  L  KI
Sbjct: 886  SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFE---QAVDFMCMCLDS--LTSKI 940

Query: 953  DKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVA---ENTGFISSYIETKRVRLEQ 1009
             ++L+  +  WW  YGE+ +L+ EY +NFP+  +P  A   ++ GF  SY+E KR +LE 
Sbjct: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLES 1000

Query: 1010 GLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQE 1069
             L  R++  S+NL      L+  +E LA E++ FI+ K   +++  +K +    IK  + 
Sbjct: 1001 KLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKN 1060

Query: 1070 QLVCLEE 1076
             L+ +EE
Sbjct: 1061 MLLAIEE 1067

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1103 (33%), Positives = 613/1103 (55%), Gaps = 45/1103 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPY+LPVLLNPL+NAVFNCP P  S L+K+F+ ++ ++F L+ P  + LL+  D  SGS 
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSH-------EEEYKTLSGKTITLRNQQKALFTGEGFD 113
            LQ+LCYS  FV+ H+LL+      +       + ++ TL+GK + +R+Q + + T +GF 
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 114  ARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXX 173
             ++RC + +T+L  NFNEY      +PI+ +D P+     R       +           
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 174  XXXXXXXXXE-PKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCE 232
                     +  K+S + +LR HP +  K + +    R    S+    D     F     
Sbjct: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR----STPEGDDPHIELFHDIIR 236

Query: 233  KALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNIS 292
            +A +A++ D  F + P+L   I++YVE+NLYDD W ++T+  KDSE+E+      LR +S
Sbjct: 237  RAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNG----LRYLS 292

Query: 293  ISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSR 352
            + Q+ + LYP   ++F+++ V  +E N+  A+    RLP+ ++H+ KA  +++TL+ +SR
Sbjct: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSR 352

Query: 353  SLEINDKV--ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGM 410
              +   +V  +++ ADTL+SL V+V+C+ ++++LK  LFYLQ FAK+  SITFG+L Y +
Sbjct: 353  VDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAI 412

Query: 411  STLEAVLSYFE---SREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTP 467
            STLEA + YF+     +K+  LE  C +  S  + L+       S+N    +  L  RT 
Sbjct: 413  STLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSES---SSVNLIHYQKTLSYRTE 469

Query: 468  AGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGN 527
             G S LSIC+ N + ++   L +  E  FPLED+L D+T EG  LL+Q L  G    +  
Sbjct: 470  QGESLLSICIANGKNDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASL 528

Query: 528  FIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLF 587
             ++++  SCT+ E+ ++ N  ++ +R++ HYL H ++++ ++G F +W+ +D +GHT LF
Sbjct: 529  IVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALF 588

Query: 588  AIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDD 647
             I R+YD  +YD M+  +++ A  W   + + F  + H+D K NTLLH++K ++S++L+ 
Sbjct: 589  TIFRSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY 648

Query: 648  PLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVL 707
              V+VN+ N+KGLTP+MVYA+YNRLDN KSIL DKR+I+ K Q+   L   DY KNP++L
Sbjct: 649  ESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLIL 708

Query: 708  GELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISF 767
             E+ K +       +   H +K+E   W++ +T V +      + ++  LK +Q+F  + 
Sbjct: 709  HEIAKQSAMDTAFGKCFVHTLKYESSSWLVNIT-VQADRKGNFETVEFHLKTVQNFFRTV 767

Query: 768  SKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLS-LICRQEEFEHIFN 826
             +T  MTF+P            K ++ SI +LET  +LR  +   + LI  QE  + I  
Sbjct: 768  LRTCPMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILA 827

Query: 827  NPSGSLVNAAEHVQEQEANSTY---GMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKL 883
            N S  L       +     +T+     +EPEE++ IQ  ++FN+ E+  ++S   ++KKL
Sbjct: 828  NESKLLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKL 887

Query: 884  AIFGILKGKDLERSHTMFQSHGNN-------FTKIIGRSTNVFGSLKHSLPQCEFGYLAN 936
            AIF  LK  D+E+S  +    G+         T      T V+G+    L       L  
Sbjct: 888  AIFLRLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMIL-------LVE 940

Query: 937  NTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVR-PRVAENTGF 995
            +  L+   +  L   I+ +L   IP WWK YGEL++ R +Y +NFP  V+    + + G 
Sbjct: 941  DIDLMLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGI 1000

Query: 996  ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSAT 1055
            I   +E K+ +LE+ L   I  + +++ +   ++   +ESLA +L+ F+ FK  +     
Sbjct: 1001 IGKILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGV 1060

Query: 1056 IKEHAAMNIKWLQEQLVCLEEAL 1078
            IK     NIK L+E+L+ ++  L
Sbjct: 1061 IKRWVRENIKELKERLIHIQRDL 1083

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1105 (33%), Positives = 599/1105 (54%), Gaps = 58/1105 (5%)

Query: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62
            Y+LP LLNPLINA+FNCP P+ SPL+K+F  ++ +RF L+ P   +LL Y D+++   L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   DLCYSASFVSDHILLLGGGG----CSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRC 118
            +LCY+A F++ HILL            ++ Y+TL GKT+ ++ +   + T  GF  RRR 
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123

Query: 119  QVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXX 178
            ++L+T++L NFN+YF+G+  + I+++D PL       D    F +Y              
Sbjct: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAPNLL 183

Query: 179  XXXXE-PKASLEQMLRAHPSYGDKLSAIIRT-QRAALSSSTYNADNLAAHFMQTCEKALA 236
                +  ++S E +L  HP++  +L  +    +RAAL     N D     F +  E+A  
Sbjct: 184  MDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAAL-----NDDPSKKMFEELVEQAFD 238

Query: 237  AIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQV 296
             ++ D  F+ F NL   IH+Y E+NLY+D W++LT   K  E+  ++        S++Q+
Sbjct: 239  GMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTEN----CEYFSVNQL 294

Query: 297  PSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEI 356
             +  Y  D + F +  +T +E+ +  A +  ++L +++S++ K+K++VETLQ +S + ++
Sbjct: 295  LTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDM 354

Query: 357  NDKV---------ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILA 407
                         +++DADTL+SL V+VVC++E K ++SHL+YLQ F+ +S+S  FGIL 
Sbjct: 355  GSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILG 414

Query: 408  YGMSTLEAVLSYFESREKLKLLEKH----CSSNASYWEALADGKLPLGSLNP-SEVKDIL 462
            Y +STLEAV+ YFE+  K           C       + L+  + P   +N  +  KDIL
Sbjct: 415  YAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLS-CENPTNEVNDLATYKDIL 473

Query: 463  RTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCS 522
              R   G S LS+C+ N + ++ L + +++E  FP+ED+L DET++GS LLI+ +  G  
Sbjct: 474  AYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNL 533

Query: 523  SLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNG 582
              +   I ++  +CT  EL +++N  ++Y RS  HYL H +D++  +G +INW+Q++ +G
Sbjct: 534  EATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSG 593

Query: 583  HTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVS 642
             TPLF+I R+YD  +Y+ MV  A+  A  W       F  S H DNKGN+LLHV+K++VS
Sbjct: 594  QTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVS 653

Query: 643  VVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIK 702
            ++L    +N+N  N KGLTP+MVY +Y RL NI +I +D RLI++K QN ++ TCFDY K
Sbjct: 654  ILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAK 713

Query: 703  NPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNA--PAKVIQR 755
            + +VL ++G+       F L   + +R HN+    +        V SV     P      
Sbjct: 714  DRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVN--------VTSVSKTEEPFVTAVI 765

Query: 756  SLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLI 815
            ++K IQ  L S  K N  TF+P            +  +  I + + +  L + +   +++
Sbjct: 766  NMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVL 825

Query: 816  CRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEI 870
               ++  +++F + +  L    +N +   Q+  +      +EPEE+  IQ  ++FN  EI
Sbjct: 826  LFLKKVPQNLFTDEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEI 885

