Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11176g6.22ON53653627650.0
Kwal_56.224376.22ON53653523110.0
SAKL0E01364g6.22ON54153120610.0
KLLA0D01221g6.22ON56653319960.0
Kpol_1037.276.22ON54652919620.0
KAFR0A050706.22ON56453019560.0
TBLA0G009706.22ON55954319460.0
Ecym_30276.22ON54953519360.0
Suva_15.1776.22ON54453119290.0
TDEL0G044706.22ON54253619290.0
CAGL0E02629g6.22ON54852919280.0
ZYRO0C07744g6.22ON54752919240.0
NCAS0D021606.22ON56353919180.0
KNAG0F028906.22ON56352919180.0
Smik_15.1716.22ON54453119140.0
TPHA0J003506.22ON55953119140.0
Skud_15.1636.22ON54453119110.0
YOR002W (ALG6)6.22ON54453119020.0
ACR004W6.22ON56353519040.0
NDAI0C026306.22ON58053318800.0
TPHA0J013805.669ON5753742961e-27
TBLA0A093105.669ON5463602942e-27
ZYRO0A11506g5.669ON5563742924e-27
CAGL0L10450g5.669ON5503732754e-25
YOR067C (ALG8)5.669ON5773752747e-25
Kwal_55.217425.669ON5554192721e-24
KLTH0F17666g5.669ON5554202702e-24
KLLA0F16621g5.669ON5612602668e-24
Kpol_1018.735.669ON6212652651e-23
NDAI0F005105.669ON5703812641e-23
KAFR0D024405.669ON5753732622e-23
Smik_15.2475.669ON5773742605e-23
NCAS0G004505.669ON5703762596e-23
TDEL0B025405.669ON5692832579e-23
Suva_8.1185.669ON5762662561e-22
SAKL0G00836g5.669ON5613732561e-22
Skud_15.2345.669ON5773742562e-22
ADR210C5.669ON5722632552e-22
KNAG0L019205.669ON5684172392e-20
Ecym_40515.669ON6043762303e-19
CAGL0J03432g2.284ON62267732.3
TBLA0D011908.717ON43143714.1
NCAS0H013906.123ON816108706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11176g
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...  1069   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   894   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   798   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   773   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   760   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   758   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   754   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   750   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   747   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   747   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   747   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   745   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   743   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   743   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   741   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   741   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   740   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   737   0.0  
ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...   738   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   728   0.0  
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   118   1e-27
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   117   2e-27
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   117   4e-27
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   110   4e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   110   7e-25
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   109   1e-24
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   108   2e-24
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   107   8e-24
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   106   1e-23
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   106   1e-23
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   105   2e-23
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   104   5e-23
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   104   6e-23
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   103   9e-23
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   103   1e-22
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   103   1e-22
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   103   2e-22
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   102   2e-22
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    97   2e-20
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    93   3e-19
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    33   2.3  
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    32   4.1  
NCAS0H01390 Chr8 complement(265088..267538) [2451 bp, 816 aa] {O...    32   6.4  

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/536 (97%), Positives = 524/536 (97%)

Query: 1   MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVP 60
           MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVP
Sbjct: 1   MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVP 60

Query: 61  MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL 120
           MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL
Sbjct: 61  MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL 120

Query: 121 GSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180
           GSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP
Sbjct: 121 GSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180

Query: 181 SLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYL 240
           SLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYL
Sbjct: 181 SLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYL 240

Query: 241 LSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDK 300
           LSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDK
Sbjct: 241 LSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDK 300

Query: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360
           VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM
Sbjct: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360

Query: 361 AFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420
           AFFLFGFQVHEK            FCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY
Sbjct: 361 AFFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420

Query: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480
           GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI
Sbjct: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480

Query: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL
Sbjct: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/535 (80%), Positives = 471/535 (88%)

Query: 1   MDARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVP 60
           M  +K    E FFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGE + P
Sbjct: 1   MAGKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGP 60

Query: 61  MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL 120
           +HGDFEAQRHWMELT +LPLSQWYW+DLQYWGLDYPPLTAYHSY LGKLGS+LN EWFAL
Sbjct: 61  IHGDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFAL 120

Query: 121 GSSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180
            SSRG E P++KAYMRFTVILSEA LYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP
Sbjct: 121 LSSRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQP 180

Query: 181 SLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYL 240
           SLILIDHGHFQYNSVMLGLTVY+INNLLDG++GPAAICF+LSLCFKQMAL+YSP+FFAYL
Sbjct: 181 SLILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYL 240

Query: 241 LSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDK 300
           LS  L SPS    RF+SVA STVI+FC++FSPLYVFGG KNVLQSIHRIFPFSRGIFEDK
Sbjct: 241 LSECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDK 300

Query: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360
           VANFWCVSNV+ KYA N+TQ +LQ+ S  ATAAGFLPSF +V+ YPKKHMIP+ LAACSM
Sbjct: 301 VANFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSM 360

Query: 361 AFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420
           AFFLF FQVHEK            +CSTDWNVL++VSWINNVALFTLWPLLKKD L LQY
Sbjct: 361 AFFLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQY 420

Query: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480
           GI+MLLSNWLIGNFSFVTPRFLP FITPGPS+S V+ETYRRRSFLP+N  WK++I+ SY+
Sbjct: 421 GILMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYL 480

Query: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILD 535
           +MA IHILD FV  P  LPDLWVL+NCALGF CF++FWLW +YKLFTMRN ++ D
Sbjct: 481 IMAAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/531 (71%), Positives = 445/531 (83%)

Query: 5   KSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGD 64
           + + KESFFASPL+DFLSPFRPVANQ+ A+Y+IV+FAL+IRC VGLGSFSG    PMHGD
Sbjct: 10  RKIVKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGD 69

Query: 65  FEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSR 124
           FEAQRHWMELTTNLPLSQWYW+DL YWGLDYPPLTAYHSY LGKLG + +P WF LG SR
Sbjct: 70  FEAQRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSR 129

Query: 125 GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184
           G E+ +LK+YMRFTV+LSE  LYIP V+YF KW G  R Q+PIGQYIAAAAILFQPSLIL
Sbjct: 130 GQESMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLIL 189

Query: 185 IDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRS 244
           IDHGHFQYNSVMLGLTVYAINNLLD ++ PAAICF+LS+CFKQMAL+Y+PIFF+YLLS+S
Sbjct: 190 IDHGHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKS 249

Query: 245 LFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANF 304
           LFSP F   R ++VA +T+I+F  MF PLY++GG++NVLQSIHRIFPFSRGIFEDKVANF
Sbjct: 250 LFSPLFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANF 309

Query: 305 WCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFL 364
           WC SN+ +KY   +TQ QLQ  S  ATA GFLP+F L+  YPKKH+IPY L ACSM+FFL
Sbjct: 310 WCFSNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFL 369

Query: 365 FGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMM 424
           F FQVHEK            + STDWNVL++VSWINN+A FTLWPLLKKD L LQY  ++
Sbjct: 370 FSFQVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLL 429

Query: 425 LLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAV 484
           LLSNWLIGNFSFVTPRFLP F+TPGPS S+V+E YRRRS LP+NI WK++I+ SYI M +
Sbjct: 430 LLSNWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGI 489

