Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11220g6.21ON32732713290.0
Kwal_56.224336.21ON3223279991e-135
SAKL0E01210g6.21ON3233268591e-114
Kpol_1037.266.21ON3423327571e-98
YOR007C (SGT2)6.21ON3463307502e-97
Skud_15.1686.21ON3483337432e-96
Smik_15.1766.21ON3453307353e-95
Ecym_30256.21ON3183237315e-95
TPHA0J003406.21ON3383347256e-94
KAFR0L004106.21ON3313317049e-91
ZYRO0C07788g6.21ON3343216987e-90
KLLA0D01155g6.21ON3353346918e-89
KNAG0M011706.21ON3393246874e-88
CAGL0E02739g6.21ON3433206832e-87
NCAS0H008306.21ON3383346719e-86
ACR005W6.21ON3273366412e-81
NDAI0D008106.21ON3493446416e-81
TDEL0G044806.21ON3432276292e-79
Suva_15.1826.21ON3462306267e-79
TBLA0G010506.21ON3503286251e-78
Kpol_1032.86.21ON3433254283e-49
NDAI0I022406.21ON3502173105e-32
NCAS0D026706.21ON3512503062e-31
TPHA0M002706.21ON3772622765e-27
TBLA0A072706.21ON3732532343e-21
Kwal_55.199355.617ON593892348e-21
CAGL0H08195g5.617ON583892331e-20
TPHA0D028805.617ON585922171e-18
NDAI0F009105.617ON583922162e-18
AEL224W5.617ON5801122153e-18
Kpol_1018.695.617ON590892126e-18
SAKL0G07084g5.617ON5851122118e-18
YOR027W (STI1)5.617ON589892101e-17
NCAS0G008105.617ON584932091e-17
Smik_15.2055.617ON589892091e-17
TDEL0A048405.617ON5761342064e-17
KLTH0E02178g5.617ON593892038e-17
TBLA0E033005.617ON582892039e-17
KLLA0A07062g5.617ON581922021e-16
Skud_15.1925.617ON5891032011e-16
ZYRO0A05676g5.617ON572892002e-16
Suva_8.805.617ON586891975e-16
Ecym_55825.617ON584891922e-15
KAFR0C058905.617ON575901851e-14
KNAG0B032005.617ON579921753e-13
NCAS0A00490singletonON620901612e-11
KLLA0F24046g2.152ON604751434e-09
KAFR0B066103.481ON5111031328e-08
NCAS0F034903.481ON512901282e-07
Ecym_44133.481ON510711273e-07
TDEL0D055003.481ON512901264e-07
KNAG0A039508.506ON386941246e-07
Kwal_33.147672.152ON5941231247e-07
Smik_6.2153.481ON513681248e-07
YGR123C (PPT1)3.481ON513681239e-07
TBLA0C039503.481ON5121091239e-07
Skud_7.4323.481ON513681212e-06
CAGL0D05060g3.481ON5101091202e-06
Ecym_82042.152ON597751202e-06
NDAI0B057903.481ON5231061203e-06
TPHA0D032203.481ON5131281193e-06
Suva_7.4083.481ON513681193e-06
NCAS0G024802.152ON596691168e-06
KLTH0B05170g2.152ON593751168e-06
NDAI0F028102.152ON609701159e-06
SAKL0F03102g3.481ON513821151e-05
ABR131W2.152ON594731151e-05
KNAG0A079003.481ON512931132e-05
AAR083C3.481ON538681122e-05
NCAS0B024008.506ON380551113e-05
CAGL0L04048g2.152ON587571104e-05
SAKL0H10934g8.506ON380871087e-05
CAGL0L12936g2.152ON6001211087e-05
NDAI0B043402.152ON664761088e-05
Smik_2.2958.506ON385551061e-04
KLTH0F14542g3.481ON5131181061e-04
SAKL0E10956g2.152ON600751051e-04
Kpol_505.413.481ON513901052e-04
Skud_2.2828.506ON385551042e-04
CAGL0H07425g8.506ON3801111032e-04
TDEL0B013108.506ON380861033e-04
NDAI0C052908.506ON379801033e-04
Suva_4.4058.506ON385551033e-04
ADR230W5.689ON685901033e-04
Skud_8.1782.152ON638781024e-04
Kwal_55.211753.481ON511941015e-04
YBR155W (CNS1)8.506ON385551005e-04
AGL268C8.506ON379931006e-04
YBR112C (CYC8)3.367ON9661241009e-04
Kwal_27.118908.506ON33470980.001
Smik_8.1952.152ON635142990.001
Smik_2.2543.367ON1020124990.001
NCAS0B070102.152ON62575960.002
Suva_15.3142.152ON644112960.002
TBLA0C055302.152ON61058960.002
TPHA0I015102.152ON60360950.003
ZYRO0G06512g2.152ON60460940.004
YHR117W (TOM71)2.152ON639112940.004
Skud_2.2403.367ON984117930.006
TBLA0H033808.506ON37571900.009
KLLA0B09966g8.506ON370125900.009
ZYRO0F08624g8.506ON37971900.009
KAFR0F007202.152ON608137910.010
ZYRO0B04224g3.481ON51382890.017
KAFR0E029808.506ON38055880.017
KLTH0F10428g3.367ON795127890.019
KLTH0E11748g8.506ON37880870.023
SAKL0A01672g6.328ON12849820.025
TDEL0B051402.152ON59960870.026
NCAS0E024907.412ON80998870.030
Ecym_25598.506ON370118860.031
Kpol_513.28.506ON37495860.031
Ecym_40315.689ON68862870.032
TPHA0L014208.506ON37497840.048
YNL121C (TOM70)2.152ON61775840.056
NDAI0J001307.546ON140382840.063
SAKL0E14542g5.689ON69053840.067
TPHA0P015903.5ON107788840.068
Skud_14.2112.152ON61775830.089
Smik_14.2072.152ON61775820.098
KNAG0H035302.152ON61460820.10
Kpol_1043.605.689ON70663820.11
KNAG0I025206.328ON11776770.11
Suva_14.2192.152ON61775820.11
TPHA0D038606.328ON12080770.12
NCAS0B025608.470ON57882820.12
KLLA0B10912g3.481ON51251800.21
TBLA0H019705.352ON84064800.21
NDAI0C051308.470ON590103800.21
Smik_4.4918.470ON61251790.22
KNAG0H006103.367ON97381800.23
Skud_4.5068.470ON61151790.24
Kpol_1028.516.328ON11772740.24
Suva_2.4108.470ON61151790.25
Ecym_20906.328ON17240760.25
Kpol_1048.212.152ON59773790.26
CAGL0K11209g8.470ON59052790.29
Suva_4.3613.367ON96381790.29
YCR060W (TAH1)6.328ON11173730.39
KLLA0C15455g8.470ON56693770.45
YDR244W (PEX5)8.470ON61290760.61
Kwal_55.218395.689ON69072760.68
Kpol_1031.648.470ON60757750.75
YKL022C (CDC16)2.665ON84065750.80
NDAI0E040407.412ON78393750.82
SAKL0C13772g3.5ON1090134750.88
NCAS0A147707.458ON300119730.95
KLTH0F18150g5.689ON68972741.0
Smik_3.1596.328ON11563691.3
KLTH0F19734g3.5ON1081128731.3
KLTH0C06204g7.412ON62788731.3
TPHA0C044707.190ON11859691.4
KAFR0J025706.328ON12193691.5
CAGL0D01364g3.367ON114855721.7
Smik_11.2322.665ON79365722.0
AGL294W7.412ON65695722.0
TBLA0I023106.328ON11648672.1
SAKL0F16236g7.546ON140891722.1
KNAG0A041208.470ON60251712.2
Ecym_71427.412ON67595712.3
TPHA0L012108.470ON58857712.4
KAFR0L018707.412ON71286712.5
Kwal_27.117378.470ON57548712.6
TDEL0B016608.470ON54952712.6
Suva_11.2042.665ON79364712.6
Suva_3.956.328ON11172662.7
Kpol_1018.1067.412ON75389712.7
Kwal_27.107407.412ON62888702.9
Skud_11.2062.665ON80264703.1
KLTH0E10934g8.470ON56848693.6
KLLA0E22705g1.456ON389102693.7
TBLA0A016908.470ON66251693.8
Ecym_28207.546ON139885703.8
TDEL0B076002.665ON75264693.9
CAGL0G10087g7.546ON1411130694.1
TPHA0E007407.412ON74690694.7
TDEL0C050903.367ON75955685.7
SAKL0D11110g1.456ON432101676.0
ZYRO0C16522g3.367ON97455686.1
AER290C8.827ON22360666.2
KLLA0D09020g3.395ON53030676.5
KAFR0D023405.689ON69754676.7
SAKL0H11946g8.470ON57351676.8
AFR453W8.470ON569132677.1
Kpol_172.23.367ON41855667.7
Kwal_34.160921.456ON395101669.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11220g
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   516   0.0  
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   389   e-135
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   335   e-114
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   296   1e-98
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   293   2e-97
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   290   2e-96
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   287   3e-95
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   286   5e-95
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   283   6e-94
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   275   9e-91
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   273   7e-90
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   270   8e-89
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   269   4e-88
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   267   2e-87
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   263   9e-86
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   251   2e-81
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   251   6e-81
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   246   2e-79
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   245   7e-79
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   245   1e-78
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   169   3e-49
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   124   5e-32
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   122   2e-31
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   110   5e-27
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    95   3e-21
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    95   8e-21
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    94   1e-20
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    88   1e-18
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     88   2e-18
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    87   3e-18
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    86   6e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    86   8e-18
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    86   1e-17
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    85   1e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    85   1e-17
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    84   4e-17
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    83   8e-17
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    83   9e-17
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    82   1e-16
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    82   1e-16
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    82   2e-16
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    80   5e-16
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    79   2e-15
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    76   1e-14
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    72   3e-13
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       67   2e-11
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    60   4e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    55   8e-08
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   2e-07
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    54   3e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    53   4e-07
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    52   6e-07
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    52   7e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    52   8e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    52   9e-07
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    52   9e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    51   2e-06
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    51   2e-06
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    51   2e-06
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    51   3e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    50   3e-06
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    50   3e-06
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    49   8e-06
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    49   8e-06
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    49   9e-06
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    49   1e-05
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    49   1e-05
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    48   2e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    48   2e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    47   3e-05
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    47   4e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    46   7e-05
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    46   7e-05
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    46   8e-05
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    45   1e-04
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    45   1e-04
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    45   1e-04
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    45   2e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   2e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   2e-04
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    44   3e-04
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    44   3e-04
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    44   3e-04
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    44   3e-04
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    44   4e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    44   5e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    43   5e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    43   6e-04
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    43   9e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    42   0.001
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    43   0.001
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    43   0.001
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    42   0.002
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    42   0.002
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    42   0.002
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    41   0.003
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    41   0.004
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    41   0.004
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    40   0.006
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    39   0.009
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    39   0.009
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    39   0.009
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    40   0.010
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    39   0.017
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    39   0.017
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    39   0.019
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    38   0.023
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    36   0.025
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    38   0.026
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    38   0.030
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    38   0.031
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    38   0.031
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    38   0.032
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    37   0.048
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    37   0.056
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    37   0.063
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    37   0.067
TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3...    37   0.068
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    37   0.089
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    36   0.098
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    36   0.10 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    36   0.11 
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    34   0.11 
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    36   0.11 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    34   0.12 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    36   0.12 
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    35   0.21 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    35   0.21 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.21 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    35   0.22 
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    35   0.23 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.24 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.24 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    35   0.25 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    34   0.25 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    35   0.26 
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    35   0.29 
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    35   0.29 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    33   0.39 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    34   0.45 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    34   0.61 
Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR08...    34   0.68 
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   0.75 
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    33   0.80 
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    33   0.82 
SAKL0C13772g Chr3 (1211712..1214984) [3273 bp, 1090 aa] {ON} sim...    33   0.88 
NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {...    33   0.95 
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    33   1.0  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    31   1.3  
KLTH0F19734g Chr6 (1599275..1602520) [3246 bp, 1081 aa] {ON} sim...    33   1.3  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   1.3  
TPHA0C04470 Chr3 complement(967705..968061) [357 bp, 118 aa] {ON...    31   1.4  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    31   1.5  
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    32   1.7  
Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {...    32   2.0  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    32   2.0  
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    30   2.1  
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    32   2.1  
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    32   2.2  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    32   2.3  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   2.4  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    32   2.5  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    32   2.6  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    32   2.6  
Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {...    32   2.6  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    30   2.7  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    32   2.7  
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    32   2.9  
Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {...    32   3.1  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    31   3.6  
KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]...    31   3.7  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    31   3.8  
Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} simila...    32   3.8  
TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON} Anc_2...    31   3.9  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    31   4.1  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    31   4.7  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    31   5.7  
SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} simila...    30   6.0  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    31   6.1  
AER290C Chr5 complement(1170367..1171038) [672 bp, 223 aa] {ON} ...    30   6.2  
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    30   6.5  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    30   6.7  
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    30   6.8  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    30   7.1  
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    30   7.7  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    30   9.0  

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/327 (83%), Positives = 273/327 (83%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           GQSLEQIVGASSKGPTATQQEPVKVNIPV                   MATKDFEHAISK
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
           RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240

Query: 241 GFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSGG 300
           GFPDIASM             K                      SNPAIKQMADKFQSGG
Sbjct: 241 GFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIKQMADKFQSGG 300

Query: 301 GTPSMADLMNNPALMDMAKNMFGGPKQ 327
           GTPSMADLMNNPALMDMAKNMFGGPKQ
Sbjct: 301 GTPSMADLMNNPALMDMAKNMFGGPKQ 327

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  389 bits (999), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/327 (61%), Positives = 238/327 (72%), Gaps = 5/327 (1%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+P+ K+LA+LI+D+L  T E KE+ EDY+DSLNVAIDC+TEAFE ++ES ++ +EK+F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G+SL+Q+V A+S G +++ QE VKVNIPV                   MA KDFE A+ K
Sbjct: 61  GRSLKQVVEAASVG-SSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLK 119

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           YSEAI+ LP+NAVY+ANRAAA+SSLKKY EAV+DAE AIKVNPSYSKGYSRLGFAQYALG
Sbjct: 120 YSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALG 179

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
           +PEEALDAYKKVLDIEG  ATDAMKRDYDTAMKKV QSLNVE+SAPAA+   +  A G  
Sbjct: 180 KPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSATGSG 239

Query: 241 GFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSGG 300
           G PDI+SM                                    +NPA+KQMA+KFQSGG
Sbjct: 240 GLPDISSM----LGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQMAEKFQSGG 295