Query: 871  LAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSL--KHSL-P 927
            L+ K+   +L+K+ IF  LK  D E ++      G   T   G++ + F ++   H +  
Sbjct: 886  LSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTN--GKAADAFTTIIKNHKMFS 943

Query: 928  QCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRP 987
                  L  +   LE  +  L   I  IL   IP+WWK YGE ++L   Y K FP  V+P
Sbjct: 944  DLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKP 1003

Query: 988  RVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFI 1044
            +    T     +  +IETKR + EQ L  +I  SSK L      +  ++E+LA EL+N++
Sbjct: 1004 KSTAGTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063

Query: 1045 NFKAEFWVSATIKEHAAMNIKWLQE 1069
             F+       TI   A  NI  LQE
Sbjct: 1064 EFRKACLDQRTIVAFAIKNISVLQE 1088

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1109 (33%), Positives = 600/1109 (54%), Gaps = 64/1109 (5%)

Query: 4    YLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQD 63
            +LP LLNPLINA+FNCP P+ SPL+K+F  ++  RF L+ P  E LL Y D+++   L +
Sbjct: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64

Query: 64   LCYSASFVSDHILLLGGGGC----SHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQ 119
            LCY+A F++ HILL+         S +  Y+TL GKT+ ++ +   +    GF  RRR +
Sbjct: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124

Query: 120  VLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYR-FXXXXXXXXXXXX 178
            +L T++L NFN+YF+G++ + II+++ PL+      D    F +Y+              
Sbjct: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184

Query: 179  XXXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAI 238
                + ++S E +L  HP+   +L  +    R    S     D     F    ++A   +
Sbjct: 185  DSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSD----DPSEKIFECIVQQAFEGM 240

Query: 239  QEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPS 298
            + D  F+ FPNL   IHEY E+NLYDD W++LT+  K  E+  +      +  SI+ + +
Sbjct: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEE----YKYFSINHLLA 296

Query: 299  FLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEIND 358
              Y  D ++F ++ VT +EK +  A +  ++L +T+S++ K+K++VETLQ +S + ++  
Sbjct: 297  DFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGS 356

Query: 359  KVISV---------DADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYG 409
              + V         DADTL+SL V+V+C++E K LKSHL+YLQ F+ +S+S  FGIL Y 
Sbjct: 357  HQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYA 416

Query: 410  MSTLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSL-----------NPSEV 458
            +STLEAV+ YFE  +K        S N +    L      L ++           N +  
Sbjct: 417  VSTLEAVVCYFEDFKK-------NSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATY 469

Query: 459  KDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLD 518
            KDIL  R   G S LSIC+ N + ++ L + ++++  FPLEDLL DET++GS LLI+ + 
Sbjct: 470  KDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIK 529

Query: 519  NGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQR 578
            +G    +   I ++  +CT+ EL S++N  ++Y R+  HYL H +D++  +G +++W+++
Sbjct: 530  SGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRK 589

Query: 579  DCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIK 638
            +  G TPLF+I R+YD  +Y+AMV  A+  A  W   + + F    H DNKGN LLHV+K
Sbjct: 590  NSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLK 649

Query: 639  SNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCF 698
            ++ S++L    +++N  N KGLTP+MVY +Y RL+NI++I++D+RL+++K Q  ++ TCF
Sbjct: 650  TDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCF 709

Query: 699  DYIKNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVI 753
            DY K+  VL ++G+       F L   + +R HN+    +          S    P    
Sbjct: 710  DYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVN------ITFASDTEKPFSNT 763

Query: 754  QRSLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLS 813
              ++K IQ  L S  K N  TF+P            +  +  I + +    L + S   +
Sbjct: 764  VINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFN 823

Query: 814  LICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRT 868
            ++   ++  + +F + +  L    +N ++  Q+Q +   Y  +EPEE+  IQ  ++FN  
Sbjct: 824  VLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFD 883

Query: 869  EILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVF-GSL-KHSL 926
            EI + K+   +L+K+ IF  LK  D +  +      G +      ++ + F G+L  H++
Sbjct: 884  EISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYN--AKAADAFAGNLTNHNM 941

Query: 927  -PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDV 985
                    L  +   LE  +  L   +  IL   IP+WWK YGEL++L   Y K FP  V
Sbjct: 942  FNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVV 1001

Query: 986  RPRVAENT-GFI--SSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNN 1042
            +P+   +T G I    +IETKR + EQ L  +I  SSK+L      +  ++E LA EL+N
Sbjct: 1002 KPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSN 1061

Query: 1043 FINFKAEFWVSATIKEHAAMNIKWLQEQL 1071
            ++ F+        I   AA NI  LQE +
Sbjct: 1062 YMEFRKACLNQRNIVAFAATNISVLQENI 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/1109 (32%), Positives = 594/1109 (53%), Gaps = 62/1109 (5%)

Query: 3    YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62
            Y+LP LLNPLINA+FNCP P+ SPL+K+F  ++ +RF L+ P    LL Y D+++   L 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   DLCYSASFVSDHILLLGGGG----CSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRC 118
            +LCY+  F++ HILL            +  Y+TL GK + ++ +   +    GF  R+R 
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123

Query: 119  QVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXXXXXXX 178
            ++LET++L NFN+YF+G++ + I+ +D PL   +A  D    F +Y              
Sbjct: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSNLP 183

Query: 179  XXXXE-PKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAA 237
                E  ++S + +L  H +   +L  +    R        N D     F    +++   
Sbjct: 184  VNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAP----NDDPSKKMFEDIVQQSFDG 239

Query: 238  IQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVP 297
            ++ D  F+ F NL   IH+Y E+NLYDD W++L    K  E++ +      +  S++Q+ 
Sbjct: 240  MKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK----YKYFSVNQLL 295

Query: 298  SFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEIN 357
            +  +  D ++F +  +T +E+ +  A +  ++L +T+S++ K+K++VETLQ +S   EI+
Sbjct: 296  ADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEIS 355

Query: 358  D---------KVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAY 408
                        +++DADTL+SL V+VVC++E K LKSHL+YLQ F+ + +S  FGIL Y
Sbjct: 356  SHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGY 415

Query: 409  GMSTLEAVLSYFESREKLKLLEKHCSSNASYWEA--LADGKLPLGSLNPSE-------VK 459
             +STLEAV+ YFE  +K    E    +N SY +   L D    L S NP+         +
Sbjct: 416  AISTLEAVVCYFEDFDKNN--ENLAKANVSYQKTRELLDK---LSSENPTNEIENLATYE 470

Query: 460  DILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDN 519
            D L+ R   G S LSIC+ N +  + L + T++E  FP+ED+L DET++GS LLI+ +  
Sbjct: 471  DNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKT 530

Query: 520  GCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRD 579
            G    +   I ++  +C++ EL S++N  ++Y R+  HYL H +D++  +G +++W++++
Sbjct: 531  GNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKN 590

Query: 580  CNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKS 639
             +G TPLF+I RTYD  +Y+ MV  A+  A  W       F    H D+KGN+LLH++KS
Sbjct: 591  SSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKS 650

Query: 640  NVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFD 699
            +VS++L    +++N  N KGLTP+M+Y +Y R+ NI +I +D RLI++K QN ++ TCFD
Sbjct: 651  DVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFD 710

Query: 700  YIKNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQ 754
            Y K+  VL ++G+       F L   + +R HN+    +          S  + P     
Sbjct: 711  YAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTN------ITTASNTDKPFLTTV 764

Query: 755  RSLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSL 814
             ++K IQ  L S  K N  TF+P            +  +  I + + +  L + +   ++
Sbjct: 765  INMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNV 824

Query: 815  ICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTE 869
            +   ++  +++F + +  L    +N ++  Q+  +      +EPEE+  IQ  ++FN  E
Sbjct: 825  LLFLKKVPQNLFTDEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDE 884

Query: 870  ILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKII-GRSTNVFGSL--KHSL 926
            I + K+   +L+K+ IF  LK  D E ++   +  G    KII G + + F  +   H++
Sbjct: 885  ISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGR---KIINGEAADAFARIFTNHNM 941