Query: 485 IHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILD 535
           +H+LD +VQPPAK PDLWVL+NC+LGF  F +FW+WN YK+FT+RNK++ D
Sbjct: 490 LHLLDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/533 (67%), Positives = 427/533 (80%)

Query: 4   RKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHG 63
           +K    E+FFASP+YDFL+PFRPV NQ+ A+YVIVIFAL+IRCAVGLG +SG  T PM G
Sbjct: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSS 123
           DFEAQRHWME+T +LP+ +WYW+DLQYWGLDYPPLTAYHSY LGKLGS     WF L SS
Sbjct: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153

Query: 124 RGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLI 183
           RG E+  LK+YMRFTVI+SE  LYIPAV+YFTKW G  R QSPIGQYIAAAAILFQP+LI
Sbjct: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213

Query: 184 LIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSR 243
           L+DHGHFQYN VMLG+TVY +NNLLDGF+   AICF+LSLCFKQMAL+YSPIFFAYLLS+
Sbjct: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273

Query: 244 SLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVAN 303
           S +SP     R  ++++ST + F   F P+Y+FGG KN++QS+HRIFPF+RGIFEDKVAN
Sbjct: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333

Query: 304 FWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFF 363
           FWCVSN+ +KY + FTQ  LQ  S  AT  G LPSF +  LYPK+H++PY LAACSM+FF
Sbjct: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393

Query: 364 LFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIM 423
           LF FQVHEK            + S DWNVL++V WINNVALFTLWPLLKKD L LQYG+M
Sbjct: 394 LFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453

Query: 424 MLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMA 483
            + SNWLIGNFSFVTPRFLP F+TPGPS+S++   YRR S LP +++W+++I+ SYI M 
Sbjct: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513

Query: 484 VIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           +IH LD +V PP+K PDLWVL NC+LGF+CF  FW+WNNYKLF MRN ++ DL
Sbjct: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/529 (67%), Positives = 431/529 (81%), Gaps = 4/529 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESFFASPLYDFLSPFRPV+NQ+  EY+IVIFAL++RCA+GLGS+SG    PM GDFEAQ
Sbjct: 15  EESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYSGMGNPPMFGDFEAQ 74

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRG--N 126
           RHWME+T +LP+S+WY+FDL+YWGLDYPPLTAYHSY LG +GS LN  WFAL  SRG  +
Sbjct: 75  RHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLNKSWFALNDSRGYES 134

Query: 127 ETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
           E  +LK YMR TVI+SE   YIP V+YFTKW G  R+QS IGQYIAAAAILFQPSL+LID
Sbjct: 135 ENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIAAAAILFQPSLMLID 194

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLTVYAINNLLD F+ PAA+CF+LS+CFKQMAL+Y+PIFF YLL RSLF
Sbjct: 195 HGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYYAPIFFGYLLGRSLF 254

Query: 247 SPSF-KFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANF 304
           S  F   SRF+S+A+STV  F  M++PLYVFGG ++NV+QS+HRIFPF+RG+FEDKVANF
Sbjct: 255 SRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIFPFARGLFEDKVANF 314

Query: 305 WCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFL 364
           WCV+N+ +KY   +TQ +LQ  S  AT  GFLP+   ++ YPKKH++PY LAACSM+F+L
Sbjct: 315 WCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHLLPYALAACSMSFYL 374

Query: 365 FGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMM 424
           F FQVHEK            + STDWNVL+ VSW+NNV LFTLWPLLKKD L LQYG+  
Sbjct: 375 FSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPLLKKDGLTLQYGVCF 434

Query: 425 LLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAV 484
            LSNWLIGNFSF+TP+FLP  +TPGP + N  +TY RRS LP+NI+WKI+I++SYIVM +
Sbjct: 435 FLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNILWKIIIVSSYIVMLL 494

Query: 485 IHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533
           IH+ ++FV PP + PD+WVLMNC LGF CF +FWLWN YK+FT+ NK++
Sbjct: 495 IHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLANKTL 543

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/530 (65%), Positives = 427/530 (80%), Gaps = 2/530 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +E F+ASPLYDFL PFRP  NQ+ A+Y+IV FAL+IRCA+GLGS+SG    PM GDFEAQ
Sbjct: 35  EEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGLGSYSGMGHSPMFGDFEAQ 94

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LP+S+WYWFDLQYWGLDYPPLTAYHSY LGK+GS + P+WF L  SRG E 
Sbjct: 95  RHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIGSFIYPKWFTLNDSRGIEM 154

Query: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
             +K+YMR TV++SEA  Y PA++YF+KWFG  R QSPIGQYIAA AILFQPSL+LIDHG
Sbjct: 155 EGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQYIAATAILFQPSLMLIDHG 214

Query: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248
           HFQYNSVMLGLTVYAINNLLD F+  A++CF+LS+CFKQM+L+Y+PIFF YLLS+SLF P
Sbjct: 215 HFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSLYYAPIFFGYLLSKSLFFP 274

Query: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVF-GGMKNVLQSIHRIFPFSRGIFEDKVANFWC 306
             F   R + +A  T++TF  M+SPLY+F GG++N++QS+HRIFPF+RGIFEDKVANFWC
Sbjct: 275 RLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHRIFPFARGIFEDKVANFWC 334

Query: 307 VSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFG 366
           V+N+++KY   FTQDQLQ  S  AT  GFLP+  ++VLYPKKH++PY LAACSM+FFLF 
Sbjct: 335 VTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKKHLLPYALAACSMSFFLFS 394

Query: 367 FQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLL 426
           FQVHEK            + STDWNVL++V WINNVALFTLWPLLKKD L LQY +   L
Sbjct: 395 FQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLWPLLKKDGLILQYAVCFAL 454

Query: 427 SNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIH 486
           SNWL+GNFSFVTP+FLP  +TPGPS+S + E Y RRS LP+NI+WK++I++SY+ MAV H
Sbjct: 455 SNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHNILWKVVIVSSYLSMAVFH 514

Query: 487 ILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
            LD FV+PP   PD+W+ +NC +GF  F  FW+W  Y LFT+RNK+++DL
Sbjct: 515 YLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTLRNKTLMDL 564

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/543 (67%), Positives = 438/543 (80%), Gaps = 15/543 (2%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +E+F+ASPL+DFL PFRPV +Q+  EYVI+IFA++IRCA+ LGS+SG+ T PM GDFEAQ
Sbjct: 17  EEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDFEAQ 76

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LP+S+WYWFDLQYWGLDYPP TAYHSY  GKLGS  NP+WFAL SSRG E+
Sbjct: 77  RHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRGYES 136

Query: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
            +  LK YMRFTVILSEA  YIPAV+YFTKW G  R QSPIGQ+IAAAAILFQPSL+LID
Sbjct: 137 DDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLMLID 196

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLTVYAINNLLD F+GPAAICF+LSLCFKQMAL+YSPIFF YLLS+SL 
Sbjct: 197 HGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSKSLV 256

Query: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFG-------------GMKNVLQSIHRIFPFS 293
            PS   SRF+ VA+STV++F +MF P+Y+FG             G+ N++Q I RIFPF+
Sbjct: 257 HPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIFPFA 316

Query: 294 RGIFEDKVANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPY 353
           RGIFEDKVANFWCV+NV++KY + FTQ+QLQ  S  AT  GFLPS   + LYP+K +IPY
Sbjct: 317 RGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFLIPY 376