Query: 301 GTPSMADLMNNPALMDMAKNMFGGPKQ 327
           GTPSMADLMNNPALMDMAKNMFGG KQ
Sbjct: 296 GTPSMADLMNNPALMDMAKNMFGGGKQ 322

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 173/326 (53%), Positives = 220/326 (67%), Gaps = 8/326 (2%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M  + KE+A+LI+D+L  T E   + EDY DSLNVAIDC++EAFE E+++ S +++ SF 
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
            + L++++ +++     TQ EPVKVNIP                    MA+KDFE AI K
Sbjct: 61  NRKLDELLKSAATA-LPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKK 119

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+EAI  LPSNAVY+ANRAAAYSSLKKY E+V+DAE+AIKVNPSYSKGYSRLGFA+YALG
Sbjct: 120 YTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALG 179

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAE--SPDA-A 237
           +PEEAL+AYK VLDIEG  ATD MKRDY+TA +KVEQSLN+E+S P  ++ +  S DA A
Sbjct: 180 KPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTDAGA 239

Query: 238 GGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQ 297
           G SGFPD+AS                                      NPA++QMA+ F 
Sbjct: 240 GASGFPDMAS----LLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQMAENFS 295

Query: 298 SGGGTPSMADLMNNPALMDMAKNMFG 323
           SGGGTP++ DLM+NPA+ DMAKN+FG
Sbjct: 296 SGGGTPNLGDLMSNPAIKDMAKNLFG 321

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  296 bits (757), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 208/332 (62%), Gaps = 9/332 (2%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+ + K++A+LIID+L    +  E+ ED  DSLNVA+DC+ EAFE E++S + V++ SF 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GQSLEQIVGASSKGPTATQ--QEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAI 118
           G SL   +  S+    AT    E VKVN+                     MA KD+E AI
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELAI 120

Query: 119 SKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYA 178
            KY+EAI TLP+NAVYFANRAAAYSSLKKY EAVEDA +AIK+NP+YSKGYSRLGFA++A
Sbjct: 121 KKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKFA 180

Query: 179 LGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAA-SNAESPDA- 236
            G+ E+AL+AYKKVLDIEG  AT+ MKRDY+TA KKVEQSLN+E+S  +  + AES  A 
Sbjct: 181 QGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSAS 240

Query: 237 -----AGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQ 291
                AG  G PD +SM             +                       NP++KQ
Sbjct: 241 AADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVKQ 300

Query: 292 MADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323
           MAD+F SG GTP  + LMN+P++ DMAKNMFG
Sbjct: 301 MADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  293 bits (750), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 155/330 (46%), Positives = 216/330 (65%), Gaps = 6/330 (1%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59
           M+ +K+E+A+LI++Y     E KEI ED  DSLNVA+DC++EAF  E+E+ S ++ KS F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  GGQSLEQIVGASSKGPTATQQ---EPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEH 116
            GQ L  I+ ++S+ P + ++   E V++NIP                    MA KD+E 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSLK+Y +AV+DAE+AI ++PSY +GYSRLGFA+
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P  S     DA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 237 AGGSGFPDIASMXXXXXXXXXXXXX--KXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMAD 294
           + G+    +  +               +                       +P+I+QMA+
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 295 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
            F SGGGTP+++DLMNNPAL +MA N+FGG
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGG 330

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  290 bits (743), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 215/333 (64%), Gaps = 10/333 (3%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59
           M+ +K E+ASLI++Y     E KEI ED  DSLNVA+DC++EAF  E+E+  S++E S F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEH 116
            GQ+L  ++ ++S+   +T+++    V+VNIP                    MA KD+E 
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSLK Y EAVEDAE+AI ++P+Y +GYSRLGFA+
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAP-----AASNA 231
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P     A +NA
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 232 ESPDAAGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQ 291
           ++   AG SG P                  +                       +P IKQ
Sbjct: 241 DASQGAGTSGLP-DLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQ 299

Query: 292 MADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
           MA+ F SGGG P+++DLMNNPAL  MA N+FGG
Sbjct: 300 MAEGFTSGGGAPNLSDLMNNPALRSMAGNLFGG 332

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  287 bits (735), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 216/330 (65%), Gaps = 6/330 (1%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59
           M  +K+E+A+LI++Y     E KEI ED  DSLNVA+DC++EAF  E+++AS ++ KS F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEH 116
            G+SL  ++ ++SK   + +++    V+VNIP                    MA KD+E 
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           AI+KY+EAI+ LP+NA+Y+ANRAAA+SSL++Y EAV+DAE++I ++PSY +GYSRLGFA+
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236
           YA G+PEEAL+AYKKVLDIEG NAT+AMKRDY++A KKVEQSLN+E++ P  S     +A
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 237 AGGSGFPDIASMXXXXXXXXXXXXX--KXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMAD 294
           + G+G   +  +               +                       +P+I+QMA+
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 295 KFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
            F SGGG P+++DLMNNPAL +MA N+FGG
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGG 330

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  286 bits (731), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 202/323 (62%), Gaps = 7/323 (2%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M  + KE+A+LI+ +L  +   K++ E+Y+DSLNVAIDC+ EAFE+E+E ++ ++ K++ 
Sbjct: 1   MPGSNKEIAALIVQFLSTST--KDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G+ L  +V + +  PT +  EP   N                       A KDFE A+ K
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKAFAAKDFEGAVKK 118

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+EAI  +P+NAV++ NRAAAYSS KK+ EAV DAE+A+++NPSYS+GYSRLG A+YALG
Sbjct: 119 YTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALG 178

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
           +PEEA++AYKKVLDIEG NAT+AMKRDY++A KKVE+SLN+E + P     ++ + +   
Sbjct: 179 KPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEGSSAG 237

Query: 241 GFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSGG 300
           GFPD++SM                                    +NPAIKQMA  F SGG
Sbjct: 238 GFPDLSSM----LGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNPAIKQMAQNFASGG 293

Query: 301 GTPSMADLMNNPALMDMAKNMFG 323
           GTP++ D+M +P + DMA   FG
Sbjct: 294 GTPNLGDMMKDPNIKDMAGKFFG 316

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  283 bits (725), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 160/334 (47%), Positives = 197/334 (58%), Gaps = 16/334 (4%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M  + KE+A+LI+DYL    + KE+  D  DSLNVA+DC+ EAFE E++S    ++ +F 
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G  L   +  S     AT    V +                       MATKD+E AI K
Sbjct: 61  GNGLTSFLSGS-----ATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKK 115

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           YSEAI  LP+NAVY+ANRAAAYSSLKKY +AV DAE+AIKVNP+YSKGYSRLGFA++A G
Sbjct: 116 YSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAES------- 233
           + E+ALDAYKKVLDIEG  ATD MKRDY+TA KKVEQSLN+E+  P  +  ES       
Sbjct: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGTG 235

Query: 234 -PDAAGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXS---NPAI 289
                G  GFPD++SM             K                      S   NPA+
Sbjct: 236 AAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMMQNPAV 295

Query: 290 KQMADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323
           +QMA+ F SG GTP ++ +MNNP L DMAKNMFG
Sbjct: 296 RQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  275 bits (704), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 152/331 (45%), Positives = 204/331 (61%), Gaps = 12/331 (3%)

Query: 4   TKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQS 63
           + KE+++LI+DYL +  E  ++ ED  DSLNVAIDC+T++FE E++S S +I+  F   S
Sbjct: 4   SNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFYNLS 63

Query: 64  LEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXX----XXMATKDFEHAIS 119
           L +++  + +    + +E V VN+P                        MA KDF+ AI+
Sbjct: 64  LPELLEVAMEN---SAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120

Query: 120 KYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYAL 179
           KYSEAI   P+NA+Y+ANRAAAYSSLK + +A EDAE+AI+V+P+YSKGYSRLGFA+YAL
Sbjct: 121 KYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180

Query: 180 GRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVER--SAPA-ASNAESPDA 236
            +PEEAL+AYKKVLD+EG  AT+ MKRDY+TA K+VEQSLN+E+  S P   S  ES   
Sbjct: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESVTESAAN 240

Query: 237 AGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKF 296
           A   GFPD++SM             +                       NP+I+QMA+ F
Sbjct: 241 AAAGGFPDMSSM-LGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNPSIRQMAENF 299

Query: 297 QSGGGTPSMADLMNNPALMDMAKNMFGGPKQ 327
           Q  G TP  + LMN+P + DMAKN FGG  Q
Sbjct: 300 Q-NGNTPDFSQLMNDPNIKDMAKNFFGGNNQ 329

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  273 bits (698), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 204/321 (63%), Gaps = 11/321 (3%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M P+ K+++SLI+DYL    + K + ED IDSLNVAI+C+TEAF +EK S+S+    +FG
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSA----AFG 56

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G++L +++ A +  P+ +Q E VKVNIP                    MA KD+E AI K
Sbjct: 57  GKNLAELLSAGAGAPS-SQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKK 115

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           YSEAI  +P+NAVY+ANRAAA+SSLK Y EA++DAE+A+KV+ SYSKGYSRLG+A++A G
Sbjct: 116 YSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQG 175

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASN----AESPDA 236
           + EEAL+AYKKVLDIEG +ATD MKRDY+TA +KVEQ+L + ++    ++     E   A
Sbjct: 176 KSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEPAGA 235

Query: 237 AGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKF 296
             G GF D++SM             +                       NP ++QMA+KF
Sbjct: 236 NPGGGF-DLSSM-LGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAEKF 293

Query: 297 QSGGGTPSMADLMNNPALMDM 317
             G GTP++ D+MNNPAL DM
Sbjct: 294 AGGNGTPNLNDIMNNPALRDM 314

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  270 bits (691), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 203/334 (60%), Gaps = 15/334 (4%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+ + KE+A+LI+D+L  ++    + EDY+DSLNVAIDC+TEAF+ E++   S+I   F 
Sbjct: 1   MSLSNKEIAALIVDFLSSSS--SSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G+ L +++ AS+        EPVKV+IPV                   MA K F+ AI K
Sbjct: 59  GKKLPELL-ASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEK 117

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+ AI   PSNAVY++NRAAAYSSLK+Y +AV+DAE AI+V+P+YSKG+SRLGFA+YAL 
Sbjct: 118 YTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALN 177

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
           +PEEALDAYKKVLDIEG  ATD MKRDY+TA KKVE S+N+E+S+ +AS+ +  D +   
Sbjct: 178 KPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKSATE 237

Query: 241 GFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQ--------- 291
           G    A                                       NP + Q         
Sbjct: 238 G--PGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAMK 295

Query: 292 -MADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
            MA++F SGGG P ++ +MN+P++ DMAKNMFGG
Sbjct: 296 QMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  269 bits (687), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 203/324 (62%), Gaps = 5/324 (1%)

Query: 4   TKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQS 63
           + KE++SLIIDYL +     E+  D IDSLNVAIDC+TE F VEK++ S+ IE  F G+S
Sbjct: 4   SNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFNGKS 63

Query: 64  LEQIVGASSKGPTATQQ---EPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           L +++ A+S+    T +   E VK+NIP                    +A+KD++ A+ K
Sbjct: 64  LTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLAVEK 123

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+EAI+ LP+NAVYFANRAAAY++ + Y EAV+DAE AIK++P+YSKGYSRL +A+Y   
Sbjct: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
             EE+L+AYKKVL+IEG +AT+  KR Y+TA K+VE+SLN+E+S P  S     + A G 
Sbjct: 184 NFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPAAGG 243

Query: 241 GFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSGG 300
           GFPD +S+             +                       NPAI+QMA++F+ GG
Sbjct: 244 GFPDFSSL-MSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFK-GG 301

Query: 301 GTPSMADLMNNPALMDMAKNMFGG 324
            TP  +++MNNPA+ +MA ++F G
Sbjct: 302 NTPDFSEMMNNPAVRNMASSLFSG 325

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  267 bits (683), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/320 (47%), Positives = 200/320 (62%), Gaps = 6/320 (1%)

Query: 6   KELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQSLE 65
           KE+A++II YL      K +GEDY+DS+NVAIDC+ E+FEVE+    SV+++S   + LE
Sbjct: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGLE 62

Query: 66  QIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISKYSEAI 125
           + +     G  A + E VKVNIP                    MA KDFE AI+KYSEAI
Sbjct: 63  ECLECMKGG--AVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAI 120

Query: 126 RTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
             LP+NA+Y+ANRAAA+SSLK+Y EAV DAE AI+++P+YSKGYSRLGFA+YA  +PEEA
Sbjct: 121 EVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEA 180

Query: 186 LDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGSGFP-- 243
           L+AYKKV+D+EG  ATD MKRDY+TA KKVEQSLN+E++  A        A  G+G    
Sbjct: 181 LEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGG 240

Query: 244 -DIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSGGGT 302
            D +SM             +                       +P+I+QMA++F SG GT
Sbjct: 241 FDFSSM-LSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSGNGT 299

Query: 303 PSMADLMNNPALMDMAKNMF 322
           P+M DLM+NPAL +MA +MF
Sbjct: 300 PNMDDLMSNPALRNMASSMF 319

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  263 bits (671), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 206/334 (61%), Gaps = 13/334 (3%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+ + KE+ SLI+D+L    + KEI ED  DSLNVAIDC+TE+FE E+++ +  ++  F 
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GQSLEQIVGASSKGPTATQ-QEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAIS 119
           G++L++I+ ++S   T ++ +E VKVNIPV                   MA KD+  AI 
Sbjct: 61  GKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLAIE 120

Query: 120 KYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYAL 179
           KYSEAI+TLP+N +Y+ANRAAAYSS+K+Y  A++DAE AI+++P+YSKGYSRL FA+YAL
Sbjct: 121 KYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYAL 180

Query: 180 GRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSA-----PAASNAESP 234
            +PEEAL+ YKKVLD+EG  AT AMKRD++ A  +VE S+N+E+S+     P+ S  + P
Sbjct: 181 NKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQP 240

Query: 235 -DAAGGSGFPDIASMXXXXXXXXXXXXX----KXXXXXXXXXXXXXXXXXXXXXXSNPAI 289
            +   GSG PD++S+                 +                       NP +
Sbjct: 241 ANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNPNL 300

Query: 290 KQMADKFQSGGGTPSMADLMNNPALMDMAKNMFG 323
           ++MA    SG    ++ DLMNNP++ DMA N+FG
Sbjct: 301 REMAQNLASGDA--NLDDLMNNPSVKDMANNLFG 332