Query: 927  -PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDV 985
                    L  + + LE  +  L   +  IL   I  WWK YGE ++L+  Y K FP  V
Sbjct: 942  FSDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVV 1001

Query: 986  RPRVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNN 1042
            +P+ A +T     + S+IETKR + EQ L  +I  SSK L      +  ++E LA EL+N
Sbjct: 1002 KPKSATDTPSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSN 1061

Query: 1043 FINFKAEFWVSATIKEHAAMNIKWLQEQL 1071
            ++ F+       TI   A  NI   QE +
Sbjct: 1062 YMEFRKACLDQRTIVAFATTNIGIFQEYI 1090

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/1094 (32%), Positives = 578/1094 (52%), Gaps = 56/1094 (5%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            MPY+LPVLLNPL+NA+FNCP+P+ S L+++F+R++ +RF ++ P+ E LL+++DLESG  
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCS-------HEEEYKTLSGKTITLRNQQKALFTGEGFD 113
            L +LCY   FV+ HI+++             +  ++ TL+G+ +++R +   + TG+GF 
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 114  ARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFXXXXXXX 173
             RR+  + E  LL  FN+Y +GS+  PI+H+  PL G L   DE   F            
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 174  XXXXXXXXXEPKA-SLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCE 232
                     + K    EQ +++     ++++      +A +  +  +   +   ++ T +
Sbjct: 181  QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAI-SVIGIRTEWLNTRD 239

Query: 233  KALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNIS 292
                 I  D+      +L   I++YVE+ L+ D   QL+  ++D E+E++ DF  LR+IS
Sbjct: 240  SIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRSIS 299

Query: 293  ISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSR 352
            ++QVP+  YP D + F +  V ++EK++ +A+E L+ + +  +HS K +V+  T++ +SR
Sbjct: 300  LNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLSR 359

Query: 353  SLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMST 412
              EIN   IS DADTL+SL V+++C+++V  L   L YL  F     SI FG+  Y +ST
Sbjct: 360  --EING--ISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVLST 415

Query: 413  LEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSC 472
             EA LS+F  ++ +  L K C+SN   W ++         L  S     LR RT +G S 
Sbjct: 416  FEAALSFFH-QDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN----LRIRTDSGESL 470

Query: 473  LSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEML 532
            LSIC+Q+    +   L   FE  FPLED+L+D     S LLIQ L    S  +    E++
Sbjct: 471  LSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILSEII 530

Query: 533  FRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRT 592
             +SCT++E+ S+LN  N + R + HY+M  + L+  VG++ NWE +D NGHTPLFA+ R+
Sbjct: 531  LKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAVFRS 590

Query: 593  YDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNV 652
            YD  +YD +V +       W     K F    H+D KGNTLLHV+KS +  +L  P VNV
Sbjct: 591  YDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPDVNV 650

Query: 653  NSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGK 712
            N  + KGLTP+M+Y+RYNR+ NI++I++D+RL+    Q    +T  D+ KNP V   +  
Sbjct: 651  NKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKTILD 710

Query: 713  HAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNS 772
              F       +  H+++FE  +W + +   G          + SL  IQ +L        
Sbjct: 711  ATF---NREPVVIHSLRFEERKWKIGIFSEGIFK-------KYSLDLIQYYLRYLKIMYP 760

Query: 773  MTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSLICR---------QEEFEH 823
             +F P               +  + RL++ H  ++  ++ S +           +EE + 
Sbjct: 761  CSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRGKLWLGKDEEELKV 820

Query: 824  IFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKL 883
            + + P+  L  +   ++          +EPEE+  IQ  +K+N  E   +++  ++LKKL
Sbjct: 821  LLDVPTPYLSESERFIK----------LEPEEINGIQTFLKYNLAEFQKLRNCLIILKKL 870

Query: 884  AIFGILKGKDLERSHTMFQSHGNNFT-KIIGRS-TNVFGSLKHSLPQCEFGYLANNTALL 941
            AI   +K +D+      F S GN  + K + +S  N   +  + L   EF     N   L
Sbjct: 871  AIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEF---TRNLEYL 927

Query: 942  ELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFISSYIE 1001
            E S   L+   + +L      WWK +GEL+ L+ E+ KNFP+D  P  + N  FI +YIE
Sbjct: 928  EHSVVTLLNNFESLLAK-TTLWWKHFGELMELKKEWKKNFPNDKAPPSSANRNFIDTYIE 986

Query: 1002 TKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAA 1061
             KR +    L  ++  SS NL +    ++ ++ES+AV +N FI FK +F+    +K    
Sbjct: 987  GKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVD 1046

Query: 1062 MNI---KWLQEQLV 1072
              I   K + +QL+
Sbjct: 1047 QRIRENKQIMQQLI 1060

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  498 bits (1282), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 312/1106 (28%), Positives = 573/1106 (51%), Gaps = 45/1106 (4%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            + Y++PVLLNPLINAVFNCP P NSPLRK+F RI+ + F L+ P  EILL Y D E G +
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LQDLCYSASFVSDHILLLGGGGCSH------------EEEYKTLSGKTITLRNQQKALFT 108
            L++LCY   FV+ HI+L      ++            +  YK+L+   + ++N       
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 109  GEGFDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGF------- 161
                  +++ ++++ ++L NFNEY  GS  Y II+ D+P +     + E   F       
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 162  KAYRFXXXXXXXXXXXXXXXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNAD 221
               +                 + K+S   ++  H  + +   + I        +   N  
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYI----IDFKNKQLNLT 239

Query: 222  NLAAHFMQTCEKALAAIQEDQSFRAFPN-LRLQIHEYVEMNLYDDFWAQLTNSLKDSEIE 280
            +L  +F +  +KA   ++ ++ F +F N L   I EY+E + Y+  W  +  ++ D++  
Sbjct: 240  SLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFL 299

Query: 281  NQSDFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKA 340
            +      L   SI Q+   LY  + QKF++  V +VE+ +++A +  +++  + SHS K 
Sbjct: 300  HTEMMDFL---SIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKC 356

Query: 341  KVIVETLQTVSRSLEINDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNS 400
            +++++ LQ ++   +++ + + VDADTL++L ++V+C+++V  L++HL+YLQ F+ D N+
Sbjct: 357  QILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENN 416

Query: 401  ITFGILAYGMSTLEAVLSY---FESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSE 457
            + FG+L YG+ST EA L Y   F++ EK      +C  N      ++  +    +     
Sbjct: 417  VKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKIS-SEADHSTFQVKL 475

Query: 458  VKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQML 517
             KD  + R   G S L++C+++++      +   FE  FPLED+L+DE +EG+ LL++ L
Sbjct: 476  YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKAL 535

Query: 518  DNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQ 577
                   +   +++L  SC++ EL  + N  +  QR + HY+ + +D++ ++G F NW+ 
Sbjct: 536  KVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKI 595

Query: 578  RDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVI 637
            +D  G+TPL  I RTYD   Y+ M+  A+  A+ W   + ++     H D+K NTLLH++
Sbjct: 596  KDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHIL 655

Query: 638  KSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTC 697
            K ++ V+L    +N+N+ N K +TP+M Y +YNR+ NI+ I+RD+RLI+ K Q  ++L C
Sbjct: 656  KCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDC 715

Query: 698  FDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQR-S 756
            +D++KN ++  +LG  +          A++++ E   WVL+ T   +  N  + + +  S
Sbjct: 716  YDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDT--NQDSYITKSVS 773

Query: 757  LKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIIS-INRLETKHFLRRASVVLSLI 815
            LK + + +  ++K   + FIP            K    + I +L+ + FL   S     +
Sbjct: 774  LKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNYFGTL 833

Query: 816  CRQEEFE-HIFNNPSG--SLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILA 872
               ++F+  +F NP      + A +   ++E  + Y  +  +++  I+  ++FN  E+  
Sbjct: 834  IETDDFDTELFKNPESLTKWIKAGKRKHKKE--NYYKRMTLDDINMIKSFVQFNINELGK 891