Query: 354 GLAACSMAFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKK 413
            LAACSM+FFLF FQVHEK            + STDWNVL++V WINNVALFTLWPLL+K
Sbjct: 377 ALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPLLRK 436

Query: 414 DKLALQYGIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKI 473
           D L LQY +   LSNWLIGNFSF+TP+FLP F+TPGPS+SN+ + YRR S LP+NI+WKI
Sbjct: 437 DGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNILWKI 496

Query: 474 LIITSYIVMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533
           +II+SYIVM  + ILDLF QPP   PDLW+++NC +GF CF +FWLWNNYK+  MRNK++
Sbjct: 497 IIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRNKTL 556

Query: 534 LDL 536
            DL
Sbjct: 557 NDL 559

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/535 (65%), Positives = 430/535 (80%)

Query: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61
           D R+S  +ESFFASPLYDFL P RPVANQ+ A+Y+I+IFAL++R AVGLG +SG+   P+
Sbjct: 15  DTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGLGGYSGKGKGPL 74

Query: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121
            GDFEAQRHWME+TT LP+S+WY++DL+YWGLDYPPLTAYHSY LG+LGS +N  WF L 
Sbjct: 75  FGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLGSFVNATWFKLN 134

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           +SRG E+ +LK++MR TV+LSE   YIPAV+YFT+W G  R QSPIGQY+A AAILFQPS
Sbjct: 135 TSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQYVACAAILFQPS 194

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
           LILIDHGHFQYN VMLGL VY INNLLD F+G AAICF+LSL FKQMAL+YSP+ FAYL 
Sbjct: 195 LILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMALYYSPVIFAYLF 254

Query: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKV 301
           SRS + P F F RF  +A++T++TF  +++PL +FG  +N++QS++R+FPFSRGIFEDKV
Sbjct: 255 SRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVFPFSRGIFEDKV 314

Query: 302 ANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMA 361
           ANFWCV+NVI+KY + +TQ QLQ      TA    P+F ++ LYPKK ++PY LAACSMA
Sbjct: 315 ANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFLLPYALAACSMA 374

Query: 362 FFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYG 421
           FFLF FQVHEK              ST+W+VL++V+WINNVALFTLWPLLKKD L LQY 
Sbjct: 375 FFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPLLKKDGLLLQYA 434

Query: 422 IMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIV 481
           IM LLSNWL+GNFSFVTP FLP F+TPGPS+S+VA+ YRRRS LP NI W+I+I++SY+ 
Sbjct: 435 IMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIFWRIIIVSSYVC 494

Query: 482 MAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           MA IH+LDL+VQPP   PD+WVL  CALGF CF+ FWLWN Y+L+ MRN S+ +L
Sbjct: 495 MAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRNSSLNEL 549

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/531 (66%), Positives = 425/531 (80%), Gaps = 3/531 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG+AT P+HGDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLHGDFEAQ 73

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HSY LG +G+  NP WFAL  SRG E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDKSRGFES 133

Query: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSLF
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLF 253

Query: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305
            P F  +R   +A +T+ TF LMF+PLY  GG ++N+ Q IHR+FPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFEDKVANFW 313

Query: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365
           CVSN+ VKY + F+  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 314 CVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 366 GFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD L LQY +  L
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYVVSFL 433

Query: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485
           L+NWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M + 
Sbjct: 434 LTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           H LDLFV PP K PDLWVL+NCA+GF CFS+FW+W+ YK+FT  NKS+ DL
Sbjct: 494 HFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/536 (64%), Positives = 434/536 (80%), Gaps = 1/536 (0%)

Query: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61
           +A+++  +ESF+ASPLYDFL PFRP  +Q+  EYVIV+FAL+I CAVG GS+SG+ + PM
Sbjct: 7   EAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPM 66

Query: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121
            GDFEAQRHWME+T +L  SQWYWFDL+YWGLDYPPLTAYHSY LGK+GS + PEWF L 
Sbjct: 67  FGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELN 126

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
            SRG ETP+LK +MRFTV+LSE   YIPAV+YFTKW G  R++SPIGQ+I+AAAILFQPS
Sbjct: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
           L+LIDHGHFQYN VMLGLTVYAIN+L + F+  AAICF+LS+CFKQMAL+Y+PIFFAYLL
Sbjct: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246

Query: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVF-GGMKNVLQSIHRIFPFSRGIFEDK 300
           S+SLFSP F F R  ++A++TV++F  M++PLY+F GG+ NV+QS+HRIFPF+RGIFEDK
Sbjct: 247 SKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDK 306

Query: 301 VANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSM 360
           VANFWCV+NV  KY + F Q+QLQ  S  AT  GFLP+  ++ LYPKKH+I Y LA CSM
Sbjct: 307 VANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSM 366

Query: 361 AFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQY 420
           +F+LF FQVHEK            + S++W+VL++ +WINNV LFTL+PLLKKD L LQY
Sbjct: 367 SFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQY 426

Query: 421 GIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYI 480
            +   LSNWL+GNFSFVTP+FLP F+TPGPS+S+V   YRRRSFLP+N++WKI+I++SY 
Sbjct: 427 FVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYT 486

Query: 481 VMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
            M V+H++D  + PP   PDLWVL+NCALGF CF++FWLW+ Y LFTM  K++  L
Sbjct: 487 AMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/529 (65%), Positives = 428/529 (80%), Gaps = 1/529 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASPLYDFL PFRP  +Q+  E++I++FA++IRCA+GLG +SG    PMHGDFEAQ
Sbjct: 20  EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGLGPYSGYKDGPMHGDFEAQ 79

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LP+S+WY++DL+YWGLDYPPLTA+HSY LGKLG+  NP+WFAL SSRG ET
Sbjct: 80  RHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLGTFCNPDWFALDSSRGIET 139

Query: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
             LK YMRFTV+LSEA  Y+PAV+YFTKW G +R QSPIGQ+IAAAAILFQPSL+LIDHG
Sbjct: 140 QGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQFIAAAAILFQPSLMLIDHG 199

Query: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248
           HFQYNS+MLG TVYAINNLLD F+ PAAICF+LS+CFKQM+L+Y+PIFFAYLL RS+F P
Sbjct: 200 HFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSLYYAPIFFAYLLGRSMFFP 259

Query: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307
             F   RF+S++++T++TF  MFSP Y+FGG+  + Q++ RIFPF+RGIFEDKVANFWCV
Sbjct: 260 KLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRIFPFARGIFEDKVANFWCV 319

Query: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367
            N IVK+   FT DQL+  S   T  GF P+  L++LYP+KH++PY LAACSM+F+LF F
Sbjct: 320 VNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKHLLPYALAACSMSFYLFSF 379

Query: 368 QVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427
           QVHEK            F S DWNVL++VSWINNVALFTLWPLLK++ L LQY +   LS
Sbjct: 380 QVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWPLLKREGLYLQYFVCFFLS 439

Query: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487
           NWLIGNFSF+TPRFLP FITPGPS+S+V++ YRRRS LP++I WK++I++SYI M   H 
Sbjct: 440 NWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSIFWKLIIVSSYIGMTAYHF 499

Query: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           LDLF++ P + PDLWV++NC +GF  FS+FWLW  YK  T+  K+I DL
Sbjct: 500 LDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLLKKNIQDL 548