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  251 bits (641), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 151/336 (44%), Positives = 205/336 (61%), Gaps = 19/336 (5%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+P+ K++A+LI+D+L  +A  K +GEDY DSL VAIDC+TEAFE+    A +++ +  G
Sbjct: 1   MSPSNKDIAALIVDFLTTSA--KTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
           G+SL Q++  +    T+   EP      V                   MA KD+E AI K
Sbjct: 59  GRSLSQLL-TTGMAHTSDAGEP-----KVAAEELKKEAEALKLEGNRAMAAKDYETAIQK 112

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+ AI  LP++AVY+ANRAAAYSSL++Y +AVEDAE A KV+ SYSKG+SRLG+A+YALG
Sbjct: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAA-SNAESPDAAGG 239
           R EEAL+AYK+VLDIEG NAT+AM+RDY++A +KVE+S+N++R+A    S   +  +AGG
Sbjct: 173 RHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGG 232

Query: 240 SGFPDIASMXXXXXXXXXXXXXKXX---------XXXXXXXXXXXXXXXXXXXXSNPAIK 290
           SG PD+ASM                                             SNPAIK
Sbjct: 233 SGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAIK 292

Query: 291 QMADKFQSGGGTPSMADLMNNPALMDMAKNMFGGPK 326
           +MA+ F SG G+  + DLM +PA+ +MA   F GPK
Sbjct: 293 KMAENFASGNGSSGLGDLMADPAVRNMASKFF-GPK 327

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  251 bits (641), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 142/344 (41%), Positives = 201/344 (58%), Gaps = 25/344 (7%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+   K++ +LI+D+L    E  E+ ED  DSLNVA+DC++EA E ++E     I+  F 
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GQSLEQIVGASSKGPTAT---QQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHA 117
           G++L  I+  +S     T   ++E V+VNIPV                   MA KDF  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 118 ISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQY 177
           + KY+EAI+ LP+NA+Y+ANRAAA+SSLK++ EA++DAE+AIK++PSYSKGYSRL FA+Y
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 178 ALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAP----------- 226
            LG+ EEAL++YKKVLDIEG NAT  MKRDY+TA K+VE+S+NVE+S             
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 227 --AASNAESPDAAGGSGFPDIASMXXXXXXXXXXXXXKXX----XXXXXXXXXXXXXXXX 280
             A  NA +P A    G PD++S+                                    
Sbjct: 241 ESAQGNAPNPFAG---GMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQV 297

Query: 281 XXXXSNPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
               S+P+++ +A+ F++  G   M D+MNNPA+ +MA N+F G
Sbjct: 298 QSMMSDPSMRDLANNFKN--GNTDMNDIMNNPAIRNMASNLFKG 339

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  246 bits (629), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 126/227 (55%), Positives = 167/227 (73%), Gaps = 9/227 (3%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+P+ KE+ASLI+DYL +  E K + E+ IDSLNVAIDC+ E+FEV+K  + +V    FG
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 61  GQSLEQIV----GASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEH 116
           G+ L +++    G+SS+  T TQ E +KVNIP                    MA KDF+ 
Sbjct: 57  GKGLVELLQNESGSSSETAT-TQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDL 115

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           AI KYS+AI  LP+NAVY+ANRAAA+SS+K Y EA++DAE+AIK +P+YSKGYSRLG+A+
Sbjct: 116 AIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAK 175

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVER 223
           +ALG+ E+AL+AYKKVLDIEG  A+D MKRDY+TA KKVEQSL++E+
Sbjct: 176 FALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEK 222

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 30/39 (76%)

Query: 286 NPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
           NP ++QMA+ F  G G P+M DLMNNPAL DMA ++FGG
Sbjct: 287 NPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFGG 325

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  245 bits (626), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 128/230 (55%), Positives = 174/230 (75%), Gaps = 4/230 (1%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKS-F 59
           M+ +K+E+ASLI++Y     E KE+ ED  DSLNVA+DC++EAF  E+++ SS+++KS F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  GGQSLEQIVGASSKGPTATQQEP---VKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEH 116
            GQSL  ++ +SSK P + +++    V+VNIP                    MA K++E 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           AI KY+EAI  LP+NA+Y+ANRAAA+SSLK+Y EA++DAE+AI V+PSY +GYSRLGFA+
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAP 226
           YA G+PEEAL+AYKKVLDIEG NATDAMKRDY++A K+VEQSLN+E++AP
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAP 230

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 34/39 (87%)

Query: 286 NPAIKQMADKFQSGGGTPSMADLMNNPALMDMAKNMFGG 324
           +P+I+QMA+ F SGGGTP+++DLM NPAL +MA ++FGG
Sbjct: 292 DPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFGG 330

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  245 bits (625), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/328 (43%), Positives = 203/328 (61%), Gaps = 11/328 (3%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+ + K++A+L++D+L    E K +  D  DSLNVAIDC+TEAFE EK+   S +   FG
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GQSLEQIVGASS--KGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXX----XXMATKDF 114
           G+SL +++ A++  KG +++  E +KV+I                         MA KD+
Sbjct: 61  GKSLTELLDAATNAKGRSSSP-EDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDY 119

Query: 115 EHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGF 174
             A+ KY+ AI+ +P+ AVY+ANRAAAYSS +KY EA++DAE+AIKV P++SKGYSRLGF
Sbjct: 120 NLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGF 179

Query: 175 AQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESP 234
           A++A G+ +EAL+AYKK L+++G  ATD MKRDY+TA KKVEQSLNVE+SA  +++A + 
Sbjct: 180 AKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASAS 239

Query: 235 DAAGGSGFPDIASMXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMAD 294
            +AG  G PD+ASM             +                       NP+I+QMA+
Sbjct: 240 ASAG--GMPDMASM-LGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAE 296

Query: 295 KFQSGGGTPSMADLMNNPALMDMAKNMF 322
              S G +  M D MNNPA+ +MA N+F
Sbjct: 297 NL-SSGSSEGMGDFMNNPAIREMASNLF 323

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  169 bits (428), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/325 (30%), Positives = 161/325 (49%), Gaps = 3/325 (0%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+   K+  +LI++YL +  +GKE+ ED  +SLNVAIDC+++ FE++  S   +I   F 
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
              L+ I          +    ++V                       M+ K+++ AI K
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           YS+AI   PSN  Y++NRAAAY  ++ +  AV DA  AIK++P+YSK YSRLG A+ A G
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240
             E+A+ A+KKVL++EG  +T+ MK DY+ A K V+  + + ++ P  S    P      
Sbjct: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGP--PPLNTTD 238

Query: 241 GFPDIAS-MXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXXXSNPAIKQMADKFQSG 299
              DIA+ +                                     NP ++Q A+   +G
Sbjct: 239 VLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVANG 298

Query: 300 GGTPSMADLMNNPALMDMAKNMFGG 324
            G   ++D++NNP++ ++A  +  G
Sbjct: 299 NGPGGLSDVLNNPSVKEVANGLMNG 323

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  124 bits (310), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 115/217 (52%), Gaps = 17/217 (7%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           M+ TK++ ASLII YL        + ED  +SL VAI C+ E+F ++      ++  S  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD----GDILPTSLK 56

Query: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAISK 120
            ++L+ I+  +     ATQ+                            M    +E AI K
Sbjct: 57  ERTLKTILQENLNTLEATQK------------IHNEEAEALKKEGNEAMIEGQYEEAIKK 104

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180
           Y+EAI+    N  Y++NR+ AYS L +Y +AV DA  AI ++PS+SK YSRLG+A+    
Sbjct: 105 YTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQD 163

Query: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQ 217
           + E+ + AYK+ +D+EG+NA+  +  DY+ A  K EQ
Sbjct: 164 KLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  122 bits (306), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 136/250 (54%), Gaps = 26/250 (10%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESA--SSVIEKS 58
           M+ + KE+AS I+ YL       ++ EDY +S++VAI+C+ ++F++++E +  S +    
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 59  FGGQSLEQIVGASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXXXXXMATKDFEHAI 118
               +LE     S K      ++ +K+ +                     +  ++++ AI
Sbjct: 61  LANLNLEPEPKLSEKERELVNEQAIKLKL----------------EGNKAVERENYKDAI 104

Query: 119 SKYSEAIRTLPSNAV-----YFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLG 173
            KY+ AI  L  N +     Y +N++ A +   +Y EA +DA A IK++P++SKGYSRL 
Sbjct: 105 DKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLA 164

Query: 174 FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAES 233
            A+    + E+A++AYK+VLD+EG+ ATD MKRD++   +K E +LN   S    S + +
Sbjct: 165 EAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE-TLNF--STHIDSGSAT 221

Query: 234 PDAAGGSGFP 243
           P +   + +P
Sbjct: 222 PISEAANKYP 231

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  110 bits (276), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 120/262 (45%), Gaps = 45/262 (17%)

Query: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
           MN T +E+AS+I+DY  +     ++ +D +DSLNVAIDC+ + F+V+K+  S++++ ++ 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GQSL--------EQIVGASSKGPTATQQEPVK---------------VNIPVXXXXXXXX 97
              L           +    K  T       K               +N+PV        
Sbjct: 61  SNDLLTYLPNGKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIEE 120

Query: 98  XXXXXXXX-------------XXXMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSS 144
                                   M  K +  AI  YS+AI+  P+N  Y+ NRA AY  
Sbjct: 121 TKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIK 180

Query: 145 LKKYAEAVEDAEAAI----KVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDI----- 195
              +  A+ DA  +I    K++P+  K Y RLG A+Y +G  E +L A+K++++I     
Sbjct: 181 ANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENN 240

Query: 196 EGSNATDAMKRDYDTAMKKVEQ 217
           +G   T  M  DY+ A +KV++
Sbjct: 241 KGDEITKQMDADYEKAKEKVQE 262

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 94.7 bits (234), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 110/253 (43%), Gaps = 36/253 (14%)

Query: 6   KELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQSLE 65
           K++A LI+++L      KEI +D IDSLNVAIDC+ + + + +   SS +   F    L 
Sbjct: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSDLT 68

Query: 66  QIVG----------ASSKGPTATQQEPVKVNIPVXXXXXXXXXXXXXXXX---------- 105
            I+            S+K  T    EP  +N  V                          
Sbjct: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128

Query: 106 ----------------XXXMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYA 149
                              M ++D++ AI  Y+ AI   P + +Y++NR+ AY  +  Y 
Sbjct: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188

Query: 150 EAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYD 209
            A+ DA   I ++ ++SK Y RL   +    +  +ALD YKK +++   +  + + R+++
Sbjct: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248

Query: 210 TAMKKVEQSLNVE 222
               KV+  +++ 
Sbjct: 249 DLKLKVQTDISLR 261

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 94.7 bits (234), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 66/89 (74%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KDFE A   +S+AI +  + N V ++NR+A Y+SLKK+ EA+EDAE  +K+NP++SKGY+
Sbjct: 17  KDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINPTWSKGYN 76

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           R+G AQY LG  ++A   YKK L+I+ SN
Sbjct: 77  RVGAAQYGLGNLDDAEKEYKKALEIDSSN 105

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 56/95 (58%), Gaps = 5/95 (5%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+  A+S Y+E I+  P +A  ++NRAA  + L  + +A++D + AI  +P++ + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 173 GFAQYALGR---PEEALDAYK-KVLDI-EGSNATD 202
             AQ A+       E LDA + K L+I +G+NA +
Sbjct: 476 ASAQIAVREFAPAMETLDAARAKDLEINKGANARE 510

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 66/89 (74%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD+E AI  +S+AI    + N V+++NR+A Y+SLKK+ EA+ DAE  +K+NP++SKGY+
Sbjct: 18  KDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINPTWSKGYN 77

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           RLG A   LG  +EA  +YKK L+++GSN
Sbjct: 78  RLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 69/126 (54%), Gaps = 11/126 (8%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA S L  + EA+ED   AI+ +P++ + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 173 GFAQYALGR---PEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
             AQ A+       E LDA  +  D E +N+ +   R+ D    K  Q    +R  PA+S
Sbjct: 465 ATAQIAVKEFAAAIETLDA-ARTKDAEVNNSANV--REIDQLYVKASQ----QRFQPASS 517

Query: 230 NAESPD 235
           N E+P+
Sbjct: 518 N-ETPE 522

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            + K++E A+  +S+AI   P  N V ++NR+A Y+SLKK+ +A+ DA    K+NP++SK
Sbjct: 16  FSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINPTWSK 75

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           GY+R+G A Y LG  +EA  +YKK L+++ SN
Sbjct: 76  GYNRVGAAHYGLGDLDEAEKSYKKALELDASN 107

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 7/134 (5%)

Query: 117 AISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           A+  Y+E I   P +A  ++NRAAA S L  + EA+ D E A++ +P++ K Y R   AQ
Sbjct: 411 AVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQ 470

Query: 177 YALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDA 236
            A+     AL+     LDI  S  T+         + ++      +R  PA+SN E+P+ 
Sbjct: 471 IAIKEYSSALE----TLDIARSKDTELNNGSNIREINQLYAKATQQRFEPASSN-ETPEQ 525

Query: 237 AGGSGF--PDIASM 248
                   P++A++
Sbjct: 526 TYQRAMKDPEVAAI 539

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
             +KDF  AI  +++AI   P+ N V ++NR+AAY+S K++ EA+ DA   +K+NP++SK
Sbjct: 16  FTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINPTWSK 75

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           GY+RLG A++ LG  EEA   YK+ L ++ +N
Sbjct: 76  GYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 46/75 (61%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  YSE I+  P +A  ++NRAAA S L  + EA++D + AIK +P++ + Y R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 173 GFAQYALGRPEEALD 187
             AQ A+     ALD
Sbjct: 464 ATAQIAIKEYANALD 478

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 53/113 (46%), Gaps = 15/113 (13%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI----KVNPSY---S 166
           F+ AI +Y++A   L  +  Y  NR+AA      +  A+     A+    ++   Y   +
Sbjct: 271 FDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRELRADYKIIA 329

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSL 219
           K ++R+G A +  G  ++++D Y+K L       T+    D  T ++  E+ L
Sbjct: 330 KSFARIGNAYHKKGDLKKSIDYYQKSL-------TEHRTADILTKLRNCEKEL 375

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 73/112 (65%), Gaps = 3/112 (2%)

Query: 109 MATKDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            A KDFE AI  + +AI      N V ++NR+A Y+S++K+ EA+ DA+  +++ P +SK
Sbjct: 15  FAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKPDWSK 74