Query: 873  IKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTK--IIGRSTNVFGSLKHSLPQCE 930
            +     +LKKL  F  LK  D+  S+ +F++ G    +  I  +   + G +K    Q  
Sbjct: 892  LNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIKPKYFQSI 951

Query: 931  FGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPD-DVRPRV 989
            F  L +  + LE+ +  +    + ++ +DIP W   +  L +L+ +Y ++F D D R  +
Sbjct: 952  FLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFSDFDSRNGL 1011

Query: 990  AENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAE 1049
             EN   +S Y + KR   E+ +   I  ++    + +  +  ++E+LA E N F+ FK+ 
Sbjct: 1012 NENI--LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSR 1069

Query: 1050 FWVSATIKEHAAMNIKWLQEQLVCLE 1075
            F+    +       I  L++Q++ +E
Sbjct: 1070 FFKDVILNMIIPSAIATLKDQVLNIE 1095

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  452 bits (1163), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 333/1121 (29%), Positives = 550/1121 (49%), Gaps = 79/1121 (7%)

Query: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60
            M Y++PVL NPLINAVFNCP P  SP +K++  +  + F L+ P   ILL Y+D  S  S
Sbjct: 1    MAYFMPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNIS 60

Query: 61   LQDLCYSASFVSDHILLLGGGGCSHE---------EEY-KTLSGKTITLRNQQKALFTGE 110
             ++LCY+  FV+ HIL+L     + +         + Y K+L+GK + LR  Q      +
Sbjct: 61   FRELCYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLR--QSLCIPIK 118

Query: 111  GFDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPL-TGRLARRDEWPGFKAYRFXXX 169
            G+ ++R+ Q+ +  LL+NFN+Y  GS  + I+H+D+PL        DE  GF+  R    
Sbjct: 119  GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPF 178

Query: 170  XXXXXXX--XXXXXXEPKAS---LEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLA 224
                           E KA      Q+ +    +  +L   ++  +A          N+ 
Sbjct: 179  HSQDKDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEP-----LQNIG 233

Query: 225  AH-FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQS 283
            +  F          ++E+Q F+ F NL    +EY+E  LY D W +L    +D  +    
Sbjct: 234  SELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKIL---- 289

Query: 284  DFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVI 343
            DF ++  +S+  + +  Y    + F +  +  +E  + +AV   + +   NS+S K  VI
Sbjct: 290  DFRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVI 349

Query: 344  VETLQTVS---RSLEINDKVIS----VDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAK 396
             +TL  ++       I D  +     +DADTLVSL  +++C+A V+D+  H+ YLQ F K
Sbjct: 350  FKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYK 409

Query: 397  DSNSITFGILAYGMSTLEAVLSYF-------ESR---EKLKLLEKHCSSNASYWEALADG 446
            D N++ FG L Y +ST+EA LSYF       ESR   +KL LLE       S  + L   
Sbjct: 410  DENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL--- 466

Query: 447  KLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDET 506
             +P+     ++ KD  R RT  G S LS+ + N++          FE  FPL+DLL D  
Sbjct: 467  -IPI-----NQFKDYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTD 520

Query: 507  VEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLI 566
            V GS LLI+ L       +   IE+   SCT +EL ++ N  ++ +R+  HY+   ++++
Sbjct: 521  VSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEIL 580

Query: 567  VKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQ 626
             K+GK+INW  +D  G T LF I R+YD T Y + +  A   A LW       F++S H 
Sbjct: 581  EKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHT 640

Query: 627  DNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLII 686
            D  G++LLH++KS VS++L    +++N  N KG+TP+M Y +YNR+DNIK+IL D RLII
Sbjct: 641  DLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLII 700

Query: 687  QKCQNGSYLTCFDYIKNPVVL----GELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLV 742
            +K Q   YL C DY KN  V      +L K   F   +Y   A   ++E   W L +++ 
Sbjct: 701  KKLQKDKYLNCLDYGKNFTVFNLLAAKLSKDVIF-ENAYISYA---RYEKSHWYLCISVQ 756

Query: 743  GSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXK-MKIISINRLET 801
                     +I+  LK   + + +  K     FIP            +   I+ I RL+ 
Sbjct: 757  KDDLEYTTNIIK--LKKYYNLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKI 814

Query: 802  KHFLRRASVVLSLICRQEEFEHIFNNPSGSLVN-AAEHVQEQEA----NSTYGMIEPEEV 856
            K++L   S  LS +   E+ + +       ++   +  +Q+QE     +S++  +  E++
Sbjct: 815  KNYLNFLSHGLSALLYFEKIDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDI 874

Query: 857  ASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRST 916
             +I+    F+  EI    +      KL+IFG +K  DL  S+ + +  G+ F+      +
Sbjct: 875  NNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSN--NEIS 932

Query: 917  NVFGSLKHSLPQCE----FGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVS 972
               G L+   P       +  L+ +   ++  + +L  K+   +   +  W K   +L+ 
Sbjct: 933  RTLGDLQSISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLE 992

Query: 973  LRHEYNKNF--PDDVRPRVAENTG-FISSYIETKRVRLEQGLVGRINRSSKNLLRFSLML 1029
             R EY+  F   ++    ++ENT  F  ++  T R   E+ L   +    ++L +    +
Sbjct: 993  HRKEYSIKFLQSNEETGNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEI 1052

Query: 1030 RRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQ 1070
            R  +E LA E ++++  K++F  +  +++  ++N+  L+EQ
Sbjct: 1053 RVKHEELAEEFSDYVRMKSKFNSNLLVRKFVSLNLAHLKEQ 1093

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  452 bits (1164), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 331/1109 (29%), Positives = 548/1109 (49%), Gaps = 82/1109 (7%)

Query: 15   AVFNCPTPQNSPLRKVFTRI-EKQRFALVTPTPEILLEYEDLESGSSLQDLCYSASFVSD 73
            A+ NC  P +SPL+K++T++ +K ++ ++ P  E+LL Y D ES S L DLCY+ +F S 
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HILLLGGGGC------------SHEEEYKT-------LSGKTITLRNQQKALFTGEGFDA 114
            HILLL                 + E+ Y          S K I  +N+    F   G   
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 115  RRRCQVLETELLSNFNEYFQGS-STYPIIHVD-FPLTGRLA---RRD----EWPGFKAYR 165
            + R ++L+ E +  FN Y + + +T  I+++D   L G L    R D      P  ++  
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 166  FXXX-XXXXXXXXXXXXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLA 224
                              + KA+ + +LR +  +  K     +  R        N D+L 
Sbjct: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLA-----NQDDLP 253

Query: 225  AH-FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQS 283
               F    E+    +  D  F+   +LR  I+EYVE+NL+DD W  +    K+ EI    
Sbjct: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEI---- 309

Query: 284  DFSILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVI 343
            D +   NISI QV S    T+  KF +  V   E+N++EA + L+++   +++ SKA ++
Sbjct: 310  DLNPFGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANIL 369

Query: 344  VETLQTVSRSLEINDKV-------------ISVDADTLVSLLVVVVCQAEVKDLKSHLFY 390
            + TL+T++ + E ND               +++DAD L++L V+V C+A++K+LK HL Y
Sbjct: 370  ILTLRTLTGNKE-NDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSY 428

Query: 391  LQEFAKDSNSITFGILAYGMSTLEAVLSYFES---REKLKLLEKHCSSNASYWEALADGK 447
            LQ F  + +   FGIL Y +STLEAV+ YFE    +E  + L   C+SN    + L+  K
Sbjct: 429  LQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTK 488

Query: 448  -----LPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLL 502
                   L  L   E    LR R   G S L++C+ + + +   H+  ++E  FP+EDLL
Sbjct: 489  KYETNAALYFLRKYEGS--LRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546