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/529 (66%), Positives = 431/529 (81%), Gaps = 1/529 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASPLYDFL PF+PV +Q+  EY+I++FA++IRCA+GLG +SG++  PMHGDFEAQ
Sbjct: 19  EESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIGLGPYSGQSVKPMHGDFEAQ 78

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHW+E+T +LP+SQWY+FDL+YWGLDYPPLTAYHSY LGKLGS++NP+WFAL  SRG E+
Sbjct: 79  RHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKLGSLINPDWFALNVSRGLES 138

Query: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
            +LK YMRFTVILSE   YIPAV+YFTKW G  R  SP+GQ+IAAAAILFQP+L+LIDHG
Sbjct: 139 NDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQFIAAAAILFQPALMLIDHG 198

Query: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248
           HFQYN VMLG TVYAIN+L+D F+ PAA CF+LS+CFKQMAL+YSPIFFAYLL R +F  
Sbjct: 199 HFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMALYYSPIFFAYLLGRCVFKT 258

Query: 249 SFKFSRFMSVALSTVITFCLMFSPLYVFG-GMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307
             +F RF+S+A++T+ TF +M+ PLY+ G G +NVLQS+HRIFPF+RGIFEDKVANFWCV
Sbjct: 259 GIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHRIFPFARGIFEDKVANFWCV 318

Query: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367
           +N+ VKY   FTQ QLQ  S  ATA GFLP+  LV+LYPKKH++P+ LAACSM+FFLF F
Sbjct: 319 TNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKKHLVPFALAACSMSFFLFSF 378

Query: 368 QVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427
           QVHEK            + ST+W+VL++VSWINNV LFTLWPLLKKD LALQY +     
Sbjct: 379 QVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLWPLLKKDGLALQYCVCFAFC 438

Query: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487
           NWLIGNFSFVTP FLP F+TPGPS+S+V   YRRRS LP +I+WK++I+ SYI M  IH+
Sbjct: 439 NWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKSIIWKLIIVGSYISMGAIHV 498

Query: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           LD+FV PP   PDLWV++NC LGF CF +FWLWN YKLF++  +S+  L
Sbjct: 499 LDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSLAGQSLQQL 547

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/539 (65%), Positives = 419/539 (77%), Gaps = 4/539 (0%)

Query: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61
             +  +P+ESF+ASPLYD L PFRP  +Q+  EY IV+F+L+IRCAVGLG FSG    PM
Sbjct: 25  SKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGLGPFSGYGVPPM 84

Query: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121
            GDFEAQRHWME+T +LP+ +WYWFDL+YWGLDYPPLTAYHSY  GK+GS  NP WFAL 
Sbjct: 85  FGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIGSFFNPNWFALD 144

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           SSRG E  +LK +MR TV++SEA  YIP V+YF KW G  RRQSPIGQ+IAAAAIL QPS
Sbjct: 145 SSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQFIAAAAILLQPS 204

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
           LILIDHGHFQYNSV LGLTVYAINNLLD F+  AA+CF+LS+CFKQM L+YSPIFFAYLL
Sbjct: 205 LILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTLYYSPIFFAYLL 264

Query: 242 SRSLFSPS-FKFSRFMSVALSTVITFCLMFSPLYVFG---GMKNVLQSIHRIFPFSRGIF 297
           S+SLF+P  F   RF+++A++TV +F LM+ PLYVFG   G+ NVLQSIHRIFPF+RGIF
Sbjct: 265 SKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSIHRIFPFARGIF 324

Query: 298 EDKVANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAA 357
           EDKVANFWCV+NVI KY   FTQ +LQ  S   T  GFLP+  +++ YPKK+++PY L+A
Sbjct: 325 EDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYPKKYLLPYALSA 384

Query: 358 CSMAFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLA 417
           CSMAF+LF FQVHEK            + STD NVL+ VSW+NN+ LFTLWPLLKKD L 
Sbjct: 385 CSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLT 444

Query: 418 LQYGIMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIIT 477
           LQY + +LLSNWLIGNFSF+TP FLP  +TPGPS+S + E Y  RS LP NI WK++I+ 
Sbjct: 445 LQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLPRNIFWKVIIVL 504

Query: 478 SYIVMAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           SYI M  IH+LD FV PP   PDLWV++NC LGF CF +FW+WN YKLF+M  KS+  L
Sbjct: 505 SYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLFSMIKKSLHHL 563

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/529 (65%), Positives = 428/529 (80%), Gaps = 1/529 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +E F+ASP+YDFL PFR   +Q+  EY+IV+F L+I+ A+GLGS+SG  T PM GDFEAQ
Sbjct: 35  EECFYASPIYDFLYPFRSPGSQWVTEYIIVVFLLIIKSAIGLGSYSGFQTPPMFGDFEAQ 94

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LP+SQWYWFDLQYWGLDYPP TAYHSY LGK+G+ + P WF L +SRG ET
Sbjct: 95  RHWMEITQHLPVSQWYWFDLQYWGLDYPPFTAYHSYLLGKIGTFIYPPWFELDASRGMET 154

Query: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
             +K+YMRFTV+LSE   YIPA++YFTKW G +++QSPIGQ++AAAAILFQP+L+LIDHG
Sbjct: 155 DGIKSYMRFTVLLSECIFYIPAIVYFTKWVGRRKKQSPIGQFVAAAAILFQPTLMLIDHG 214

Query: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248
           HFQYN VMLGLTVYAINNLLDGF+  AA+CF+LS+CFKQMAL+Y+PIFFA LLS+SLF P
Sbjct: 215 HFQYNCVMLGLTVYAINNLLDGFYAMAAVCFVLSICFKQMALYYAPIFFAVLLSKSLFFP 274

Query: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKVANFWCV 307
             F   RF+SVA +T+ +  +MF+PLY+FGG+ NVLQSIHRIFPF+RGIFEDKVANFWCV
Sbjct: 275 RLFNIPRFLSVAFATLASLFVMFAPLYIFGGVGNVLQSIHRIFPFARGIFEDKVANFWCV 334

Query: 308 SNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLFGF 367
           +NV  KY   FTQ +LQ  S  AT  GF P+F +++ YPKK +IPYGLAACSMAFFLF F
Sbjct: 335 TNVFFKYKTMFTQSELQFYSLVATVVGFFPAFMIMIFYPKKFLIPYGLAACSMAFFLFSF 394

Query: 368 QVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMMLLS 427
           QVHEK            F ST+WN L++V W+NNVALFTLWPLLKKD L LQY + +++ 
Sbjct: 395 QVHEKTILVPLLPATLLFTSTNWNNLSMVFWVNNVALFTLWPLLKKDGLWLQYCVCLVMY 454

Query: 428 NWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVIHI 487
           NWL+GNFSF+TPRFLP  +TPGPS+SN+AE YRRRS LP+NI+WKI+I+ SY+ M +IH+
Sbjct: 455 NWLLGNFSFITPRFLPKILTPGPSISNIAENYRRRSLLPHNIIWKIIILVSYLCMLMIHV 514

Query: 488 LDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           L+  +  P++ PDLWV +NC +GF CF +FW+W  YKL T+RNK+I +L
Sbjct: 515 LEYTIAAPSQYPDLWVQLNCTVGFGCFVLFWMWTYYKLITLRNKTIQEL 563