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN--ATDAMKRDYDTAMKKVEQ 217
           G++RLG A Y LG  +EA ++YKK L+++ SN  A D + +   T  +++EQ
Sbjct: 75  GHNRLGAAHYGLGDLDEAEESYKKALELDSSNKAAQDGLAQVQATQQQRMEQ 126

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 75/141 (53%), Gaps = 13/141 (9%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + +A++D + AI+ +P++ + Y R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 173 GFAQYALGRPE---EALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
             AQ A+       E LD  ++  D E +N ++   R+ D    K  Q    +R  PA +
Sbjct: 463 ATAQIAVQEYAAAIETLDTAREK-DAEVNNGSNT--REIDQLYIKATQ----QRFQPANA 515

Query: 230 NAESPDAAGGSGF--PDIASM 248
           N ESP+         P++A++
Sbjct: 516 N-ESPEETYARAVKDPEVAAI 535

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK----VNPSY-- 165
           + F+ AI+ Y +A   L  +  Y  NRAAA      Y  A++  E A++    +   Y  
Sbjct: 268 RQFDEAIANYEKAW-DLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKV 326

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++RLG A Y L   ++A++ Y+K L
Sbjct: 327 IAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD++ AI  +S+AI      N V ++NR+A Y+SLKK+  A++DAE  +K+NPS+SKGY+
Sbjct: 19  KDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINPSWSKGYN 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           R+G A + +G  +EA   YKK L+++ SN
Sbjct: 79  RVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAA  S L  + EA++D   AI+ +P++ + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 173 GFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAE 232
             AQ A+     AL+        +      A  R+ D    K  Q    +R  P  SN E
Sbjct: 472 ATAQIAVREFSSALETLDAARSKDAEVNKSANTREIDQLYIKASQ----QRFQPNDSN-E 526

Query: 233 SPD 235
           SP+
Sbjct: 527 SPE 529

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAY-------SSLKKYAEAVEDAEAAIKVNPS 164
           + F+ A++KY+EA     ++  Y  NR+AA        +S+K   EAVE           
Sbjct: 277 RQFDEAVAKYNEAWEA-HNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYKV 335

Query: 165 YSKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++R+G     L   ++A+D YKK L
Sbjct: 336 IAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 74/112 (66%), Gaps = 3/112 (2%)

Query: 109 MATKDFEHAISKYSEAIR-TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            A KDFE AI  +++AI  +   N V ++NR+A Y+S K++ +A+EDA+  + +NP++SK
Sbjct: 14  FAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINPAWSK 73

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN--ATDAMKRDYDTAMKKVEQ 217
           GY+R+G A + LG  +EA   YKK L+++ +N  A D +++ + T   + +Q
Sbjct: 74  GYNRVGAAHFGLGDLDEAEQGYKKALELDSANKAAQDGLEQVHKTQQSRQQQ 125

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA S L  + EA++D   AI  +P++ + Y R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 468 ATAQIAV 474

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAY-------SSLKKYAEAVEDAEAAIKVNPS 164
           + F+ AI  YS+A   L  +  Y  NRAAA        +++K   EAVE           
Sbjct: 273 RKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYKV 331

Query: 165 YSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVE 216
            SK ++R+G + + L   ++A++ Y+K L    +       R+ +  +KK E
Sbjct: 332 ISKSFARIGNSYHKLNELKKAIEFYQKSLTEHRTPEILTKLRNCEKELKKQE 383

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD++ AI  +++AI    + N V ++NR+A Y+SLKK+++A+ DA   +K+NPS+SKGY+
Sbjct: 19  KDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGYN 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           RLG A   LG  +EA   YKK L+++ SN
Sbjct: 79  RLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 71/140 (50%), Gaps = 11/140 (7%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA+ D   AI+ +P++ + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 173 GFAQYALGRPEEALDAYK--KVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASN 230
             AQ A+     AL+     +  D E +N + A  R+ D    K  Q    +R  P  SN
Sbjct: 471 ATAQIAVKEYASALETLDAARTKDAEVNNGSSA--REIDQLYYKASQ----QRFQPGTSN 524

Query: 231 AESPDAAGGSGF--PDIASM 248
            E+P+         P++A++
Sbjct: 525 -ETPEETYQRAMKDPEVAAI 543

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 54/115 (46%), Gaps = 15/115 (13%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK----VNPSY-- 165
           + F+ AI  Y++A   L  +  Y  NRAAA     +Y  A+     A++    +   Y  
Sbjct: 276 RQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKV 334

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSL 219
            SK ++R+G A + LG  ++ ++ Y+K L       T+    D  T ++  E+ L
Sbjct: 335 ISKSFARIGNAYHKLGDLKKTIEYYQKSL-------TEHRTADILTKLRNAEKEL 382

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 64/93 (68%), Gaps = 3/93 (3%)

Query: 109 MATKDFEHAISKYSEAI--RTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            A+KDF  AI  ++EAI   T P N V ++NR+A Y+SLK++ EA+ DA+  +K+NP +S
Sbjct: 15  FASKDFTGAIEYFTEAIAASTTP-NHVLYSNRSACYTSLKQFQEALNDAQQCVKINPDWS 73

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           KGY+R+G A   LG  ++A   YKK L+++ +N
Sbjct: 74  KGYNRMGAAHLGLGDLDDAESNYKKALELDSNN 106

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 43/67 (64%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA++D E AI+ +P++ + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRK 464

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 465 ATAQIAI 471

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 64/89 (71%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD++ AI  +++AI    + N V ++NR+A Y+SLKK+++A+ DA+  I +NPS+SKGY+
Sbjct: 19  KDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININPSWSKGYN 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           RLG A   LG  +EA + YKK L+++ SN
Sbjct: 79  RLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA+ D   AI+ +P++ + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 471 ATAQIAV 477

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAV---EDA-EAAIKVNPSY-- 165
           + F+ AI  Y++A   L  +  Y  NRAAA     +Y  A+    DA E   ++   Y  
Sbjct: 276 RQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKV 334

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            S+ ++R+G A + LG  ++ ++ Y+K L
Sbjct: 335 ISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 75/134 (55%), Gaps = 15/134 (11%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD+E A   + +AI      N V ++NR+A Y+SLKK+AE ++DAE  +K+NP +SKGY+
Sbjct: 18  KDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINPGWSKGYN 77

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASN 230
           R+G AQ+ L   E+A  +Y+K L+++ +N   A K   D  +K  E            S 
Sbjct: 78  RVGAAQFGLNNLEDAEKSYQKALELDSANK--AAKEGLDQVLKTRE------------SR 123

Query: 231 AESPDAAGGSGFPD 244
            + PD   G  F D
Sbjct: 124 QQMPDLGLGQMFND 137

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA+ D + AI+ +P++ + Y R 
Sbjct: 397 DWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRK 456

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 457 ASAQIAV 463

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI----KVNPSY-- 165
           + F+ AI  Y++A   L  +  Y  NRAAA      Y  A+     A+    ++   Y  
Sbjct: 262 RKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKV 320

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++R+G A + LG  +++++ Y+K L
Sbjct: 321 IAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 63/89 (70%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD+E A   +++AI    + N V ++NR+A ++SLKK+ EA+ DA   +K+NP++SKGY+
Sbjct: 17  KDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINPAWSKGYN 76

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           R+G A + LG+ +EA   YKK L+I+ SN
Sbjct: 77  RVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 13/141 (9%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E  +  P +A  ++NRAAA + L  + EA++D + AI  +P++ + Y R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 173 GFAQYAL---GRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
             AQ A+       E LDA  +  D E +N  +   R+ D    K  Q    +R  P   
Sbjct: 476 ATAQIAVREFASAIETLDA-ARAKDTELNNGANV--REIDQLYIKASQ----QRFQPQDP 528

Query: 230 NAESPDAAGGSGF--PDIASM 248
           N E+P+ A       P++AS+
Sbjct: 529 N-ETPEQAYARALKDPEVASI 548

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAV----EDAEAAIKVNPSY-- 165
           + F+ AI  Y++A   L  +  Y  NR+AA      Y +A+    E  E   ++   Y  
Sbjct: 281 RKFDEAIEHYNKAW-DLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGREMRADYKL 339

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            SK ++R+G A   L   ++A++ Y+K L
Sbjct: 340 ISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 64/89 (71%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           K+++ AI K+++AI    + N V ++NR+A Y+S K++ + +EDA   +K+NP++SKGY+
Sbjct: 19  KNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINPTWSKGYN 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           R+G A + +G  +EA  AYKK L+++ SN
Sbjct: 79  RVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I   PS+A  ++NRAAA S L  + EA+ D   AI+ +P++ + Y R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 173 GFAQYALGR--PE-EALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
             AQ A+    P  E LDA  +  D E +N  ++  R+ D    K  Q    +R  P+ +
Sbjct: 464 ATAQIAIKDFVPAIETLDA-ARTKDAELNNGANS--REIDQLYLKANQ----QRFQPSNA 516

Query: 230 NAESPD 235
           N E+P+
Sbjct: 517 N-ETPE 521

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 63/92 (68%), Gaps = 1/92 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            A+KD+  AI  +++AI      N V F+NR+A Y+S K + +A++DA   +K+NPS++K
Sbjct: 14  FASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINPSWAK 73

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           GY+RLG A Y LG  +EA  +YKK L+++ +N
Sbjct: 74  GYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 71/138 (51%), Gaps = 7/138 (5%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+  A+  Y+E I+  P++A  ++NRAAA S L  +A+A+ D + AI+ +P++ + Y R 
Sbjct: 404 DWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRK 463

Query: 173 GFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAE 232
              Q A+     A++        +    + A  R+ D    K  Q+    R  PA +N E
Sbjct: 464 ATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKASQA----RFEPANAN-E 518

Query: 233 SPDA--AGGSGFPDIASM 248
           +P+   A  +  P++AS+
Sbjct: 519 TPEEAYARATKDPEVASI 536

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 15/115 (13%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI----KVNPSY-- 165
           + F+ AI KY+EA  T  ++  Y  NRAAA      Y  A+E    A+    ++   Y  
Sbjct: 269 RKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKV 327

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSL 219
            SK ++R+G + + LG  ++A+D Y+K L       T+    D  T ++  E+ L
Sbjct: 328 ISKSFARMGNSYHKLGDLKKAIDYYEKSL-------TEHRTPDILTKLRNTEKEL 375

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 71/103 (68%), Gaps = 5/103 (4%)

Query: 112 KDFEHAISKYSEAIRT--LPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           K+++ AI  +++AI     PS+ V F+NR+A Y+SLKK+++A+ DA   +K+NPS+SKGY
Sbjct: 19  KNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDANECVKINPSWSKGY 77

Query: 170 SRLGFAQYALGRPEEALDAYKKVLDIEGSN--ATDAMKRDYDT 210
           +RLG A   LG  +EA   YKK L+++ +N  A D +++ + T
Sbjct: 78  NRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRT 120

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA+ D   AI+ +P++ + Y R+
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRM 470

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 471 AAAQIAV 477

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 14/113 (12%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAA----------YSSLKKYAEAVEDAEAAIKVNP 163
           F+ AI  Y+ A   L  +  Y  NRAAA           ++L    E   D  A  KV  
Sbjct: 278 FDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYKV-- 334

Query: 164 SYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVE 216
             SK ++R+G A + LG  ++ ++ Y+K L    +    A  R+ +   KK E
Sbjct: 335 -ISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILAKLRNVEKEQKKAE 386

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 65/89 (73%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD+  AI  +++AI    + N V ++NR+A Y+S KK+ EA++DAE  +K++PS+SKGY+
Sbjct: 17  KDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISPSWSKGYN 76

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           R+G AQ+ L + +EA  +YK+ L+++ SN
Sbjct: 77  RVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 42/67 (62%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E ++  P +A  F+NRAAA + L  + EA+ED   A+ ++P++ + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 455 ATAQIAV 461

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAY-------SSLKKYAEAVEDAEAAIKVNPS 164
           + FE AI  Y++A   L  +  Y  NR+AA        +++K   +AVE          +
Sbjct: 260 RQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYKT 318

Query: 165 YSKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++R+G A Y L    +A++ Y + L
Sbjct: 319 IAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 61/89 (68%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD+  AI  +++AI    + N V ++NR+A Y+SLKK+ +A+ DA   +K+NPS+SKGY+
Sbjct: 19  KDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINPSWSKGYN 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           RLG A   LG  ++A   YKK L+++ +N
Sbjct: 79  RLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 41/67 (61%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + EA+ D   AI+ +P++ + Y R 
Sbjct: 408 DWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 467

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 468 ATAQIAV 474

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAV----EDAEAAIKVNPSY-- 165
           + FE AI  Y++A   L  +  Y  NRAAA      Y  A+    +  E   ++   Y  
Sbjct: 273 RQFEEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKV 331

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            SK ++R+G A + LG  ++ +D Y+K L
Sbjct: 332 ISKSFARIGNAYHKLGDLKKTIDNYQKSL 360

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 62/89 (69%), Gaps = 1/89 (1%)

Query: 112 KDFEHAISKYSEAIR-TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KDF+ A+  ++ AI+ +   N V ++NR+ AY+SLKK+ EA+ DA   +K+   +SKG++
Sbjct: 18  KDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKADWSKGHN 77

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           RLG A + LG  +EA ++YKK L+++ +N
Sbjct: 78  RLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 72/140 (51%), Gaps = 11/140 (7%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+  A+  YSE I   P +A  ++NRAAA S L  + +A++D + AI+++PS+ + Y R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 173 GFAQYALGRPEEALDAYK--KVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASN 230
             AQ A+     A++     +  D E +N +    R+ D    K  Q    +R  PA +N
Sbjct: 467 ATAQIAVQEYSAAIETLDVARTKDAEVNNGSSI--REIDQLYVKATQ----QRFQPANTN 520

Query: 231 AESPDAAGGSGF--PDIASM 248
            ESP+         P++AS+
Sbjct: 521 -ESPEETYARAVKDPEVASI 539

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAA-------YSSLKKYAEAVEDAEAAIKVNPS 164
           + F+ AI+KY EA   L  +  Y  NRAAA        S++K   EAVE           
Sbjct: 272 RKFDEAIAKYEEAW-NLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRELRADYKV 330

Query: 165 YSKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++RLG A Y L   ++A++ Y+K L
Sbjct: 331 IAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 61/90 (67%), Gaps = 1/90 (1%)

Query: 112 KDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           KD++ AI  +++AI    + N V ++NR+AAY+S K+Y +A+ DA+  IK+NPS++KGY+
Sbjct: 19  KDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINPSWAKGYT 78