Query: 503  NDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHA 562
             DE+++GS LLIQ + +     +   + +L  +CT+ EL +++N  +  +R++GH+L + 
Sbjct: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606

Query: 563  LDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRL 622
            L+++  +GK+INW Q+D  G TPLF I R+YD  +YD MV ++ + A  W  L GK F  
Sbjct: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666

Query: 623  SKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDK 682
              H D KGNTLLH++K N+ ++L D  +NVN+ N+ G TP+M   RY R +NI+ +L D 
Sbjct: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726

Query: 683  RLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLV 742
            RL +   Q  + LT FD+ K+  +   LG+H         + AH +K+    W L +T+ 
Sbjct: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTV- 785

Query: 743  GSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETK 802
              + +AP K    +LK ++  L    K N   F+P            +++   + R++  
Sbjct: 786  -KLKDAP-KTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVL 843

Query: 803  HFLRRASVVLSLICRQEEFE-HIFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQK 861
              L   S  LS +   +  + ++F     ++     +    +  +    I PE+++ IQ 
Sbjct: 844  EMLPFISFCLSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQN 903

Query: 862  IMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGS 921
             +KFN TEI   K+   + +KL++F  LK KDL        S+ N  T +   S+  F S
Sbjct: 904  FLKFNITEIERTKNKLEIAEKLSLFSRLKSKDL------LNSNENYVTIVSQLSSKRFRS 957

Query: 922  -LKHSLPQCEFGYLANNTAL------LELSSRLLVQKIDKILNHDIPHWWKTYGELVSLR 974
             LK+S    +   +    AL      L++ ++ L   I  I    I +WW  YGEL++  
Sbjct: 958  TLKYSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAH 1017

Query: 975  HEYNKNFPDDVRPRVAENTGFISSYIET-KRVRLEQGLVGRINRSSKNLLRFSLMLRRSN 1033
              Y + FP+            +   I   KR++LE+ L  +I   ++ L      +++ +
Sbjct: 1018 KHYTRAFPELANVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMH 1077

Query: 1034 ESLAVELNNFINFKAEFWVSATIKEHAAM 1062
            E  A E++ FI+ K +F +   ++ +  +
Sbjct: 1078 ELAAEEVSRFIDLKTKFTLEYALQSYLTI 1106

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  427 bits (1099), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 322/1153 (27%), Positives = 557/1153 (48%), Gaps = 126/1153 (10%)

Query: 15   AVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQDLCY-SASFVSD 73
            ++FNCP P NSPL+K++  ++ + F L+ P  E LL Y D ++   L+DLCY +  F+  
Sbjct: 16   SIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFIGA 75

Query: 74   HILL--------------LGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQ 119
            HILL               G    +  E++ TL+G  I ++ +   L    G   R++ +
Sbjct: 76   HILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLVLLSGSPNRQKIK 135

Query: 120  VLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLAR-RDEWPGFKAYRFXXXXXXXXXXXX 178
            +   ++L NFN+Y QGS+ + ++H+D PL   + R  DE   F                 
Sbjct: 136  IERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTLHDNDGDSSPDAR 195

Query: 179  XXXXE----PKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKA 234
                +     ++  E ++  + ++  +    +   + + ++   N       F Q    A
Sbjct: 196  PLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNE----TLFKQIVAVA 251

Query: 235  LAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISIS 294
               ++ ++ F+ F +LR  IHEY+E+NLYD  W Q+T       +++++  + ++NISI 
Sbjct: 252  YNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTL---CALDDETKGTRIKNISIE 308

Query: 295  QVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSL 354
            ++    Y    + F +  +T++EKN+  +   + +L   NS + K++ ++ TLQ ++   
Sbjct: 309  EIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMD 364

Query: 355  -------EINDKVIS--VDADTLVSLLVVVVCQAEVK--DLKSHLFYLQEFAKDSNSITF 403
                   + N+K  +  +DADTL++LL++++C++E+   DLK ++FYL++F  D N I F
Sbjct: 365  NPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINF 424

Query: 404  GILAYGMSTLEAVLSYFES---REKLKLLEKHCSSNASYWEALADGKLPLGSLN--PSEV 458
            GIL+Y +ST E V+  FE+    +KLK          SY E + +  + +  L   P  +
Sbjct: 425  GILSYTISTFEIVIYSFENIVEYDKLK----------SYSEII-EKLIKVDDLKKVPKTI 473

Query: 459  K--DILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQM 516
            K    L  R+  G S L  C+ N Q   FL L   +E  F ++++L+D  VEG+ LL+Q 
Sbjct: 474  KWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQA 533

Query: 517  LDNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWE 576
            L      +S   I +L R+C+  ++  ++N ++++ R+ GHYL++ L+++  +GK++NW+
Sbjct: 534  LIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWK 593

Query: 577  QRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHV 636
            QRD  G TPLF I R YD  +YD ++   +     W    G +F++S H D K N++LH+
Sbjct: 594  QRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHI 653

Query: 637  IKSNVSVVL-----DDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQN 691
            ++SN+ ++      +   +++N  N KG TP+M+Y +Y+RL N+K IL D RL+  + Q 
Sbjct: 654  LRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQR 713

Query: 692  GSYLTCFDYIKNPVVLGELGKHAFFLPQSY-QIRAHNIKFEGDEWVLWMTLVGSVPNAPA 750
              Y TCFDY  +  +  ELGKHA      + +I  H++K        + +L   +P+   
Sbjct: 714  ELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF-SLTFPLPDKEN 772

Query: 751  K--VIQRSLKFIQSFLISFSKTNSMTFIP-----XXXXXXXXXXXXKMKIISINRLETKH 803
            +   +   +K I S L    K + ++ +P                 K+ +  I  L  + 
Sbjct: 773  ETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQS 832

Query: 804  FLRRASVV-------------LSLICRQEEFEHIFNNPSGSLVNAAEHVQEQEANSTYG- 849
             LRR +               LSLI  + +      N +  L        +   N T+G 
Sbjct: 833  LLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKL--------KHNVNKTHGE 884

Query: 850  --MIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMF----QS 903
               ++PE++  IQ  +KFN  E+  +      L+KL  F  LK  D++ S   F    +S
Sbjct: 885  KKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKS 944

Query: 904  HGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTAL------LELSSRLLVQKIDKILN 957
              N+    I ++TN        +   E  Y  NNT +      L+  + +L   I+ IL 
Sbjct: 945  IKND---QIAQATNRSLEPIIEMQSLENQY-YNNTLIRDELDFLKACTLILTGNIEDILR 1000

Query: 958  HDIPHWWKTYGELVSLRHEYNKNFPDDVRPRV--------------AENTGFISSYIETK 1003
              IP+WWK YGEL+ L   YNK FP +                     N G     IE +
Sbjct: 1001 TQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQ 1060

Query: 1004 RVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMN 1063
            R +  + L   I++   +L      + R +E LA ELN ++ FK  F+  A I+     +
Sbjct: 1061 RNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRNWRRGD 1120

Query: 1064 IKWLQEQLVCLEE 1076
            ++ + + L+   E
Sbjct: 1121 LEAVNDDLITFTE 1133

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  414 bits (1065), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 258/746 (34%), Positives = 405/746 (54%), Gaps = 40/746 (5%)

Query: 351  SRSLEINDKV--ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAY 408
            S  LE+ D +  +++DADTL+SL V+VVC++E K LKSHL+YLQ F+ +S+S  FGIL Y
Sbjct: 3    SHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGY 62

Query: 409  GMSTLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSLNPS-EV------KDI 461
             +STLEAV+ YFE   K        ++     + L D    L   NP+ EV      KDI
Sbjct: 63   AVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLD---KLSCENPTNEVEDLATYKDI 119

Query: 462  LRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGC 521
            L  R   G S LSIC+ N +  + L + +++E+ FP+EDLL DET++GS LLI+ +  G 
Sbjct: 120  LTYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGN 179

Query: 522  SSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCN 581
               +   I+++  +CT+ EL S++N  ++Y R+  HYL H +D++  +G +I+W++++ +
Sbjct: 180  LEAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSS 239