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/531 (65%), Positives = 422/531 (79%), Gaps = 3/531 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ + P+HGDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLHGDFEAQ 73

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HSY LG +GS  NP WFAL  SRG E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDKSRGFES 133

Query: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305
            P F  +R   ++ +T+ TF LM +PLY  GG +KN+ Q IHRIFPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFEDKVANFW 313

Query: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365
           CV+NV VKY + F+  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 314 CVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 366 GFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLK+D L LQY +  L
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQYAVSFL 433

Query: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485
           LSNWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M + 
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGLY 493

Query: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           H LDLFV PP+K PDLWVL+NC +GFTCFS+FW+W+ YK+FT  +KS+ DL
Sbjct: 494 HFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/531 (64%), Positives = 425/531 (80%), Gaps = 2/531 (0%)

Query: 5   KSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGD 64
           ++L  E F+ASPLY FLSPF+   NQ+ + Y+IV+FAL+IRCA+GLG +SG    PM GD
Sbjct: 26  ETLDTEPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGD 85

Query: 65  FEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSR 124
           FEAQRHWME+T +LP+SQWY++DLQYWGLDYPPLTAYHSY  G +G   NP WF L +SR
Sbjct: 86  FEAQRHWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSR 145

Query: 125 GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLIL 184
           G E  ELK +MR T I+SE   YIPA++YFT W G +R+QSP+GQYIAAAAILFQP L+L
Sbjct: 146 GMEMKELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLML 205

Query: 185 IDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRS 244
           IDHGHFQYNSVMLGLTVYAINNLLD  + PAAI F++S+CFKQM+L+Y+PIFFAYLL RS
Sbjct: 206 IDHGHFQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRS 265

Query: 245 LFSPSF-KFSRFMSVALSTVITFCLMFSPLYVFGGMK-NVLQSIHRIFPFSRGIFEDKVA 302
           LF   F   SRF+++A++T+++F  +F+PLYVFGG K N++QS+HRIFPF+RGIFEDKVA
Sbjct: 266 LFKKQFFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVA 325

Query: 303 NFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAF 362
           NFWCV+NVI+KY  N+TQD+LQ  S   T  GFLP+   ++ +PKKH++PY LAAC+M+F
Sbjct: 326 NFWCVTNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSF 385

Query: 363 FLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGI 422
           FLF FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD + LQYG+
Sbjct: 386 FLFSFQVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGV 445

Query: 423 MMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVM 482
             +LSNWLIGNFSF TPRFLP  +TPGP + NV   YRRRS LPNNI+WKI+I+ SYIVM
Sbjct: 446 CFILSNWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVM 505

Query: 483 AVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSI 533
             I  L+LFV+PP + PD++VL+NC LGF CF+ FWLWN YKLFT+ +K++
Sbjct: 506 VAIQGLELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNL 556

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/531 (65%), Positives = 423/531 (79%), Gaps = 3/531 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RCA+GLG +SG+ + P+HGDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLHGDFEAQ 73

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HS   G +G+  NP WFAL  SRG E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDKSRGFES 133

Query: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAAAAILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQPSLMLID 193

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305
            P F  +R   +A +T+ TF ++ +PLY  GG ++N+ Q I+RIFPFSRGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFEDKVANFW 313

Query: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365
           CV+N+ VKY D FT  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 314 CVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 366 GFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD L LQY +  L
Sbjct: 374 SFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYTVSFL 433

Query: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485
           LSNWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M V 
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGVY 493

Query: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           H+LDLFV PP+K PDLWVL+NCA+GFTCFS+FW+W+ YK+FT  NKS+ DL
Sbjct: 494 HLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/531 (65%), Positives = 421/531 (79%), Gaps = 3/531 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           +ESF+ASP+YDFL PFRPV NQ+  EY+I + A+++RC +GLG +SG+ + P++GDFEAQ
Sbjct: 14  EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLYGDFEAQ 73

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T +LPLS+WYW+DLQYWGLDYPPLTA+HSY LG +GS  NP WFAL  SRG E+
Sbjct: 74  RHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEKSRGFES 133

Query: 129 PE--LKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILID 186
           P+  LK YMR TVI+S+   Y PAV+YFTKW G  R QSPIGQ IAA+AILFQPSL+LID
Sbjct: 134 PDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQPSLMLID 193

Query: 187 HGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLF 246
           HGHFQYNSVMLGLT YAINNLLD ++  AA+CF+LS+CFKQMAL+Y+PIFFAYLLSRSL 
Sbjct: 194 HGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYLLSRSLL 253

Query: 247 SPSFKFSRFMSVALSTVITFCLMFSPLYVFGG-MKNVLQSIHRIFPFSRGIFEDKVANFW 305
            P F  +R   +A +T+ TF ++F+PLY  GG +KN+ Q IHRIFPF+RGIFEDKVANFW
Sbjct: 254 FPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFEDKVANFW 313

Query: 306 CVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFFLF 365
           CV+NV VKY + FT  QLQ  S  AT  GFLP+  + +L+PKKH++PY L ACSM+FFLF
Sbjct: 314 CVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACSMSFFLF 373

Query: 366 GFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIMML 425
            FQVHEK            + STDWNVL++VSWINNVALFTLWPLLKKD L LQY +  L
Sbjct: 374 SFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQYAVSFL 433

Query: 426 LSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMAVI 485
           LSNWLIGNFSF+TPRFLP  +TPGPS+S++   YRRRS LP N+VWK  II +YI M   
Sbjct: 434 LSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTYIAMGFY 493

Query: 486 HILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           H LD FV PP+K PDLWVL+NCA+GF CFS+FWLW+ YK+FT  +KS+ DL
Sbjct: 494 HFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/535 (64%), Positives = 427/535 (79%)

Query: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61
           DA+K   KE+FFASPLYDFL P RPV NQ+ A+Y+IVIFAL+IR AVGLG +SG    PM
Sbjct: 29  DAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPM 88

Query: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121
            GDFEAQRHWME+T ++P+S+WY+  LQYWGLDYPPLTAYHSY LGKLGS ++PEWF+L 
Sbjct: 89  FGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH 148

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           +SRG E+ +LK+YMR TVILSE   YIPAVLYFT+W G +R+QSPIGQYIA AAILFQP+
Sbjct: 149 ASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
           LILIDHGHFQYN VMLGLTV AINNLLD ++  AA+ F+ SL FKQMAL+Y+P+ F YLL
Sbjct: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268

Query: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKV 301
           SRS++ P     RF++VA++T+I F ++++PLY+ G +  + QSIHR+FPF RG+FEDKV
Sbjct: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKV 328

Query: 302 ANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMA 361
           ANFWCV+NV+VKY   +T  QL+  S   T+A  LPS  +  LYPKK M+PY LAACSM+
Sbjct: 329 ANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMS 388

Query: 362 FFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYG 421
           FFLFGFQVHEK            + STDWNVL++V+WINN+ALFTLWPLLKKD L+LQY 
Sbjct: 389 FFLFGFQVHEKTILVPLLPITLLYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYA 448

Query: 422 IMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIV 481
           IM LLSNWLIGNFSF+TP FLP  +TPGPS+S+VA+ YRRRS LP+NI+W+I+I+ SYI 
Sbjct: 449 IMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNIIWRIIIVVSYIC 508