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSNA 200
           R G A   L + EEA   Y + L I+ +NA
Sbjct: 79  RKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+ +A+  Y+E I+  P +A  ++NRAAA + L  + +A+ D   AI+ +PS+ + Y R 
Sbjct: 400 DWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRK 459

Query: 173 GFAQYAL 179
              Q A+
Sbjct: 460 ATCQIAV 466

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 55/115 (47%), Gaps = 15/115 (13%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAY-------SSLKKYAEAVEDAEAAIKVNPS 164
           + F+ AIS Y++A  T   +  Y  NR+AA        + +K   EAVE+A         
Sbjct: 265 RQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENARELRTDYKI 323

Query: 165 YSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSL 219
            +K ++R+G A   L   ++A++ Y+K L       T+    D  + ++K E+ L
Sbjct: 324 VAKSFARMGNAYAKLDDLKKAIEYYQKSL-------TEHRTPDILSKLRKAEKDL 371

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPS 164
           ++K +E A+S   E I+  PS A  +  + AA   L KY EA +     +K++P+
Sbjct: 52  SSKQYEQALSDADECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPN 106

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 63/92 (68%), Gaps = 1/92 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPS-NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            A K ++ A+  +++AI    + N V ++NR+A+Y+S +K+ EA++DA    K+NPS++K
Sbjct: 16  FAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINPSWAK 75

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           GY+R G A + +G  ++A  +YKK L+++ +N
Sbjct: 76  GYTREGAAHFGMGNLDDAEASYKKALELDANN 107

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 40/67 (59%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D+  A+  Y+E I+  P +A  ++NRAAA S L  + +A+ D   AI+ +P++ + Y R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 173 GFAQYAL 179
             AQ A+
Sbjct: 460 ATAQIAV 466

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 8/89 (8%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK----VNPSY-- 165
           ++F+ AI+ Y++A   L +N  Y  NR+AA     +Y  A+     AI+    +   Y  
Sbjct: 265 RNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGREMRADYKI 323

Query: 166 -SKGYSRLGFAQYALGRPEEALDAYKKVL 193
            +K ++R+G A   +G  +EA++ Y+K L
Sbjct: 324 IAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSN-AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           K +E A+  ++ A+    +N  + ++NRAAA+  LK YAEA+ED +  +++ P++ KGYS
Sbjct: 22  KGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAPNWDKGYS 81

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIEGSNA 200
           R+G A   L + +EA + +KK L +   N 
Sbjct: 82  RVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +++  A+  Y+E I+T P++ V + NRAA +  L    + ++D + AI V+PSY K Y R
Sbjct: 443 REYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYVR 502

Query: 172 LGFAQYALGRPEEALDAY 189
            GFAQ      +EAL+ +
Sbjct: 503 KGFAQITERDLDEALETW 520

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KDFE AI  Y+ AI +L  + V+++NR+AAY S+  + + VED  AA+K+ P YSK + R
Sbjct: 118 KDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLR 176

Query: 172 LGFAQYALGRPEEAL 186
              A   LG+  +A+
Sbjct: 177 RASAYENLGQFSDAM 191

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 5/103 (4%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           +  +DF+ A   Y++AI T P+ +++++NRA A   L  +  A+ D   AI++N S  K 
Sbjct: 20  LKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKA 79

Query: 169 YSRLGFAQYALGRPEEALDAYKKVL-----DIEGSNATDAMKR 206
           Y R G A   L   + A + +  VL     DI   N  D  ++
Sbjct: 80  YHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNGFDTCEK 122

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 51/90 (56%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +++  AI  YS+AI   P+ +++F+NRA A   L  +   + D + A++++P   K Y R
Sbjct: 26  QNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPKNIKAYHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
            G +   L + ++A +  + VL  + ++AT
Sbjct: 86  RGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 43/71 (60%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           +A+KD+  AI  Y++AI      +++F+NRA A   L ++  A+ED+  AI+++ S  KG
Sbjct: 20  VASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSSNVKG 79

Query: 169 YSRLGFAQYAL 179
           Y R G A   L
Sbjct: 80  YHRRGMAYAGL 90

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 49/104 (47%), Gaps = 8/104 (7%)

Query: 127 TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL 186
           T+   A+ + ++   + + K Y +A+E    AI+++   S  +S    A   L R + AL
Sbjct: 4   TIVPEALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSAL 63

Query: 187 DAYKKVLDIEGSNATDAMKR--------DYDTAMKKVEQSLNVE 222
           +   K ++++ SN     +R        D+ +A + +E  L V+
Sbjct: 64  EDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVVLRVK 107

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (56%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +DF  AI  Y++AI    + ++YF+NRA A+  L  +  ++ D + A+K++P  +K Y R
Sbjct: 26  QDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKAYHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
            G +   L   ++A +  + VL  +  +AT
Sbjct: 86  RGLSYIGLLEFKKAKNDLQIVLKAKPGDAT 115

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 46/94 (48%), Gaps = 4/94 (4%)

Query: 111 TKDFEHAISKYSEAIRTLPS----NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            K F  A   Y++ I+        N   FANRAA    LK Y   V D + A+++NP   
Sbjct: 98  VKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAMEINPMNL 157

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNA 200
           K + R+G A  ALG+ +EA DA    L I+  N 
Sbjct: 158 KCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENV 191

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 65/123 (52%), Gaps = 5/123 (4%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K FE A+  YS AI  +  + V+++NR+A Y SL +  + VED  AA+K+ P YSK   R
Sbjct: 110 KQFEDALKYYSLAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLR 168

Query: 172 LGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYD-TAMKKVEQSLNVERSAPA 227
              A  +LG+  +A   L A     D  GS+    ++R+ +  AM  +++ L  ++    
Sbjct: 169 RASANESLGKFADAMFDLSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQEYKL 228

Query: 228 ASN 230
            SN
Sbjct: 229 PSN 231

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F  AI KY+EAI    + ++YF+NRA A+  +  +  A+ D + AIK++P   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

Query: 172 LGFAQYAL 179
              +  AL
Sbjct: 86  RALSCMAL 93

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F  AI KY+EAI    + ++YF+NRA A+  +  +  A+ D + AIK++P   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

Query: 172 LGFAQYAL 179
              +  AL
Sbjct: 86  RALSCMAL 93

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           + T+D+  AI  Y+EAI+   + ++YF+NRA  +  +  +   + D + A++++P   K 
Sbjct: 23  IKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPKNIKA 82

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQ 217
           Y R G +   L   + A    K VL  + ++AT   KR  D   K + +
Sbjct: 83  YHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFIRE 129

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F  AI KY+EAI    +  +YF+NRA ++  +  +  A+ D + AIK++P   K Y R
Sbjct: 26  KHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHR 85

Query: 172 LGFAQYAL 179
              +  AL
Sbjct: 86  RALSCMAL 93

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPS 164
           +F+ A++   EAI+  P N   +  RA +  +L ++ +A  D    +KV P+
Sbjct: 61  NFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVLLKVKPN 112

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 2/109 (1%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           +  +D+  AI KY +AI    + +VYF+NRA  +  L  +  A +D + A+ ++P   K 
Sbjct: 20  VKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKA 79

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQ 217
           Y R G A   L   ++A      VL  + S+A  A KR  D   K + +
Sbjct: 80  YHRRGLACVGLLEFKKARADLTVVLKAKPSDA--AAKRALDICEKVIRE 126

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K +E AI  YS A+R L  + V+++NR+A +  L K  + VED  AA+++ P YSK   R
Sbjct: 112 KKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170

Query: 172 LGFAQYALGRPEEAL 186
              A  +LG   +A+
Sbjct: 171 RATANESLGNFADAM 185

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K +  A+  Y++AI    + +++F+NRA A   L  +   ++D  +A++++P   K Y R
Sbjct: 27  KKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKAYHR 86

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQ 217
            G +Q  L   ++A +    VL  + S+AT   KR  D   K + +
Sbjct: 87  RGLSQLGLLHFKKAKNDLSIVLKAKPSDAT--AKRALDMCEKVIRE 130

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKK 191
           A+   N    Y   KKY +AVE    AI+++ + S  +S    AQ  L   +  LD    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 192 VLDIEGSNATDAMKR 206
            L+++  N     +R
Sbjct: 73  ALELDPKNIKAYHRR 87

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 60/128 (46%), Gaps = 18/128 (14%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D++ AI  YS+AI    + ++YF+NRA A+     +  AV D + A+K++P   K Y R 
Sbjct: 27  DYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPKNIKAYHRR 86

Query: 173 GFAQYALGRPEEALDAYKKVL-----DIEGSNAT-------------DAMKRDYDTAMKK 214
           G +   +    +A +    VL     DI  SNA              +A+    D A   
Sbjct: 87  GLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKVCENFIREERFKNAIGGSGDNAKSN 146

Query: 215 VEQSLNVE 222
           + Q+LN+E
Sbjct: 147 ICQTLNLE 154

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F  AI KY++AI    + ++YF+NRA A+  +  +  A+ D + A+K++P   K Y R
Sbjct: 26  KHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHR 85

Query: 172 LGFAQYAL 179
              +  AL
Sbjct: 86  RALSCMAL 93

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KDFE+AI  Y+ A+ +L  + VY++N +A YSSL  Y + +E A  A+ + P YSK   R
Sbjct: 109 KDFENAIKYYTFAL-SLKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVR 167

Query: 172 LGFAQYALG 180
              A   LG
Sbjct: 168 RANAYEKLG 176

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ AI  YS AI  +  + V+++NR+A Y SL +  + VED  AA+K+ P YSK   R
Sbjct: 109 KKYDEAIQYYSWAIE-VKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLR 167

Query: 172 LGFAQYALGRPEEAL 186
              A  +LG   +A+
Sbjct: 168 RASANESLGNFADAM 182

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 111 TKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           T  FE AI  Y  A++ L  + +Y++N +A Y+SL +Y + +E A  A+K+ P++SK   
Sbjct: 123 TSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLM 181

Query: 171 RLGFAQYALG 180
           R   A  A+G
Sbjct: 182 RRALAYEAMG 191

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K+F  A   YS+AI    + ++YF+NRA A+  L  +  A+ D   AI+++P   K Y R
Sbjct: 26  KNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKAYHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVL 193
            G +   L    +A    K VL
Sbjct: 86  RGLSYIGLLEFNKARKDLKIVL 107

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLG 173
           +E AI  Y  A++ L  + V+++NR+A Y  L K  + VED  AA+K+ P YSK   R  
Sbjct: 111 YEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRA 169

Query: 174 FAQYALGRPEEAL 186
            A  +LG   +A+
Sbjct: 170 TANESLGNYADAM 182

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 52/93 (55%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           + ++D++ AI  Y++AI    +++++++NRA A+  L  +  A+ D   AIK++ +  K 
Sbjct: 23  IKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNNNIKA 82

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
           Y R G A   L    +A +    +L  + ++AT
Sbjct: 83  YHRRGLAYVGLLEFRKAKNDLTILLKYKPNDAT 115

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 38/68 (55%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD+  A+  Y+ AI    + +++F+NRA A   L ++  A+ED+  AI+++    K Y R
Sbjct: 52  KDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHR 111

Query: 172 LGFAQYAL 179
            G A   L
Sbjct: 112 RGLAHCGL 119

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 29/55 (52%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   FANRAA    LK Y   + D + A+ +NP   K Y R+G A Y L   EEA
Sbjct: 117 NEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 111 TKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
            KD+E+AI+ Y  A++ L ++ V+++N AA Y SL+   EA+E    A+++NP YSK
Sbjct: 99  VKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSK 154

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (52%), Gaps = 2/87 (2%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   F NRAA    LK +   + D + A++ NP   K + R+G A ++L + EEA +A +
Sbjct: 117 NESLFLNRAACELELKNHRRCINDCKEALRYNPKNVKCFYRMGRAFFSLNKLEEAKEAIE 176

Query: 191 KVLDIEGSNATDAMKRDYDTAMKKVEQ 217
             L  + +NA  A+    D  +KK E+
Sbjct: 177 FGLRFDSNNA--ALGALLDKIVKKDEE 201

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K FE AI  Y+ AI+ L  + V+ +N +A Y SL    + VE +  A+++ P YSK   R
Sbjct: 107 KRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165

Query: 172 LGFAQYALGRPEEAL-DAYKKVL--DIEGSNATDAMKRDYD-TAMKKVEQSLNVERSAPA 227
              A   +GR ++A+ D     L  D  GS+    ++R+ +  A++ +++ + ++ S P 
Sbjct: 166 RASAYENMGRYQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQ 225

Query: 228 A 228
           A
Sbjct: 226 A 226

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 111 TKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
           +KD E+AI  Y  A+R L  + V+++N +A Y ++ +  + +E +  A+++ P YSK   
Sbjct: 171 SKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALL 229

Query: 171 RLGFAQYALGRPEEAL 186
           R   A  ALG  +EAL
Sbjct: 230 RRANAYEALGNNKEAL 245

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   FANRAA    LK Y   +ED   A+ +NP   K Y R   A ++L + EEA
Sbjct: 120 NESLFANRAACELELKNYRRCIEDCSKALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K +  A+  YS+AI    + +++F+NRA +   L  +  A+ED   +I+++P   K   R
Sbjct: 26  KKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNIKAIHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
            G +   L    +A    K +L ++  N   A+K     A++  E+ +  ER   A S
Sbjct: 86  RGLSYVGLLEFSKARKDLKTILQVK-PNEQSALK-----ALEVCERFIREERFKKAIS 137

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKK 191
           A+ F N+  A+   KKY EAVE    AI+++ + S  +S   F++  L     AL+   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 192 VLDIEGSNATDAMKR 206
            ++++  N     +R
Sbjct: 72  SIELDPKNIKAIHRR 86

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F+ AI  Y+ A+  L  + V+++NR+A Y S+ +  + VED  AA+K+   YSK   R
Sbjct: 116 KKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLR 174

Query: 172 LGFAQYALGRPEEAL 186
              A  +LG   +A+
Sbjct: 175 RASANESLGNYADAM 189

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +++  AI  Y++AI   P+ +++++NRA A   L  +  A  D   A+ ++    K Y R
Sbjct: 26  QNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAYHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
            G A   L   + A +    VL  + S+AT
Sbjct: 86  RGLANVGLLEFKRARNDLNVVLKAKPSDAT 115

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 4/94 (4%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKK 191
           AV F N    +   + Y++A+E    AI+++P+ S  YS    AQ  L   + A +   +
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNE 71

Query: 192 VLDIEGSNATDAMKRDYDTA----MKKVEQSLNV 221
            L ++  N     +R          K+    LNV
Sbjct: 72  ALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNV 105