Query: 582  GHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNV 641
            G TPLF+I R+YD  +Y+ MV  A+  A  W       F    H DNKGN+LLHV+K+N+
Sbjct: 240  GQTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNI 299

Query: 642  SVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYI 701
             ++L    +++N  N KGLTP+MVY +Y RL NI +I +D+RLI++K QN ++ TCFDY 
Sbjct: 300  PILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYA 359

Query: 702  KNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNA--PAKVIQ 754
            K+  VL ++G+       F L   + +R HN+           T + SV NA  P     
Sbjct: 360  KDHSVLSKIGERGVKDSLFGLIYFHSLRYHNLN--------ATTNITSVSNAEKPFATTV 411

Query: 755  RSLKFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMKIISINRLETKHFLRRASVVLSL 814
             ++K IQ  L S  K N  TF+P            +  +  I + +    L + +   ++
Sbjct: 412  INMKTIQGLLRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNV 471

Query: 815  ICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTE 869
            +   ++  E++F + +  L    +N ++  Q+         +EPEE+  IQ  ++FN  E
Sbjct: 472  LLFLKKIPENLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDE 531

Query: 870  ILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSL--KHSL- 926
            I + K+   +L+K+ IF  LK  D E ++      G     I   +++ F  +   H++ 
Sbjct: 532  ISSFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKL--INSEASSAFKGIITNHNMF 589

Query: 927  PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVR 986
             +     L  N   LE  +  L   +  IL   IP+WWK YGE ++L   Y K FP+ V+
Sbjct: 590  SELSLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVK 649

Query: 987  PRVAENTGF---ISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNF 1043
            P+ A +T     +  +IETKR + EQ L  +I  SSK L      +  ++E LA EL+N+
Sbjct: 650  PKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNY 709

Query: 1044 INFKAEFWVSATIKEHAAMNIKWLQE 1069
            + F+       ++   A  NI  LQE
Sbjct: 710  MEFRKACLDQRSLVAFATTNISVLQE 735

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
           YML002W
          Length = 1131

 Score =  408 bits (1049), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 249/726 (34%), Positives = 396/726 (54%), Gaps = 44/726 (6%)

Query: 5   LPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQDL 64
           +P LLNPL++AVFNC   + SPLRKV++ +    F L+ P    L  Y+D  +   L +L
Sbjct: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 65  CYSASFVSDHILLLGGGG-------------CSHEEEYKTLSGKTITLRNQQKALFTGEG 111
           C+S  FVS HIL    G                 E ++ T +GK I     +++L+T +G
Sbjct: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 112 FDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPL--TGRLARRDEWPGFKAYRFXXX 169
           F  R   ++L+ E L +F  Y QGSST+ +I++D PL  T RL + ++   F        
Sbjct: 121 FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180

Query: 170 XXXXXXXXXXXXXEPKAS---LEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAH 226
                         P      L  M+  H  Y  K  A+ +  R  ++ S      L   
Sbjct: 181 PSTRSLANLSSAEVPPQRNPLLNSMI--HAQYNWKFRAVFQNYRKEITQS---ESMLIPG 235

Query: 227 FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTN-SLKDSEIENQSDF 285
           F +T +K    +  D SF   P +R  I EYVE N+YDD W  L N +  + E E QS+ 
Sbjct: 236 FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSES 293

Query: 286 S-ILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIV 344
           S I R IS+ Q+ +  Y     KF ++ + Q+EKN+ +A +    L VT+++  K +V+V
Sbjct: 294 SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353

Query: 345 ETLQTVSRSLE-INDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITF 403
           ETLQ +S+ ++ +    + + ADTLVSL ++++ + ++K+++ HL+YLQ F +D NSI F
Sbjct: 354 ETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413

Query: 404 GILAYGMSTLEAVLSYFES----REKLKLLEKHCSSNASYWEALADGK-LPLGSLNPSEV 458
           G+L Y +STLEAV+ Y E+    +E+L  +EK+ ++   +   L   K +    L+ S+ 
Sbjct: 414 GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473

Query: 459 KDILRTRTPAGLSCLSICLQNRQPNLFLHLATK-FEHCFPLEDLLNDETVEGSNLLIQML 517
               R R   G S LS+C+ N + ++F  L ++ +E  F  EDLL D+T EG+ LL+Q L
Sbjct: 474 SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533

Query: 518 DNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQ 577
            +    ++    +++ ++ T+ EL  +    ++Y+R+ GHY+     L+ K+GK+I W+ 
Sbjct: 534 QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDS 593

Query: 578 RDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLW-CTLKGKQFRLSKHQDNKGNTLLHV 636
           +DC G TPL  I R+YD   YD MV  ++  A  W  T+K  +F    H D+KGNTLLH+
Sbjct: 594 KDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHI 653

Query: 637 IKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLT 696
           IK N+S +L  P V++N  N +GL+P+   A Y+R +N++++L+D RLI          +
Sbjct: 654 IKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI---------FS 704

Query: 697 CFDYIK 702
            FD++K
Sbjct: 705 SFDFLK 710

 Score = 85.1 bits (209), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 119/251 (47%), Gaps = 24/251 (9%)

Query: 851  IEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFT- 909
            ++PE + +I   +K+    +L +K   + L+K +I   LK KD+  S  +  + G   + 
Sbjct: 873  MQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSS 932

Query: 910  KIIGRSTNVFGSLKHS-LPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYG 968
            K IGR+   + ++ +  L +  F  L       E     ++  ID +L+  IP WWK YG
Sbjct: 933  KKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYG 992

Query: 969  ELVSLR------------HEYNKNFPDDVRPRVAENT---GFISSYIETKRVRLEQGLVG 1013
            +L+ L             H+   N  ++V     ++T   G + ++IE KR++ ++    
Sbjct: 993  QLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRA 1052

Query: 1014 RINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVC 1073
             I+   + L      +  +N  + +E   FINF+++F        H+AM  KW++  +  
Sbjct: 1053 AISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFI-------HSAMLEKWVKLNINL 1105

Query: 1074 LEEALYDYKDK 1084
            L+++L D K+K
Sbjct: 1106 LKKSLLDSKEK 1116

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  386 bits (992), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 317/1195 (26%), Positives = 562/1195 (47%), Gaps = 166/1195 (13%)

Query: 15   AVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQDLCY-SASFVSD 73
            AVFNCP P +SP +K+FT ++ Q+F L+ P    LL Y D     SL +LCY ++ F+  
Sbjct: 16   AVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLGS 75

Query: 74   HILLLGGGGCSH--------EEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQVLETEL 125
            HIL       S+        +EE+  L+G    ++ +   +FT   F   +R ++L+   
Sbjct: 76   HILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFSNDQRFKILKIHP 135

Query: 126  LSNFNEYFQGSSTYPIIHVDFPLT-GRLARRDEWPGF-KAYRFXXXXXXXXXXXXXXXXE 183
            L+NFN+YF GS  + +I +D P+T   L   D         R                 +
Sbjct: 136  LTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQEKETPLVQDLSQQ 195

Query: 184  PKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQE--- 240
             K+S E  L  + ++  K    I +    + SS    ++    F +   +A   I     
Sbjct: 196  SKSSFENDLNKNEAWNLKFG--ILSNNYKIESSELEPNH--KLFRELVNEAFIEIDSKKF 251

Query: 241  ---------DQSFRAFPNLRLQIHEYVEMNLYDDFWAQ----LTNSLKDSEIENQSDFSI 287
                     DQ F+         H+Y+E +LYD+ W++    + NS+K+   ++Q    +
Sbjct: 252  FQKKKNFTSDQLFQL-------THDYMERHLYDEIWSRIWKMMMNSVKNYA-DDQKAQHL 303

Query: 288  LRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETL 347
            +++ SI ++    Y      F ++ V  +EKNL+ +V C+ +L  T S++ K+ +++E+L
Sbjct: 304  IKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESL 359