Query: 482 MAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           +  IHI +L+  P  +LPD+WVL NC +G + F++FW+WNNYK+F MRN +I DL
Sbjct: 509 VGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/533 (64%), Positives = 420/533 (78%), Gaps = 5/533 (0%)

Query: 9   KESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPMHGDFEAQ 68
           KESF+ASPLYDFL PFRP  +Q+  EY+IV+FA++IRCAVGLG +SG  T PM GDFEAQ
Sbjct: 48  KESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQ 107

Query: 69  RHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSSRGNET 128
           RHWME+T  LP+SQWYWFDLQYWGLDYPPLTA+HSY  GK+GS   P WF LG SRG E 
Sbjct: 108 RHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEG 167

Query: 129 PELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSLILIDHG 188
            +LK +MR TV+ SE+  YIPAV+YFTKW G +R QSPIGQ+IA AAILFQPSLILIDHG
Sbjct: 168 QDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHG 227

Query: 189 HFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLSRSLFSP 248
           HFQ+NSVMLGLTVY +NNLLD F+  AA+CF+LS+CFKQMAL+YSPIFFAYLLS+SLF P
Sbjct: 228 HFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHP 287

Query: 249 S-FKFSRFMSVALSTVITFCLMFSPLYVF----GGMKNVLQSIHRIFPFSRGIFEDKVAN 303
             F   RF +++ +T+ TF  MF P+Y F    GG+ N+LQSI RIFPF+RGIFEDKVAN
Sbjct: 288 RLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVAN 347

Query: 304 FWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMAFF 363
           FWCV+NVI KY  NFTQ+QLQ  S   T   FLP+  +++LYP+K+++ Y L+ACSM+F+
Sbjct: 348 FWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFY 407

Query: 364 LFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYGIM 423
           LF FQVHEK            + STD NVL+ VSW+NN+ LFTLWPLLKKD L+LQY + 
Sbjct: 408 LFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVC 467

Query: 424 MLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIVMA 483
           ++LSNWLIGNFSF+TPRFLP  +TPGPS+  + E YRR + LP+N +WK++I+ SY++M 
Sbjct: 468 LILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMG 527

Query: 484 VIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536
           VIH +D F++PP+  PDLWV++NC LGF CF +FWLWN YKLF+M  K+I  L
Sbjct: 528 VIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  118 bits (296), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 106/374 (28%), Positives = 167/374 (44%), Gaps = 75/374 (20%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGS--VLNPEWFALG 121
           DF+  R+W+ +T+NLP+S+WY+ +   W LDYPP  AY  + L +     V N     + 
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVL-YFTKWFGIKRRQSPIGQ-YIAAAAILFQ 179
                  P +  + R TVI+SE  L+  AVL Y+      K R    GQ ++ A++I+  
Sbjct: 124 EVGQFGLPTI-VFQRLTVIISEILLF--AVLQYYINTSNSKER----GQCFVVASSIVLS 176

Query: 180 PSLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAY 239
           P  ++IDH HFQYN  +  + + +I       +   A+ + +SLCFK + L+ +P +F +
Sbjct: 177 PGFLIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVF 236

Query: 240 LLSRSLFS-PSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVL---------QSIHRI 289
           LL   + +  +FKF  +M   L +VI +  +F    +  G+  +          Q + R+
Sbjct: 237 LLRAYVLNFENFKFKSYMD--LQSVIQWKRLFKLAGIVSGIFTICFAPFIFQLPQVLSRL 294

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVKYADNFTQDQ---LQKLSTFATAAGFLP-------- 337
           FPFSRG+     A NFW + + I K    F   +   + KL    T++  LP        
Sbjct: 295 FPFSRGLTHAYWAPNFWAMYSFIDK-VLTFVMLRFPYVHKLMLSFTSSPILPKTAAEIRE 353

Query: 338 ----------------------------SFALVVLYPKKHMIPY-----------GLAAC 358
                                       +F L + Y    +IP             L  C
Sbjct: 354 RMAQNNNGTKGLVQDYFFVILPQITPKLTFLLTLFYQILAVIPLLFDPSYKRFIGSLTLC 413

Query: 359 SMAFFLFGFQVHEK 372
            MA +LFG+ VHEK
Sbjct: 414 GMASYLFGWHVHEK 427

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 93/360 (25%), Positives = 159/360 (44%), Gaps = 60/360 (16%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGS- 122
           DF+  R+W+ +T  LPL +WY+ +   W LDYPP  AY  + L +       E   L   
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI+SE  L++   ++       ++ QS    ++ A++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           ++IDH HFQYN  + G+ + +I    +  +    + + ++LCFK + L+ +P +F +LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 243 RSLFS-PSFKFSRFMSVALSTV---------ITFCLM---FSPLYVFGGMKNVLQSIHRI 289
             + +   FKF  +  + L            I  C+M   F P +     +++ Q + R+
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVMGVCFGPFW-----RDMNQLLSRL 273

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVK----------YADNFTQDQLQKLSTFATAAG---- 334
           FPFSRG+     A NFW + + + K          +      D++++   +   +     
Sbjct: 274 FPFSRGLTHAYWAPNFWAIYSFVDKMLSILFVRVPFNKFINLDKIEERKRWNNGSRGLVE 333

Query: 335 -----FLP------SFALVVLYPKKHMIPY-----------GLAACSMAFFLFGFQVHEK 372
                 LP      +F L + Y    ++P             L  C  A FLFG+ VHEK
Sbjct: 334 DVFFVILPQIQPNLTFVLTLFYQVLAVVPVLFDPSFKRFIGSLTLCGFASFLFGWHVHEK 393

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  117 bits (292), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 165/374 (44%), Gaps = 75/374 (20%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL--GSVLNPEWFALG 121
           DF+  R+W+ +T NLPL QWY+     W LDYPP  AY  + L +   G+V       + 
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEI- 103

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
             +G        + R TVILSE  L++   ++       +R QS    ++ A++I+  P+
Sbjct: 104 VDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPA 159

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
            +++DH HFQYN  +  + + +I     G +   A  + ++LCFK + L+ +P +F +LL
Sbjct: 160 FLIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLL 219

Query: 242 -SRSLFSPSFKFSRFMSVAL-----------STVI-TFCLMFSPLYVFGGMKNVLQSIHR 288
            +  L    FKF  +  +             S VI  F L F P      +K++ Q + R
Sbjct: 220 RAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPF-----VKDLPQVLTR 274

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVIVK----------YADNFTQ------------DQL-Q 324
           +FPFSRG+     A NFW + + + K          Y   FT             D++ Q
Sbjct: 275 LFPFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTIDEIKQ 334

Query: 325 KLST-------------FATAAGFLP--SFALVVLYPKKHMIPY-----------GLAAC 358
           +++              F       P  +FAL   Y    +IP             L  C
Sbjct: 335 RIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIGSLTLC 394

Query: 359 SMAFFLFGFQVHEK 372
            +A +LFG+ VHEK
Sbjct: 395 GLASYLFGWHVHEK 408

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  110 bits (275), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 99/373 (26%), Positives = 159/373 (42%), Gaps = 73/373 (19%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LPL QWY+     W LDYPP  AY  + L + + S +  +      
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  L++   +Y       +R QS    ++ A++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           ++IDH HFQYN  +  + + +I    +  +      + ++LCFK + L+ +P +F +LL 
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 243 RSLFS-PSFKFSRFMS----------VALSTVI--TFCLMFSPLYVFGGMKNVLQSIHRI 289
             + +   FKF  +            V L +V+  TF + F P ++F    ++ Q + R+
Sbjct: 212 AYVLNLKDFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGP-FIF----DLPQLLTRL 266