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   FAN+AA    LK Y   +ED   A+ +NP  +K Y R   A + L + EEA
Sbjct: 120 NESLFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 111 TKDFEHAISKYSEAI----RTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            K F  A   YS+ I    +    N   +ANRAA    +K Y   + D + A+++NP   
Sbjct: 94  VKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNI 153

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSN-ATDAMKRDYDTAMKKVE 216
           K Y R+  A  AL R +EAL++ +    I+ +N +   +K   +T   ++E
Sbjct: 154 KCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIE 204

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   +ANRAA    +K Y   + D + A++ NP   K Y R+G A  AL   EEA  + +
Sbjct: 115 NESLYANRAACELEIKNYRRCLNDCKTALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE 174

Query: 191 KVLDIEGSNATDAMKRDYDTAMKKVE 216
             L ++ SN    ++   D  +KK E
Sbjct: 175 FGLQVDSSNK--PLQSLLDIVLKKQE 198

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 135 FANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLD 194
           FAN+AA    LK +   + D + A+++NP   K Y R+  A +AL + EEA ++ +  L 
Sbjct: 118 FANKAACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLK 177

Query: 195 IEGSNATDAMKRDYDTAMKK 214
            +  N +  +   +DT +KK
Sbjct: 178 FDPENTS--LINLHDTIIKK 195

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   FANRAA    LK Y + VED   A+ +NP   K Y R+  + + L + EEA
Sbjct: 120 NESLFANRAACELELKNYRKCVEDCGKALTINPKNIKCYYRISKSFFQLRKLEEA 174

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 42/90 (46%), Gaps = 4/90 (4%)

Query: 129 PSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDA 188
           P   V   NRAA +  L K   A+ DA   I V+    KGY R G     LGR EEAL  
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 189 YKKVL----DIEGSNATDAMKRDYDTAMKK 214
           Y+  L    + E ++A  A ++  D   ++
Sbjct: 127 YENGLKQAGEAEKTHAIHAPQKFLDIVYRQ 156

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
             +K+F+ AI  Y  AI   P++ V+++N +A Y S     + VE    A+++ P +SK 
Sbjct: 136 FTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKA 195

Query: 169 YSRLGFAQYALGRPEEAL 186
             R   A  +LG   +A+
Sbjct: 196 LLRRASANESLGNFTDAM 213

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ A+  YS+AI    + ++YF+NRA +   L  +  A ED + AI ++P   K   R
Sbjct: 24  KKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNIKAIHR 83

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNATDAMK 205
            G +   L    +A    + VL ++  N   A+K
Sbjct: 84  RGLSYVGLLEFFKARKDLRVVLQVK-PNEQSALK 116

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYAL 179
           A+ F N+  AY   KKY EAVE    AI+++ + S  +S   F++  L
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRL 57

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   +ANRAA    LK Y   +ED   A+ +NP   K Y R   A + L + EEA
Sbjct: 120 NESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 4/93 (4%)

Query: 111 TKDFEHAISKYSEAIRTLPSNA----VYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            K F  A   Y++ I     +A    +   NRAA    LK Y   + D   A+K+NP   
Sbjct: 90  VKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALKLNPKNP 149

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
           K + R+G A   L + EEA +A    L ++  N
Sbjct: 150 KAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 61/124 (49%), Gaps = 3/124 (2%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           M   D+  A   + +A+     N +++ +    Y  + +Y +A++    AI++NP  S+ 
Sbjct: 307 MIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEV 366

Query: 169 YSRLG-FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPA 227
           +  LG   +    +  +ALDAYK+   ++ +N    ++   +   K++E   N+ +S  A
Sbjct: 367 WYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNINKSNGA 424

Query: 228 ASNA 231
            +NA
Sbjct: 425 PTNA 428

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D + A   Y   ++  PS+A    + A  Y S   +  A E  E A+ VNP  S  ++ L
Sbjct: 61  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 120

Query: 173 GFAQYALGRPEEALDAYKKVL 193
           G     L   + A +AY++ L
Sbjct: 121 GHCYLMLDDLQRAYNAYQQAL 141

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   F+NRAA    LK Y   V D   A++ NP+  K + R+  A + L + E+A +A +
Sbjct: 115 NESLFSNRAACELELKNYRRCVNDCRQALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIE 174

Query: 191 KVLDIEGSNA 200
             L ++  +A
Sbjct: 175 FGLKLDSESA 184

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
             TK+F  AI  Y  AI   P++ V+++N +A Y S     + +E    A+++ P +SK 
Sbjct: 135 FTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKA 194

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKK--VEQSLNVERSAP 226
             R   A  +LG   +A+     VL + G         D+D A  +  +E++LN +    
Sbjct: 195 LLRRASANESLGNFTDAMFDL-SVLSLNG---------DFDGASIEPMLERNLNKQAMKV 244

Query: 227 AASNAESPDAAGGSGFPDIASM 248
              N    D  G    P   S+
Sbjct: 245 LNENLSKGDGRGSQLLPSNTSL 266

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/75 (22%), Positives = 38/75 (50%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKK 191
           AV   N+   + + K + EA++  + AI+++P+    YS +     + G   + L+   K
Sbjct: 124 AVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTK 183

Query: 192 VLDIEGSNATDAMKR 206
            L+I+  ++   ++R
Sbjct: 184 ALEIKPDHSKALLRR 198

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 61/124 (49%), Gaps = 3/124 (2%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           M   D+  A   + +A+     N +++ +    Y  + +Y +A++    AI++NP  S+ 
Sbjct: 309 MIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEV 368

Query: 169 YSRLG-FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPA 227
           +  LG   +    +  +ALDAYK+   ++ +N    ++   +   K++E   N+ +S  A
Sbjct: 369 WYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNMNKSNGA 426

Query: 228 ASNA 231
            +NA
Sbjct: 427 PTNA 430

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D + A   Y   ++  PS+A    + A  Y S   +  A E  E A+ VNP  S  ++ L
Sbjct: 63  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 122

Query: 173 GFAQYALGRPEEALDAYKKVL 193
           G     L   + A +AY++ L
Sbjct: 123 GHCYLMLDDLQRAYNAYQQAL 143

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD+ +AI  Y+ A+  L  + ++++N +A Y SL +  + +E +  A+++NP+YSK   R
Sbjct: 136 KDYTNAIKYYNLAL-DLNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLR 194

Query: 172 LGFAQYALGRPEEAL 186
              A  +L    +AL
Sbjct: 195 RASANESLENYSDAL 209

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K F  AI  Y  AI   P++ V+++N +A Y S     + VE    A+++ P +SK   R
Sbjct: 145 KSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLR 204

Query: 172 LGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYD-TAMKKVEQSL 219
              A  +LG   +A   L       D +G++    ++R+ +  AMK + +SL
Sbjct: 205 RASANESLGNFTDAMFDLSVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESL 256

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           FE AI  Y+ AI  L  N ++++N +A Y SL K  E ++    A+++ P YSK   R
Sbjct: 127 FEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLR 183

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +DFE+A+  Y+ A+ TL  + V+++N +A Y SL +  + VE +  A+K+   YSK   R
Sbjct: 119 QDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLR 177

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD+++A+  Y  A+ TL  + V+++N +A Y S+ +  + VE++  A+++ P YSK   R
Sbjct: 120 KDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLR 178

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K+F  AI  Y  AI   P+  V+++N +A Y S     + +E    A+++ P +SK   R
Sbjct: 141 KNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLR 200

Query: 172 LGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYD-TAMKKVEQSL 219
              A  +LG   +A   L       D +G++    ++R+ +  AMK + ++L
Sbjct: 201 RASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNLNKQAMKVLNENL 252

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 39/75 (52%)

Query: 132 AVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKK 191
           AV   NR   + + K + EA++  + AI+++P+    YS +     + G  E+ ++   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 192 VLDIEGSNATDAMKR 206
            L+I+  ++   ++R
Sbjct: 187 ALEIKPDHSKALLRR 201

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 57/117 (48%), Gaps = 3/117 (2%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           M   D+  A   + +A+     N +++ +    Y  + +Y +A++    AI++NP  S+ 
Sbjct: 301 MIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEV 360

Query: 169 YSRLG-FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERS 224
           +  LG   +    +  +ALDAYK+   ++ +N    ++   +   K++E   N+ +S
Sbjct: 361 WYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNINKS 415

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D + A   Y   ++  PS+A    + A  Y S   +  A E  E A+ VNP  S  ++ L
Sbjct: 55  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 114

Query: 173 GFAQYALGRPEEALDAYKKVL 193
           G     L   + A +AY++ L
Sbjct: 115 GHCYLMLDDLQRAYNAYQQAL 135

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   +ANRAA    LK + + +ED + A+  N    K Y R+G A  ++ R +E+ ++ +
Sbjct: 111 NESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDESKESIE 170

Query: 191 KVLDIEGSNAT 201
             L I+  N +
Sbjct: 171 FGLKIDSENKS 181

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 112 KDFEHAISKYSEAIRT----LPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSK 167
           K F+ A + Y +A+      L  N   + N AA    +K Y   +     A+K+N    K
Sbjct: 84  KRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALKLNAKNVK 143

Query: 168 GYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPA 227
            + R+G A   LGR E++L+A +  L ++  N   A+K     A +K+++   +E    A
Sbjct: 144 AFFRIGKAYLELGRFEDSLEAVQVGLAVDPENG--ALKSIQSKATEKLKRKKELENRTLA 201

Query: 228 ASNAE 232
               E
Sbjct: 202 QKQKE 206

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   FAN AA    +K +   +   + A++ NP   K Y R+  A Y L + +EA ++ K
Sbjct: 115 NESLFANLAACELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVK 174

Query: 191 KVLDIEGSNAT 201
             L I+  N +
Sbjct: 175 FGLTIDSENKS 185

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 63/137 (45%), Gaps = 7/137 (5%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD+E+A+  Y  A+  L  + V+++N +A Y SL +  + +E +  A+++ P YSK   R
Sbjct: 122 KDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR 180

Query: 172 LGFAQYALGRPEEA---LDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAA 228
              A   L    +A   L       D  G+     ++R+ +    KV   L+ +   P+ 
Sbjct: 181 RATANEQLENYSDAMFDLSVLSLNNDFNGATIEPMLERNLNKQAIKV---LDQKSKNPSK 237

Query: 229 SNAESPDAAGGSGFPDI 245
           + +E P     + F  I
Sbjct: 238 NESELPSNTSMASFFSI 254

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           +DF  A   Y++AI    + +++F+NRA A+     +  ++ D + A++++    K Y R
Sbjct: 26  QDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAYHR 85

Query: 172 LGFAQYALGRPEEALDAYKKVL 193
            G +   L   ++A    K VL
Sbjct: 86  RGLSYVGLLEFKKARTDLKTVL 107

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEA 185
           N   +ANRAA    LK +   + D + A+  NP   K Y R+G A  A+ + E A
Sbjct: 115 NESLYANRAACQLELKNFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESA 169

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 57/127 (44%), Gaps = 1/127 (0%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           M   D+  A   +  A+     N  ++ +    Y  + +Y +A++    AI++NP  S+ 
Sbjct: 323 MVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEV 382

Query: 169 YSRLG-FAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPA 227
           +  LG   +    +  +ALDAYK+   ++ +N     + +  T     + + NV    P 
Sbjct: 383 WYDLGTLYETCNNQLTDALDAYKQAARLDTNNVHIRERLEALTEQLANQSNGNVMAHQPK 442

Query: 228 ASNAESP 234
           A+ A +P
Sbjct: 443 AATASNP 449

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N   F+NRAA    LK Y   V D + A++ N    K Y R+  A   L + E+A  A +
Sbjct: 115 NESLFSNRAACELELKNYRRCVNDCKRALQYNVKNIKCYYRIAKAFLLLNKLEDAKQAAE 174

Query: 191 KVLDIEGSN-ATDAMKRDYD 209
             L ++  N A +A++++ D
Sbjct: 175 FGLKLDPENQALNALRQNVD 194

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 29/49 (59%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKV 161
           D+E A+  Y +AI   PSN + ++N A     L+K++EAV+     +K+
Sbjct: 19  DYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD+++A+  Y+ A+  +  + V+++N +A Y SL +  + VE++  A+++ P YSK   R
Sbjct: 115 KDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLR 173

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 52/98 (53%), Gaps = 3/98 (3%)

Query: 115 EHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGF 174
           E A++ Y  A +  P++++    RA    S+ KY +A++  E  IK+ P  +     LG 
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEATVQFILGQ 768

Query: 175 AQYALGRPEEALDAYKKV--LDIEGSNA-TDAMKRDYD 209
               +GR ++A+  Y     LD +GSN  +DA+K+ ++
Sbjct: 769 LYQIMGRKKDAIKRYTIAMNLDPKGSNLISDALKKCHE 806

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 38/89 (42%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD + AI  + +A +  P+    +  +   Y S+  Y  A      AI  +  +   Y  
Sbjct: 604 KDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYG 663

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNA 200
           +G     LG  E+AL  ++K   I  SNA
Sbjct: 664 MGMCSMKLGEYEQALVYFEKARSINPSNA 692

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 6/118 (5%)

Query: 111 TKDFEHAISKYSEAIRTLPS----NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            K ++ A + YS+ I         N   + NRAA    L+ +   + D + A+  N    
Sbjct: 92  VKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALNFNAKCV 151

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERS 224
           K + R+G A + L + EEA  +    L ++  N  +A+    DT +K+ E++  +E S
Sbjct: 152 KAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQN--NALVSLLDTIVKQEEKANVLEES 207

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 4/95 (4%)

Query: 111 TKDFEHAISKYSEAIRTLPS----NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYS 166
            K F  A   Y++AI         N   +ANRAA    LK Y   + D + A+ +NP   
Sbjct: 87  VKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNI 146

Query: 167 KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
           K Y R+  A  A+ + ++  +A +  L  +  N +
Sbjct: 147 KCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%)

Query: 129 PSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDA 188
           P   +   NRAA++  +    +A+ DA+  IKV+    KGY R G     + + +EAL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 189 YK 190
           Y+
Sbjct: 127 YR 128

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 6/97 (6%)

Query: 131 NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N + F N+AA    +K Y   + D + A+  NP   K Y R+  A  A+ + +E+ ++ +
Sbjct: 111 NELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE 170

Query: 191 KVLDIEGSNATDAMKRDYDTAMKKVEQS----LNVER 223
             L ++  N++  +     T +KK E+     L +ER
Sbjct: 171 FGLKVDSRNSS--LLNLLKTIIKKQEEKTAYRLKLER 205