Query: 348  QTVSRS----LEINDKVIS---VDADTLVSLLVVVVCQAEVK--DLKSHLFYLQEFAKDS 398
            Q ++ S     E  DK  S   +DAD L++LL +V+ Q+ +   DLK++L+YL+ F+ D 
Sbjct: 360  QIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFSTDE 419

Query: 399  NSITFGILAYGMST-------LEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLG 451
            +S +FGIL Y ++T       LE V+ +   +EK  L+E+           + D    L 
Sbjct: 420  SSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELI---------MTDDLSTLS 470

Query: 452  SLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSN 511
            S   ++ K +L  R   G S L++ + N+Q   F     ++E    ++ + ND++++ S 
Sbjct: 471  STFENDKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSST 530

Query: 512  LLIQMLDNGCSSLSGNFIEMLFRSC-TKTELESFLNHVNRYQRSSGHYLMHALDLIVKVG 570
            LL+Q + +     +   +++LF++C  + EL S++N V+ + R+ GHYL+  L ++  +G
Sbjct: 531  LLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIG 590

Query: 571  KFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKG 630
            +FINW+Q+D NG TPLF I R+YD ++YD +V + ++ A  W      +F+++ H D+ G
Sbjct: 591  QFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNG 650

Query: 631  NTLLHVIKSNVSVVLD-----DPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLI 685
            N+LLH++++N+S++LD     +  +N+N  N KG TP+M+Y +Y R DNI+ I+++++LI
Sbjct: 651  NSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLI 710

Query: 686  IQKCQNGSYLTCFDYIKNPVVLGELGKHAFFLPQSYQIRAHNIKFEGDEWVLWMTLVGSV 745
              K Q+ +++ CFDY  +  ++ ++G+   FL  + Q+    I     +    M+ V S+
Sbjct: 711  FNKFQSPNFIDCFDYSVDSSIMNDIGE---FLLSNGQLFGKIIVLSLKK---QMSTVPSL 764

Query: 746  P------------NAPAKVIQRSLKF--IQSFLISFSKTNSMTFIPXXXXXXXXXXXXKM 791
            P             A    + +++KF  +  FL    +  +++F+P              
Sbjct: 765  PRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDK 824

Query: 792  KIISINRLET-----------KHFLRRASVVLSLICRQEE-------------------F 821
            K  + N L T           + FL+R +  L ++   ++                    
Sbjct: 825  KSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISI 884

Query: 822  EHIFNNPSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLK 881
            E      S +  +A   ++          ++PE +  IQ  +KFN  E+  I     +L 
Sbjct: 885  EESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLS 944

Query: 882  KLAIFGILKGKDLERSHTMFQS-----HGNNFTKIIGRSTNVFGSLKHSLPQ-CEFGYLA 935
            KL IF  LK  D+  +   F       +      II +S NV  S ++   +      L 
Sbjct: 945  KLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLH 1004

Query: 936  NNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPD-DVRPRVAE--- 991
             + +     +  L+  ++ I+   IP+WWK YGEL+ L   Y+KNFP+  V  R  +   
Sbjct: 1005 EDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLS 1064

Query: 992  --------------------------------NTGFISSYIETKRVRLEQGLVGRINRSS 1019
                                            N G  ++ IE ++ +LE+     I+ + 
Sbjct: 1065 GNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETI 1124

Query: 1020 KNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCL 1074
              L      L   +E LA ELN ++ FK  F+    +K     +IK L+E ++ L
Sbjct: 1125 SLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHVLVL 1179

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  346 bits (888), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 326/1220 (26%), Positives = 548/1220 (44%), Gaps = 182/1220 (14%)

Query: 8    LLNPLINAVFNCPTPQ--NSPLRKVFTRIEKQRFALVTPTPEILLEYEDLES-------- 57
            +LNPLI  +F+       N PL+K+F +++  +F L+ P  +ILL Y D  +        
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 58   GSS---LQDLCY-SASFVSDHILLLGGGGCSHEE-EYKTLSGKTITLR--NQQKALFTGE 110
            GS+   L+DLC  S  F++ HILL       +++   ++++GKTIT++      AL  GE
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124

Query: 111  GF---------DARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGF 161
                         ++  ++++ +L  NFN Y QG   YPI ++D+PL   + + +    F
Sbjct: 125  MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184

Query: 162  KAYRFXXXXXXXXXXXXXXXXEPKASLEQM-------------LRAHPSYGDK--LSAII 206
                                 +P   LE               L    S  D+   + +I
Sbjct: 185  DR-------KLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLI 237

Query: 207  RTQRAALSSSTYNADNLAAHFMQTCEKALAAIQEDQS----------------------- 243
            +  R  +     N+       ++  E    AI E+Q+                       
Sbjct: 238  KDDRV-IWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKR 296

Query: 244  --FRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFLY 301
              F +  NL   I+E++E+ L+DD W +++    +S+     DFS L NIS++++    Y
Sbjct: 297  YNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDF----DFSKLSNISVNKLLLNFY 352

Query: 302  PTDRQK-FDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
             T+  K F +  +  +EK +  AV   ++     +   K+  +++TLQ     L IN   
Sbjct: 353  STNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQI----LTINK-- 406

Query: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420
               DADTL+ LL +V+C+ +V++LKSHLFYLQ FA D N+I FGIL Y +STLEA+  YF
Sbjct: 407  -LTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYF 465

Query: 421  E--SREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQ 478
            +  S      L   C    + ++ + +    + SL+     DIL  R+  G S LS+C+ 
Sbjct: 466  DHISHSHKADLIAFCDKLHNLYDTILNN---IKSLD----NDILSYRSQNGESLLSLCII 518

Query: 479  NRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTK 538
            N + ++FL L T +EH FP+ED+L+D  + GS+LL+Q         S   + +L  SC +
Sbjct: 519  NNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNE 578

Query: 539  TELESFLNHVNRYQRSSGHY--LMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHT 596
             EL  FLN  +++ RS  HY  + +++ ++ + G  I+WE +D    TPL  I + +   
Sbjct: 579  EELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVN 638

Query: 597  DYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDP----LVNV 652
              ++ +   ++    W  +  K F L  H D  GN LLHV+K  ++ ++++P     +N+
Sbjct: 639  YNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETINI 698

Query: 653  NSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGK 712
            N+ N KGL+P MVY + NR DNI+ IL++  LI  + Q   +L     + N  V   L  
Sbjct: 699  NANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQ-LPFLITSTNLYNSKVNHLLAT 757

Query: 713  HAFFLPQSYQIRAHNIKFEGDE---------WVLWMTLVGSVPNAPA------KVIQRSL 757
            H         I  H+++F             W++ ++++      P       +     L
Sbjct: 758  HFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKL 817

Query: 758  KFIQSFLISFSKTNSMTFIPXXXXXXXXXXXXKMK--------------IISINRLETKH 803
            K I+S L  F +    + +P            K                 + I++LE ++
Sbjct: 818  KTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQY 877

Query: 804  FLRRASVVLSLICRQEEFEHIF--------------------NNPSGSLVNAAEHVQEQE 843
             L+  S  L+ +    +F+                       +N S    +     Q  E
Sbjct: 878  NLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTE 937

Query: 844  ANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQS 903
             +  Y   +PE++ +IQ  +KFN  E+   K+    +K ++I    K  DL  S   FQ 
Sbjct: 938  LSKAY---QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQK 994

Query: 904  HG-----NNFTKIIGRS-------TNVFGSLK----HSLP-QCEF-GYLANNTALLELSS 945
            +      NN ++I+          TN + S K    +S   + EF   L  N    E   
Sbjct: 995  NTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLV 1054

Query: 946  RLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFIS-SYIETKR 1004
              L    + + N  I  WW  YG L+    +YNK++P+    ++  N  F S + +  KR
Sbjct: 1055 CKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN---RKIDINNNFESFNTMFDKR 1111