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVKY---------------------------------- 314
           FPFSRG+     A NFW + + I K                                   
Sbjct: 267 FPFSRGLTHAYWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNEIKAK 326

Query: 315 --ADNFTQDQLQKLSTFATAAGFLP--SFALVVLYPKKHMIPY-----------GLAACS 359
             A+N     L +   F      +P  +F L +LY    ++P             +  C 
Sbjct: 327 MAANNNGSKGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSMTLCG 386

Query: 360 MAFFLFGFQVHEK 372
           +A FLFG+ VHEK
Sbjct: 387 LASFLFGWHVHEK 399

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  110 bits (274), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 162/375 (43%), Gaps = 77/375 (20%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL--GSVLNPEWFALG 121
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L +    SV +     + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKSVRDDGCLDIV 125

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P +  + R TVI SE  L++   +Y       +R QS    ++ A++I+  P 
Sbjct: 126 EIGKFGLPTI-VFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVASSIVLSPG 180

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
            ++IDH HFQYN  +  + + +I    +  +   A+ +  ++CFK + L+ +P +F +LL
Sbjct: 181 FLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLAPCYFVFLL 240

Query: 242 SRSLFS-PSFKFSRFMS----------VALSTVIT--FCLMFSPLYVFGGMKNVLQSIHR 288
              + +  +FKF  +            + L+TV+   F + F P         + Q + R
Sbjct: 241 RAYVLNVNNFKFKSYKDFLFLIRWANLLKLATVVVGIFTICFLPF-----AHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVIVKYADNFTQDQLQKLSTFAT---------------- 331
           +FPFSRG+     A NFW + + + K        +L  + TFAT                
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTT-VMLKLPYVHTFATKFIKPPLIPQNIKEIN 354

Query: 332 ---AAG--------------FLP------SFALVVLYPKKHMIPY-----------GLAA 357
              AA                LP      +F L + Y    ++P             L  
Sbjct: 355 ERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKRFVGSLTL 414

Query: 358 CSMAFFLFGFQVHEK 372
           C +A FLFG+ VHEK
Sbjct: 415 CGLASFLFGWHVHEK 429

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  109 bits (272), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 179/419 (42%), Gaps = 74/419 (17%)

Query: 61  MHGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFAL 120
           +  DF+  R+W+ +T  LPL QWY+ +   W LDYPP  AY  +AL +L   +  +   L
Sbjct: 41  LSTDFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCL 100

Query: 121 GSSRGNE--TPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILF 178
              +  +   P +  + R TVI SE  L++   +Y  K    +R       ++ A++I+ 
Sbjct: 101 DIVKVGQFGMPTI-VFQRLTVIASEILLFVVLQVYINKSHISERS----ANFVVASSIVL 155

Query: 179 QPSLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFA 238
            P  ++IDH HFQYN  +  + + +I    +  +    + F +++CFK + L+ +P FF 
Sbjct: 156 SPGFLIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFV 215

Query: 239 YLLSRSLFSPSFKFSRFMSVALSTVIT-------FCLMFSPLYVFGG-----MKNVLQSI 286
           +LL   +      FS F   + + +I+       F L    L VFG      +    Q +
Sbjct: 216 FLLRVYVLD----FSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPFISQWPQLL 271

Query: 287 HRIFPFSRGIFEDKVA-NFWCVSNVI----------VKYADNF-TQ------------DQ 322
            R+FPFSRG+     A NFW + +++          V Y   F TQ            + 
Sbjct: 272 SRLFPFSRGLTHAYWAPNFWAMYSLLDKVLTLIILKVPYVHKFLTQFIAPPLIPATIGEI 331

Query: 323 LQKLSTFATAAG---------FLP------SFALVVLYPKKHMIPY-----------GLA 356
            QKL  +               LP      +F L + Y    +IP             L 
Sbjct: 332 KQKLLQYNVGTKGLVQDVYFVILPQIQPRLTFILTLFYQILAIIPVLFSPSFKRFVGSLT 391

Query: 357 ACSMAFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDK 415
            C  A FLFG+ VHEK              ++D  +L   + + +    +L+PLL + +
Sbjct: 392 LCGFASFLFGWHVHEK-AIMLIIIPFSFLVTSDRRLLTPFNLLASAGYVSLFPLLHETQ 449

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 110/420 (26%), Positives = 176/420 (41%), Gaps = 82/420 (19%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL--GSVLNPEWFALG 121
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  + L +     V +     + 
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           +      P +  + R TVI+SE  L++   +Y  K     R       ++ A++I+  P 
Sbjct: 104 AVGQFGLPTI-VFQRVTVIVSEILLFVVLQVYINKSHISDRS----ANFVVASSIVLSPG 158

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAIC---FMLSLCFKQMALFYSPIFFA 238
            ++IDH HFQYN  +  +    I +++   H    +C   F  +LCFK + L+ +P FFA
Sbjct: 159 FLIIDHIHFQYNGFLFAIL---IASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFA 215

Query: 239 YLLSRSLFSPS-FKFSRFMSV----------ALSTVI--TFCLMFSPLYVFGGMKNVLQS 285
           +LL   +   S F+F  +  +           L TV+   F + F+P      +  + Q 
Sbjct: 216 FLLRVYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQL 270

Query: 286 IHRIFPFSRGIFEDKVA-NFWCVSNVI----------VKYADNF------------TQDQ 322
           + R+FPFSRG+     A NFW + + +          V Y   F            T D+
Sbjct: 271 MSRLFPFSRGLTHAYWAPNFWALYSALDKVLTLFFLKVPYVHKFLTQVVSPPLIPVTIDE 330

Query: 323 LQ-KLSTFATAAG---------FLP------SFALVVLYPKKHMIPY-----------GL 355
           ++ KL  +               LP      +F L + Y    +IP             L
Sbjct: 331 IKTKLQQYNVGTKGLVQDVYFVILPQIQPKLTFILTLFYQILAVIPVLFSPSFERFVGSL 390

Query: 356 AACSMAFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDK 415
             C  A FLFG+ VHEK              +TD  +L     + +    +L+PLL + +
Sbjct: 391 TLCGFASFLFGWHVHEK-AVLLIIIPFSFLVTTDRRLLTPFHLVASAGYVSLFPLLHEPQ 449

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  107 bits (266), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 80/260 (30%), Positives = 123/260 (47%), Gaps = 26/260 (10%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL--GSVLNPEWFALG 121
           DF+  R+W+ +T  LPL++WY      W LDYPP  AY  + L +    SV       + 
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
                  P +  + R TVILSE  LY  A+  F     I  + +    ++ A++I+  P 
Sbjct: 112 KVGSFGLPTI-IFQRITVILSELVLY-AALQVFINTSDISEKSA---NFVVASSIVLSPG 166

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
           L+++DH HFQYN  + G+ + +I    +  +   A  F ++LCFK + L+ +P +F +LL
Sbjct: 167 LLIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLL 226

Query: 242 SRSLFS-PSFKF------------SRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHR 288
              +    SFKF            S  + +A   +  F L F P      +    Q + R
Sbjct: 227 RAYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIFSLAFLPF-----ITTWQQLLAR 281