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           +  K++   I+   +A+   P N   +   A A+S+++KY E+ E  E  +KV+   S+ 
Sbjct: 123 LEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVD---SRN 179

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIE 196
            S L   +  + + EE   AY+  L+ E
Sbjct: 180 SSLLNLLKTIIKKQEEK-TAYRLKLERE 206

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  A+++ P YSK   R
Sbjct: 113 KKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171

Query: 172 LGFAQYALGRPEEAL 186
              A   LG+  +A+
Sbjct: 172 RASANEGLGKFADAM 186

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 37.0 bits (84), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 47/82 (57%)

Query: 118 ISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQY 177
           + K  +A R L S +  +     AY   ++ + ++E  ++AI+V+P+  + +  LG A  
Sbjct: 655 LVKAEKAKRILQSTSWPYRVLGIAYLQNQQESSSIEWFQSAIRVDPNDIESWVGLGQAYL 714

Query: 178 ALGRPEEALDAYKKVLDIEGSN 199
           A GR E ++  ++K ++++GS+
Sbjct: 715 ACGRIEASMKVFEKAMELDGSH 736

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 29/53 (54%)

Query: 137 NRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAY 189
           NRAA++  L K  +A++DA+  I+V P   K Y R G     L + +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>TPHA0P01590 Chr16 (328049..331282) [3234 bp, 1077 aa] {ON} Anc_3.5
           YOL145C
          Length = 1077

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 145 LKKYAEAVEDAEAAIKVNPSYS---KGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
           +++Y +A+E  E  +K  P+YS   K Y+ LG   Y  G  E +L  YKK L     NA 
Sbjct: 749 MREYVKAIEGYELILKKFPNYSKLAKVYNLLGKTWYERGNKENSLSCYKKAL----QNAE 804

Query: 202 DAMKRDYDTAMKKVEQSLNVERSAPAAS 229
            ++K +       +E S ++E S   AS
Sbjct: 805 TSLKLE-------IESSNDLENSPKIAS 825

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  A+++ P YSK   R
Sbjct: 113 KKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLR 171

Query: 172 LGFAQYALGRPEEAL 186
              A   LG   +A+
Sbjct: 172 RASANEGLGNFADAM 186

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  A+++ P YSK   R
Sbjct: 113 KKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171

Query: 172 LGFAQYALGRPEEAL 186
              A   LG   +A+
Sbjct: 172 RASANEGLGNFADAM 186

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K  E AI  Y  A+     + V++AN +A Y SL  + + +E+   A+++ P YSK   R
Sbjct: 120 KAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%)

Query: 129 PSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDA 188
           P     + N +A Y  L++  +A E +   I + P   KGY R+G      G+  EA   
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 189 YKK 191
           YKK
Sbjct: 128 YKK 130

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAI-------KVNPSY 165
           +F  A   Y + I   P N + ++NRA A   L+K++E ++  +  +       K  P  
Sbjct: 19  NFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGLGKLEDNEKDEPIR 78

Query: 166 SKGYSRLGFAQYALGR 181
            K   RL  AQ +L +
Sbjct: 79  KKLLYRLHLAQESLNK 94

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K ++ AI  Y+ A+  L  + V+++N +A Y S+    + VE +  A+++ P YSK   R
Sbjct: 113 KKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLR 171

Query: 172 LGFAQYALGRPEEAL 186
              A   LG   +A+
Sbjct: 172 RASANEGLGNFADAM 186

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG-YSRLGFAQYAL 179
           Y + +   P N + ++N+A A   L +Y E VE     +   P+ +   Y +L +     
Sbjct: 26  YQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPNTTDTVYKKLNY----- 80

Query: 180 GRPEEALDAYKKVLDIEGSN 199
            R E AL   K V D E SN
Sbjct: 81  -RLEMALKNMKHVNDQEQSN 99

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 118 ISKYSEAIRTLP-SNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ 176
           I K++    +LP  +A     R   Y +   + + +E  + ++K+NP+    ++RLG + 
Sbjct: 416 IKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASL 475

Query: 177 YALGRPEEALDAYKKVLDIEGS 198
               +PE+A+ AY + L+++ S
Sbjct: 476 ANSNKPEDAIQAYHRALNLKPS 497

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           Y++AI   P N + ++NRA     L  +  +++DA+ AI+++ +  K Y R
Sbjct: 36  YTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKAYHR 86

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 35/78 (44%)

Query: 129 PSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDA 188
           P  A+   N    +   K YA+A E    AI+ +P  +  YS   F    L   + +LD 
Sbjct: 10  PEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDD 69

Query: 189 YKKVLDIEGSNATDAMKR 206
            K+ ++++ +N     +R
Sbjct: 70  AKRAIELDNNNLKAYHRR 87

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 113 DFEHAISKYSEAIRTLPSNA----VYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           D++ A+S+Y +++ TLP       + ++N  AA   + +Y+++V+D + A+++ P   K 
Sbjct: 561 DYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALELFPKNDKQ 620

Query: 169 YSRL 172
           +++ 
Sbjct: 621 WTQF 624

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/103 (21%), Positives = 46/103 (44%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           +  DF+  +  +  A++  P++ + +    A+ ++  +  EA++    AI + PS+ +  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 170 SRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAM 212
             L  A   +G  +EA      VL +   +  D      DTA+
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSVKTDTAV 555

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + + ++  E+A+KVNP+    ++RLG +     R EEA+ AY + L ++ S
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 524

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 41/89 (46%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           DF+  I  +  A++  P++ + +    A+ ++  +  EA++    A+++ PS+ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 173 GFAQYALGRPEEALDAYKKVLDIEGSNAT 201
             +   +G  +EA      VL +   N  
Sbjct: 533 AVSSMNIGCFKEAAGYLLSVLSMHEVNTN 561

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D + A   Y   ++  PS+     + A  Y S   +  A E  E A++VNP  S  ++ L
Sbjct: 80  DADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYERALQVNPELSDVWATL 139

Query: 173 GFAQYALGRPEEALDAYKKVL 193
           G     L   + A +AY++ L
Sbjct: 140 GHCYLMLDDLQRAYNAYQQAL 160

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + + ++  E+A+KVNP+    ++RLG +     R EEA+ AY + L ++ S
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 41/89 (46%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           DF+  I  +  A++  P++ + +    A+ ++  +  EA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 173 GFAQYALGRPEEALDAYKKVLDIEGSNAT 201
             +   +G  +EA      VL +   N  
Sbjct: 532 AVSSMNIGCLKEAAGYLLSVLSMHEVNTN 560

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK-VNPSYSKGYSR 171
           ++  A+  Y + I   P N + ++N A +   L KY EA+E     +K VN + S+ Y +
Sbjct: 18  NYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVNDADSQVYKK 77

Query: 172 LGFAQYALGRPE 183
           L + +Y L   E
Sbjct: 78  LQY-RYNLADTE 88

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + + ++  E+A+KVNP+    ++RLG +     R EEA+ AY + L ++ S
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 523

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 40/84 (47%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           DF+  I  +  A++  P++ + +    A+ ++  +  EA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 173 GFAQYALGRPEEALDAYKKVLDIE 196
             +   +G  +EA      VL + 
Sbjct: 532 AVSSMNIGCYKEAAGYLLTVLSMH 555

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAV 152
           D+E AI  Y +A     SN +YF+N A A   L+++ EAV
Sbjct: 56  DYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAV 95

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLG 173
           +E A+  Y+ A+  L  + V+++N +A Y SL    + VE +  A+++ P YSK   R  
Sbjct: 115 YEDALKYYNYAL-DLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRA 173

Query: 174 FAQYALGRPEEAL 186
            A   L    EA+
Sbjct: 174 SANENLENFAEAM 186

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 147 KYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           ++   ++  +AA+KVNP+    ++RLG +     R EEA+ AY + L ++ S
Sbjct: 439 EFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 490

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/91 (20%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           A  +F+  I  +  A++  P++ + +    A+ ++  +  EA++    A+++ PS+ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 170 SRLGFAQYALGRPEEALDAYKKVL---DIEG 197
             L  +   +G  +EA +     L   D+EG
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEG 526

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           D + A   Y   ++  PS+A    + A  Y S   +  A E  E A+ VNP  S  ++ L
Sbjct: 65  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 124

Query: 173 GFAQYALGRPEEALDAYKKVL 193
           G     L   + A +AY++ L
Sbjct: 125 GHCYLMLDDLQRAYNAYQQAL 145

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 6/73 (8%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPS------YSK 167
           +  A+  Y + I   P N V ++N+A A   L +Y +A++  +  ++   +       SK
Sbjct: 20  YREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK 79

Query: 168 GYSRLGFAQYALG 180
              RL  AQ A+G
Sbjct: 80  LQYRLELAQGAVG 92

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 17/93 (18%)

Query: 115 EHAISKYSEAIRTLPS---------NAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSY 165
           +  I+KY +    LP            +++AN        +++ + ++    A++VNP+ 
Sbjct: 398 KQVITKYLQVANALPQVDPEVQLGLGTLFYAN--------EEFGKTIDCFRTALEVNPND 449

Query: 166 SKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
              ++RLG +     R EEA+ AY K L ++ S
Sbjct: 450 ELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/90 (21%), Positives = 42/90 (46%)

Query: 113 DFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRL 172
           DF+  I  +  A+R  P++ + +    A+ ++  +  EA++    A+++ PS+ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 173 GFAQYALGRPEEALDAYKKVLDIEGSNATD 202
             +   +G  +EA      VL +   N  +
Sbjct: 532 AVSSMNIGCFKEAAGYLLSVLSMHEVNTNN 561

>Kwal_55.21839 s55 (998426..1000498) [2073 bp, 690 aa] {ON} YOR080W
           (DIA2) - may be involved in regulation of invasive
           growth and budding pattern [contig 126] FULL
          Length = 690

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 137 NRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIE 196
           NRAA +  L    +A++DA  A+K  P   K Y R G     L   + AL  Y+     E
Sbjct: 76  NRAATWEKLGDLTKALKDANRAVKYEPYNLKCYLRKGKILQKLQLDDMALKNYE-----E 130

Query: 197 GSNATDAMKRDY 208
           G    D M+  Y
Sbjct: 131 GLQKADEMRSRY 142

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 35/57 (61%)

Query: 142 YSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + S  ++ + ++  +AA+KV+P+    ++RLG +     R EEA+ AY K L+++ S
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPS 516

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 127 TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ-YAL-GRPEE 184
           T P +A+ + + A  Y SL + +EA +    +  ++PS++  +  LGFA  YAL G  ++
Sbjct: 526 TFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQ 583

Query: 185 ALDAY 189
           AL AY
Sbjct: 584 ALTAY 588

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKG 168
           M   +FEHA+  + +A    PSN +       A+  L    +A+   E A +V PS S  
Sbjct: 644 MKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPSSSLA 703

Query: 169 YSRLGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
             +     Y++     AL+ ++++  +    AT
Sbjct: 704 KFKRAHLLYSMANYPLALECFEELTKLAPEEAT 736

>SAKL0C13772g Chr3 (1211712..1214984) [3273 bp, 1090 aa] {ON}
           similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145C CTR9 Component of the Paf1p complex which is a
           large complex that binds to and modulates the activity
           of RNA polymerase II and is required for expression of a
           subset of genes including cyclin genes contains TPR
           repeats
          Length = 1090

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 64/134 (47%), Gaps = 14/134 (10%)

Query: 127 TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPS---YSKGYSRLGFAQYALGRPE 183
           +L + AV+  N       +K+YA+A+E+ E A+K   S    S   + LG A Y+ G  E
Sbjct: 729 SLDNEAVHI-NLGHCLLEMKEYAKAIENYEIALKRFGSERNKSSLLNLLGRAWYSRGVKE 787

Query: 184 EALDAYKKVL-------DIEGSNATDAM--KRDYDTAMKKVEQSLNVERSAPAASNAESP 234
           ++L  +K+ L       +IEG      M     ++ A+ + + + ++ RS+P     E  
Sbjct: 788 KSLHCFKRSLEYAKGAIEIEGGKEHSEMLPSLKFNFALLQFQIAESLRRSSPKDRTLEDL 847

Query: 235 DAAGGSGFPDIASM 248
           + A  SG  +  S+
Sbjct: 848 EYA-TSGLNEAISL 860

>NCAS0A14770 Chr1 complement(2911657..2912559) [903 bp, 300 aa] {ON}
           Anc_7.458 YJR088C
          Length = 300

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 19/119 (15%)

Query: 109 MATKDFEHAISKYSEAIRTLPSNAVYFAN---------RAAAYSS-----LKK--YAEAV 152
           M  KDF+ AI  + E +  +P N V FA          ++ ++SS     L+K    +++
Sbjct: 175 MNLKDFDRAIYCFEEILCIMPFNYVAFAQLAESLYYKAKSMSHSSKAKVELRKEIVQKSM 234

Query: 153 EDAEAAIKVNPSYSKGYSRLGFAQYALG--RPEEALDAYKKVLDIEG-SNATDAMKRDY 208
            +A  +I+++  Y KG+S +      LG    + AL A +K+ +I   SNA D +   Y
Sbjct: 235 NNALRSIELSGLYLKGWSMVAITSQELGPKHVKIALLAKRKLQEISTVSNAKDQITAKY 293

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 137 NRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIE 196
           NRAA +  +    +A++DA  A +  P   K Y R G     L    +AL+ Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 197 GSNATDAMKRDY 208
           G  A   M R Y
Sbjct: 131 GVKAIRDMTRKY 142

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIK--VNPSYSKGYSR 171
           +  A+  Y + I   P N V ++N+A A   L +Y  A++  +  ++  + P ++   S+
Sbjct: 24  YREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALGPEHAAIRSK 83

Query: 172 LGF 174
           L +
Sbjct: 84  LQY 86

>KLTH0F19734g Chr6 (1599275..1602520) [3246 bp, 1081 aa] {ON}
           similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145C CTR9 Component of the Paf1p complex which is a
           large complex that binds to and modulates the activity
           of RNA polymerase II and is required for expression of a
           subset of genes including cyclin genes contains TPR
           repeats
          Length = 1081

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 54/128 (42%), Gaps = 18/128 (14%)

Query: 125 IRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR------LGFAQYA 178
           +R    N     N       +++YA+A+E+ E A+K    ++   SR      LG A Y+
Sbjct: 728 VRDSLDNESVHINLGHCLLEMQEYAKAIENYEIALK---KFTNEESRPLLLNLLGRAWYS 784