Query: 1005 V------RLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKE 1058
            V        E+ ++  I  +S  L RF+  ++  +E+LA+ELNNF+NFK +F     IK 
Sbjct: 1112 VNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKF 1171

Query: 1059 HAAMNIKWLQEQLVCLEEAL 1078
                 IK L++ ++ ++  +
Sbjct: 1172 STIEVIKILKDNIIYMDSII 1191

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  191 bits (485), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 155/285 (54%), Gaps = 9/285 (3%)

Query: 3   YYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQ 62
           Y+LP LLNPL+NA+FNCP P+ SPL+K+F  ++ +RF L+ P  E LL Y D++S   L 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  DLCYSASFVSDHILLLGGGGC----SHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRC 118
           DLCY+A F++ +ILL+         S +  Y+TL GKT+ ++ +   +    GF  RRR 
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIRRRL 123

Query: 119 QVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAY-RFXXXXXXXXXXX 177
           ++LET++L NFN+YF+G++ + I+ +D PL       D    F  Y +            
Sbjct: 124 KILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMPNLS 183

Query: 178 XXXXXEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAA 237
                + ++S E +L  HP+   +L  +  + R          D   + F    ++A   
Sbjct: 184 IDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGD----DPSRSIFESIVQQAFDG 239

Query: 238 IQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQ 282
           ++ D  F+ F NL   IH+Y E+NLYDD W++LT   K  E++ +
Sbjct: 240 MKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTE 284

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  187 bits (476), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 203/786 (25%), Positives = 362/786 (46%), Gaps = 112/786 (14%)

Query: 301  YPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKV 360
            Y     KF +R V  +E  +  A +   +L  + S   K  +++ T   ++  L      
Sbjct: 219  YSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLP----Q 274

Query: 361  ISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYF 420
            + +DAD L++ +++++ + ++ +L  H  YLQ F    N   FGIL Y +STL AVL Y 
Sbjct: 275  LEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYI 333

Query: 421  ESR-EKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQN 479
            ++  +K K           Y +A+ D K+       SE K  L+ R   G S L  C+  
Sbjct: 334  DNNLDKFK----------RYTDAIQDSKI-------SEEK--LKYRNENGESYLCHCIIT 374

Query: 480  RQPNLF--LHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCT 537
            +  +    L  ++++   FP+ED+L+D+T++GS LL+  +    ++ +   I ++  + T
Sbjct: 375  KDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGT 434

Query: 538  KTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDC-NGHTPLFAIIRTYDHT 596
              E+ +++N V+   R+ GH++ +   L+ K+G ++NW  +D   G TPLF I R+YD +
Sbjct: 435  PDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQS 494

Query: 597  --DYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNS 654
               Y  M   +++ A     +    F+L KH DN  NTLLH++K+N+ ++L    + +NS
Sbjct: 495  IKSYKKMSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINS 549

Query: 655  FNKKGLTPIMVYARYNRLDNIKSILRDK---RLIIQKCQ--NGSYLTCFDYIKNPVVLGE 709
             N  G+TP+MV+ +Y RL NI+ +L  K   R+ I + Q  + ++  CF    +  +L  
Sbjct: 550  PNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNL 609

Query: 710  LGKHAFFLPQSYQIRA----HNIK--------FEGDEWVLWMTLVGSVPNAPAKVIQRSL 757
            LGK A    ++Y I      H++K           +++ + +TL         K I+ ++
Sbjct: 610  LGKFAI---KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFE---KKYKTIRFNI 663

Query: 758  KFIQSF--LISFSKTNSMTFIPXXXXXXXXXXXXKM-----KIISINRLETKHFLRRASV 810
            K I++   ++  S ++  +F+P             M     KI+ IN L     +    +
Sbjct: 664  KTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMISTKSKILFINNLNV---ILDTIL 720

Query: 811  VLSLICRQEEFEHIFNNPSGSLVNA--AEHVQEQEANSTYGM----IEPEEVASIQKIMK 864
             L L+ R+           G ++ A   ++++ Q    T       ++ E++  I   +K
Sbjct: 721  FLELVPRE-----------GFILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLK 769

Query: 865  FNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVFGSLKH 924
            FN  E+ A K+G   + +      LK  D +R   M   H            +V   L +
Sbjct: 770  FNLNELNAFKNGVKKILRQMNSINLKLFD-QRISYMDLLH----------CPDVVVHLNN 818

Query: 925  SLPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDD 984
             L    +  L +N  +LE S    +  +    N  I  WWK   EL++L  +   N  DD
Sbjct: 819  PLWNLNYNILISNFQILENSIDNTLHFLKVFQNEKIRKWWKLNNELINLT-KLASNSDDD 877

Query: 985  VRPRVAENTGFISSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFI 1044
            +          + S+   K     + L   I+   +++   +  +  S+E LAVE+NNF+
Sbjct: 878  L----------LRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFM 922

Query: 1045 NFKAEF 1050
             FK  F
Sbjct: 923  KFKPLF 928

>KAFR0B06400 Chr2 complement(1324711..1326300) [1590 bp, 529 aa] {ON}
            Anc_5.466 YOR132W
          Length = 529

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 1025 FSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQEQLVCLEEALYDYK 1082
             +L L+R+ E++ +E N++IN+  E W+  +IKE+    I++ +++L  LE   YD +
Sbjct: 385  LTLKLQRTTENMIIERNSWINW-YEKWLLNSIKEYTIRKIEYERKKLAVLERLRYDVR 441

>NCAS0A02440 Chr1 complement(460788..463250) [2463 bp, 820 aa] {ON}
           Anc_4.232
          Length = 820

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 4/41 (9%)

Query: 626 QDNKGNTLLHVIKSNVSVVLDDPLVNVNSF----NKKGLTP 662
           QDN G+T LH+   N   +  D L+N  +     NKKGLTP
Sbjct: 534 QDNNGDTALHIAARNGDKLFFDTLLNNGALNTIRNKKGLTP 574

>TBLA0G00540 Chr7 (112550..113632) [1083 bp, 360 aa] {ON} Anc_6.63
           YLR270W
          Length = 360

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 39/87 (44%), Gaps = 21/87 (24%)

Query: 881 KKLAIFGILKGKDL----ERSHTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLAN 936
           K L++ G + GKD     E++H  F  +      + GRST +F        QCE  Y   
Sbjct: 29  KVLSLLGTIDGKDAIITAEKTHFTFDENIKKPNPVDGRSTPIFY-------QCENEYSIV 81

Query: 937 NTALLELSSRLLVQKIDKILNHDIPHW 963
           N           +Q++ +I ++DI HW
Sbjct: 82  NG----------IQELKEIASNDIYHW 98

>NDAI0K02850 Chr11 (644266..645525) [1260 bp, 419 aa] {ON} Anc_6.63
           YLR270W
          Length = 419

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 59/140 (42%), Gaps = 27/140 (19%)

Query: 828 PSGSLVNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFG 887
           P+G   NA E   + EA+S+    + + + ++ +  KF R     +       K L++ G
Sbjct: 20  PTGIAANAPERKNKDEASSSVQDPQSKNLHALIQRFKFKR-----VLDSNPQTKVLSLLG 74

Query: 888 ILKGKD----LERSHTMFQSHGNNFTKIIGRSTNVFGSLKHSLPQCEFGYLANNTALLEL 943
           ++  KD    +E++H +F           GR+T +F        QCE  Y   N      
Sbjct: 75  LIDNKDAIITVEKTHFIF-GQTKKTDPESGRNTPIFY-------QCEDEYSCING----- 121

Query: 944 SSRLLVQKIDKILNHDIPHW 963
                ++ I +I  HDI +W
Sbjct: 122 -----IEDIRQISAHDIYYW 136

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 113,321,982
Number of extensions: 4923495
Number of successful extensions: 14110
Number of sequences better than 10.0: 60
Number of HSP's gapped: 14370
Number of HSP's successfully gapped: 71
Length of query: 1097
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 977
Effective length of database: 39,721,479
Effective search space: 38807884983
Effective search space used: 38807884983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)