Query: 179 LGRPEEALDAYKKVLD---------IEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAAS 229
            G  E +L+ ++K LD          E  N+       ++ A+   + +  + RS P   
Sbjct: 785 RGIRERSLECFEKSLDYAQQALTAETEKKNSKMVQSVKFNVALLHFQIAETLRRSVPKLR 844

Query: 230 NAESPDAA 237
             +  +AA
Sbjct: 845 TVDKLEAA 852

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD E +I  +  + +  PS    +  +   YSS   +  A+     A+  NP +   +  
Sbjct: 423 KDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQHYNAHYG 482

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSN 199
           LG     LG+ EE L  ++K   I   N
Sbjct: 483 LGMCCLKLGQYEECLLHFEKARSINPVN 510

>TPHA0C04470 Chr3 complement(967705..968061) [357 bp, 118 aa] {ON}
           Anc_7.190 YFR033C
          Length = 118

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 2   NPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60
            P  +EL    +D + R  + KE   DY DSL+   DCV E F ++  S S +  + F 
Sbjct: 59  TPEGQELHKHYLDCVARVEKAKE-SPDY-DSLDYKEDCVEEFFHLQHYSDSQIAPRLFS 115

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 134 YFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL----DAY 189
           +F      Y     YA A++  E  I++NP    GYS    A     + +EA+    D  
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

Query: 190 KKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVE 222
           K+V   + ++ T   K +Y   +   E++LN E
Sbjct: 65  KRVSKNDATHETIQKKLEYRLEL--AEKALNKE 95

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 139 AAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVL 193
           A  Y S   + +A E  E A++VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 89  AHLYRSRDMFQKAAELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 143

>Smik_11.232 Chr11 complement(381701..384082) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 4/65 (6%)

Query: 127 TLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ-YAL-GRPEE 184
           T P +A+ + + A  Y  L + +EA +    +  ++PS++  +  LGFA  YAL G  ++
Sbjct: 479 TFPKSAITWFSVATYYMCLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQ 536

Query: 185 ALDAY 189
           AL AY
Sbjct: 537 ALTAY 541

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLK--KYAEAVEDAEAAIKVNPSYSKGYSR 171
           F++A   Y +A+   P++  Y A+     S +K  +Y EA+   E A  +NP        
Sbjct: 488 FDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCC 545

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKR 206
            G A   LGR E+ALD Y+   +++ +++    K+
Sbjct: 546 CGVALERLGRREKALDFYQLACELQPNSSLALFKK 580

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 26/48 (54%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKV 161
           +  AIS Y+  I   PSN + ++N+A A     ++ EA+   E  +++
Sbjct: 19  YSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 1/91 (1%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           A K+   A++ + + +   PSN+     +   +   + + EA +     IK  P   +  
Sbjct: 462 APKNHNAALALFDKLLSENPSNSKAKMGKGLIFIERENWGEANKLLSEVIKEFPDNCEVT 521

Query: 170 SRLGFAQYALGRPEEALDAYKKVL-DIEGSN 199
           S LG+++  LG P+ A++ +K VL ++EG++
Sbjct: 522 SELGWSELHLGDPDSAIEKFKYVLNNVEGTD 552

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + + ++  + A++VNP+    ++RLG A     R EE++ AY + L ++ S
Sbjct: 462 FNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPS 512

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLK--KYAEAVEDAEAAIKVNPSYSKGYSR 171
           F++A   Y +A+   P++  Y A+     S +K  +Y EA+   E A  +NP        
Sbjct: 507 FDNAKMCYRKALAINPNH--YNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVILNCC 564

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKR 206
            G A   LGR E+ALD Y+   +++ +++    K+
Sbjct: 565 CGVALERLGRREKALDFYQLACELQPNSSLALFKK 599

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%)

Query: 142 YSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           + S  ++ + ++  + A+ ++P     ++RLG +     RPEEA+ AY K L ++ S
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPS 497

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 147 KYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMK 205
           K +EA    EAA++ +PS+   + +LG  Q    +    + A +K L ++  N  DAMK
Sbjct: 306 KLSEAALSFEAALQDDPSHVDAWLKLGLVQIQNEKEIHGISALEKCLQLDPKN-LDAMK 363

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 44/86 (51%)

Query: 111 TKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYS 170
            +++E A+  Y  A +  P++A+    +A    SL +Y+ AVE  E  IK++      + 
Sbjct: 609 VRNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHY 668

Query: 171 RLGFAQYALGRPEEALDAYKKVLDIE 196
            LG     +GR ++A+  Y   ++++
Sbjct: 669 MLGKIYQTMGRKKDAVKEYTVAMNLD 694

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDI 195
           Y + V+   AA+ V P     ++RLG +     R EEA+ AY+K L +
Sbjct: 442 YDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 489

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 147 KYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           ++ + ++  +AA+ VNP+    ++RLG +     R EEA+ AY K L ++ S
Sbjct: 411 EFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPS 462

>Suva_11.204 Chr11 complement(378512..380893) [2382 bp, 793 aa] {ON}
           YKL022C (REAL)
          Length = 793

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 4/64 (6%)

Query: 128 LPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ-YAL-GRPEEA 185
            P +A+ + + A  Y SL + +EA +    +  ++PS++  +  LGFA  YAL G  ++A
Sbjct: 476 FPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQA 533

Query: 186 LDAY 189
           L AY
Sbjct: 534 LTAY 537

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 114 FEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKV--NPSY----SK 167
           +  AI  Y   I   P N V  +N+A A   L ++A+A+E  +  +++  +P +    +K
Sbjct: 20  YRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQLAASPQHAALRAK 79

Query: 168 GYSRLGFAQYAL 179
              RL  AQ A+
Sbjct: 80  LLYRLQLAQAAV 91

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD E AI  + +A +  P+ A  +  +   +SS   +  A      A+  +P +   Y  
Sbjct: 549 KDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYG 608

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNA 200
           LG +   LG+ +EAL  ++K   I   N 
Sbjct: 609 LGMSCMKLGQYDEALLHFEKARSINPINV 637

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 36/88 (40%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           KD E +I  +  + +  PS    +  +   YSS   +  A+     A+  N  +   Y  
Sbjct: 424 KDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQHYNAYYG 483

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSN 199
           LG     LG+ EE L  ++K   I   N
Sbjct: 484 LGMCSLKLGQYEECLLHFEKARSINPVN 511

>Skud_11.206 Chr11 complement(375601..378009) [2409 bp, 802 aa] {ON}
           YKL022C (REAL)
          Length = 802

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 128 LPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQ-YAL-GRPEEA 185
            P +A+ + + A  Y SL +  EA +    +  ++PS++  +  LGFA  YAL G  ++A
Sbjct: 485 FPKSAITWFSVATYYMSLDRICEAQKYYSKSSILDPSFAAAW--LGFAHTYALEGEQDQA 542

Query: 186 LDAY 189
           L AY
Sbjct: 543 LTAY 546

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDI 195
           Y + V+   AA+ V P     ++RLG +     R EEA+ AY+K L +
Sbjct: 435 YDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQL 482

>KLLA0E22705g Chr5 complement(2027229..2028398) [1170 bp, 389 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 389

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 24/102 (23%)

Query: 112 KDFEHAISKYSEAIR-------------------TLPSNAVYFANRAAAYSSLKKYAEAV 152
           +DF +A+ KY +A++                   T+  + +Y  N       LK+Y E++
Sbjct: 250 RDFRNALFKYKKALKYTTAYTPEVDIDKFHNEKFTIQKHKLYL-NICLMLFYLKEYHESI 308

Query: 153 EDAEAAI---KV-NPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           + +   +   +V N   +K Y R G   YAL R E AL  YK
Sbjct: 309 KYSTFLVDDDRVGNKDKAKAYLRRGNCLYALNRFEAALTDYK 350

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           Y + ++  + A+ VNP+    ++RLG +     R EEA+ AY + L ++ S
Sbjct: 509 YDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPS 559

>Ecym_2820 Chr2 (1590180..1594376) [4197 bp, 1398 aa] {ON} similar
           to Ashbya gossypii AEL281C
          Length = 1398

 Score = 31.6 bits (70), Expect = 3.8,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 38/85 (44%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           A K    A+S + + +   P N+     +   Y    ++  A +     +   P+  +  
Sbjct: 453 APKHHSTALSLFDKLLEDDPGNSKAKLGKGLIYIERSQWQGAHDLLSDVVYKYPNNYEAL 512

Query: 170 SRLGFAQYALGRPEEALDAYKKVLD 194
           S LG++Q  LG P+ A++ +  VL+
Sbjct: 513 SELGWSQLHLGNPDNAIETFNSVLE 537

>TDEL0B07600 Chr2 (1331773..1334031) [2259 bp, 752 aa] {ON}
           Anc_2.665 YKL022C
          Length = 752

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%)

Query: 137 NRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIE 196
           N A AY  L +   A++  ++ +KV+   S  Y  LGF      + ++A+D +   L + 
Sbjct: 612 NLAHAYRRLGENERAIKCFKSVLKVSNKSSDTYCSLGFLYLKTKQLQKAIDHFHTALALR 671

Query: 197 GSNA 200
            SN+
Sbjct: 672 PSNS 675

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 59/130 (45%), Gaps = 8/130 (6%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY-- 169
           K+ E A+S + + +   PSN      +   Y   + + EA E     + V+  Y+  +  
Sbjct: 464 KNHEAALSLFDKVLLEQPSNTEAKLGKGFIYMERENWTEAYE---LLLAVSSKYADRWDV 520

Query: 170 -SRLGFAQYALGRPEEALDAYKKVL-DIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPA 227
            S +G+ +  LG+ E+A+  +K+VL +I G +      R  +   +  E  LN++ S   
Sbjct: 521 LSEIGWCRVMLGQCEQAILDFKEVLKNIHGMDLRTQEFRALNY-WRLAETYLNIQESEHV 579

Query: 228 ASNAESPDAA 237
           +   E+   A
Sbjct: 580 SEGFENVKLA 589

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 36/61 (59%)

Query: 140 AAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSN 199
            AY   ++ AE+++  + A++++P+  + +  LG +    GR E +L  +++ LD++  +
Sbjct: 687 VAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHH 746

Query: 200 A 200
           +
Sbjct: 747 S 747

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 37/90 (41%)

Query: 112 KDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSR 171
           K+   AI  + +A +  P  A  +  +   Y+S   +  A      AI  +P +   Y  
Sbjct: 542 KNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYG 601

Query: 172 LGFAQYALGRPEEALDAYKKVLDIEGSNAT 201
           LG     LG+ EEAL  ++K   I   N  
Sbjct: 602 LGMVSMKLGQYEEALLFFEKARSINPINVV 631

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 139 AAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVL 193
           A  Y S   + +A E  E A+ VNP  S  ++ LG     L   ++A +AY++ L
Sbjct: 67  AHLYRSRDMFQKAAELYEKALAVNPELSDVWATLGHCYLMLDDLQKAYNAYQQAL 121

>SAKL0D11110g Chr4 (920630..921928) [1299 bp, 432 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 432

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 22/101 (21%)

Query: 112 KDFEHAISKYSEAIRT----LPSNAV--------------YFANRAAAYSSLKKYAEAVE 153
           KDF+ A  KY +A+R     +P   V               + N +    +LKKY  A+ 
Sbjct: 293 KDFQDAFFKYRKALRYVNEYIPDMDVDEELSVKFAELKMKLYLNISLVLFNLKKYDSAIT 352

Query: 154 DAEAAIKVN--PSY--SKGYSRLGFAQYALGRPEEALDAYK 190
            A   +++   P+   +K Y R G    A  R EEAL  YK
Sbjct: 353 HATYLLEMEKVPTLDKAKAYYRRGNCYLAKNRLEEALKDYK 393

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 139 AAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVL 193
           A  Y S   +  A E  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 95  AHLYRSRDMFQRAAELYERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 149

>AER290C Chr5 complement(1170367..1171038) [672 bp, 223 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML106W
           (URA5) and YMR271C (URA10)
          Length = 223

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%)

Query: 30  IDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQSLEQIVGASSKGPTATQQEPVKVNIPV 89
           ID +  A   + EAFE+ K +   V+         E +   S +G TATQ    + +IPV
Sbjct: 130 IDDVMTAGTAINEAFEIIKTAGGKVVGTIIALDRQEIVDTTSKEGLTATQSVSKRYDIPV 189

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 3/30 (10%)

Query: 298 SGGGTPSMAD---LMNNPALMDMAKNMFGG 324
           SGGG P+M D   +M +P++ +MAK   GG
Sbjct: 500 SGGGMPNMQDIMGMMQDPSMQEMAKQFSGG 529

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%)

Query: 137 NRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYK 190
           N AA +  L     A+  ++  +++ P   K Y R G     LG+ +EA D Y+
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKLGKDKEAYDNYR 125

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 148 YAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGS 198
           Y + ++  +AA+ V P     ++RLG +     R EEA+ AY + L ++ S
Sbjct: 438 YDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPS 488

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 110 ATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGY 169
           A +DF+  I  +  A+   P +   +    A+ ++  +  EA++    AI++ P++ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 170 SRLGFAQYALGRPEEALDAYKKVL---DIEG------------SNATDAMKRDYDTAMKK 214
             L  +   +G   EA +     L   ++EG            SN  + +KR +  AM +
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAF-IAMDR 547

Query: 215 VEQSLNVERSAP 226
            +    +ER  P
Sbjct: 548 RDL---LERVVP 556

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 139 AAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVL 193
           A  Y S   +  A E  E A+ VNP  S  ++ LG     L   + A +AY++ L
Sbjct: 104 ANLYRSRDMFQRAAELYERALSVNPELSDVWATLGHCYLMLDDLQRAYNAYQQAL 158

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 22/101 (21%)

Query: 112 KDFEHAISKYSEAIRT------------------LPSNAVYFANRAAAYSSLKKYAEAVE 153
           KDF++A+ KY +A+R                   +   A  + N +    +LK+Y EA+ 
Sbjct: 256 KDFQNALFKYKKALRYVNEFIPEIEVDEAYNKKFIELKAKLYLNLSLVMFNLKRYEEAIT 315

Query: 154 DAEAAIKVNPSYS----KGYSRLGFAQYALGRPEEALDAYK 190
                +++  + S    K Y R G   +A  R ++AL  +K
Sbjct: 316 YTTYLLEIPEASSIDKAKAYYRSGNCHFAKKRYDKALSDFK 356

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,641,137
Number of extensions: 893930
Number of successful extensions: 2984
Number of sequences better than 10.0: 217
Number of HSP's gapped: 2933
Number of HSP's successfully gapped: 320
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)