Query: 289 IFPFSRGIFEDKVA-NFWCV 307
           +FPFSRG+     A N W V
Sbjct: 282 LFPFSRGLTHAYWAPNVWAV 301

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  106 bits (265), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 130/265 (49%), Gaps = 24/265 (9%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+WM +T  LP+S+WY+ +   W LDYPP  AY  + L + +  ++  +      
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI+SE  L+     Y       +R QS    ++ A++I+  P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN+ +  + + +I       +   A+ + ++LCFK + L+ +P +F +LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 243 RSLFS-PSFKFS------------RFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRI 289
             + +   FKF             R + +    +  F + F+P ++F     + Q + R+
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAP-FIF----QMPQVLSRL 339

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVK 313
           FPFSRG+     A NFW + + + K
Sbjct: 340 FPFSRGLTHAYWAPNFWAIYSFLDK 364

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  106 bits (264), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 161/381 (42%), Gaps = 88/381 (23%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSS 123
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  + + +         F     
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQ---------FVPKVV 104

Query: 124 RGNETPELKAYMRF---TVILSEAALYIPAVLYFT--KWFGIKRRQSPIGQ-YIAAAAIL 177
           R +   ++    +F   TV+    ++ I  +L F   +WF  K + +   Q +I A +I+
Sbjct: 105 RDDGCLDIVPVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQSFIVATSII 164

Query: 178 FQPSLILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFF 237
             P  ++IDH HFQYN  +  + + +I       +    + + ++LCFK + L+ +P +F
Sbjct: 165 LSPGFLIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYF 224

Query: 238 AYLLSRSLFS-PSFKFSRFMSVALSTVITFCLMFSPLYVFGG-------------MKNVL 283
            +LL   + +  +FKF  +  + L       + ++ L+  GG             + ++ 
Sbjct: 225 VFLLRAYVLNVKNFKFKSYKDLIL------LIQWNNLFKLGGIVLSIFGICFLPFIYHLP 278

Query: 284 QSIHRIFPFSRGI--------------FEDKVA-----------NFWC------------ 306
           Q   R+FPF RG+              F DK+A              C            
Sbjct: 279 QVFTRLFPFGRGLTHAYWAPNFWAIYSFTDKIATTLLLKLPYVHKLLCKCIKHPLFPTTR 338

Query: 307 --VSNVIVKYADNFTQDQLQKLSTFATAAGFLP--SFALVVLYPKKHMIPY--------- 353
             + + I++Y +N ++  ++ +  F      +P  SF L   Y    ++P          
Sbjct: 339 EEIQSRIMEYGNNGSKGLVEDV-YFIILPQIIPKLSFILTGFYQLLAVVPLLFDPSFKRF 397

Query: 354 --GLAACSMAFFLFGFQVHEK 372
              L  C MA FLFG+ VHEK
Sbjct: 398 IGSLTLCGMASFLFGWHVHEK 418

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 97/373 (26%), Positives = 160/373 (42%), Gaps = 73/373 (19%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL-GSVLNPEWFALGS 122
           DF+  R+W+ +T  + L  WY+     W LDYPP  AY  + +  L  S +  +      
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE+ L++   +Y       +R QS    +I A++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN  +  + V +I    +  +   A+ + ++LCFK + L+ +P +F +LL 
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 243 RSLFS-PSFKFSRFMS------------VALSTVITFCLMFSPLYVFGGMKNVLQSIHRI 289
             + +  +FKF  +              + +  V  F L F P ++F    ++ Q + R+
Sbjct: 240 VYVLNFENFKFRSYKDLIFLIRWKNLCQLGMIVVGVFSLCFGP-FIF----DMPQLLSRL 294

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVK----------YADNFT-------------QDQLQK 325
           FPFSRG+     A NFW + + + K          Y  NF              ++  Q+
Sbjct: 295 FPFSRGLTHAYWAPNFWALYSFLDKVLTVFALRLHYVHNFAAKFIAPSLLPSSIEEIRQR 354

Query: 326 LSTFATAAG---------FLP------SFALVVLYPKKHMIPY-----------GLAACS 359
           ++                 LP      +F L + Y    +IP             L  C 
Sbjct: 355 IAEHNNGTKGLVQDVFFVILPQISPKLTFLLTLFYQILAVIPLLFDPSFKRFMGSLTLCG 414

Query: 360 MAFFLFGFQVHEK 372
           MA +LFG+ VHEK
Sbjct: 415 MASYLFGWHVHEK 427

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 98/374 (26%), Positives = 157/374 (41%), Gaps = 75/374 (20%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L + +  V+  +      
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  LY    +Y       +R QS    ++ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           ++IDH HFQYN  +  + + +I    +  +   A  +  ++CFK + L+ +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 243 RSLFS-PSFKFSRFMS----------VALSTVI--TFCLMFSPLYVFGGMKNVLQSIHRI 289
             + +  +FKF  +              L +++   F + F P         + Q + R+
Sbjct: 242 AYVLNVNNFKFKSYKDFLFLIRWANLFKLGSIVIGIFTICFVPF-----AHQMPQVLSRL 296

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVKYADNFTQDQLQKLSTFAT----------------- 331
           FPFSRG+     A NFW + + + K        +L  + TFAT                 
Sbjct: 297 FPFSRGLTHAYWAPNFWALYSFMDKILTT-VMLKLPYVHTFATKFIKPPLIPQNIKEINE 355

Query: 332 --AAG--------------FLP------SFALVVLYPKKHMIPY-----------GLAAC 358
             AA                LP      +F L + Y    ++P             L  C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRFVGSLTLC 415

Query: 359 SMAFFLFGFQVHEK 372
            +A FLFG+ VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  104 bits (259), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 96/376 (25%), Positives = 155/376 (41%), Gaps = 79/376 (21%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LPL QWY+     W LDYPP  AY  + + + +  V+  +      
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R +VI SE  L++  + +F     +K R      +I A +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFV-VLQWFINTSNVKERTQ---SFIVATSIILSPGF 171

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN  +  + + +I       +   A+ +  +LCFK + L+ +P +F +LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 243 RSLFS-PSFKFS---------------RFMSVALSTVITFCLMFSPLYVFGGMKNVLQSI 286
             + +   F+F                R   V LS ++  C  F P ++F    ++ Q +
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLS-IVGVC--FGP-FIF----DMPQLL 283

Query: 287 HRIFPFSRGIFEDKVA-NFWCVSNVIVKYADNFTQD--QLQKLSTFATAAGFLP------ 337
            R+FPFSRG+     A NFW + +   K           +  L+T   +A F P      
Sbjct: 284 TRLFPFSRGLTHAYWAPNFWAIYSFTDKVLTTLMLKLPYVHTLATRFISAPFFPATIKEI 343

Query: 338 ------------------------------SFALVVLYPKKHMIPY-----------GLA 356
                                         +F L + Y    +IP             L 
Sbjct: 344 QKRLSEDNNGTKGLVQDVYFIVLPQIVPKLTFILTLFYQLLAVIPLLFDPSFKRFIGSLT 403

Query: 357 ACSMAFFLFGFQVHEK 372
            C MA +LFG+ VHEK
Sbjct: 404 LCGMASYLFGWHVHEK 419

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  103 bits (257), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 135/283 (47%), Gaps = 25/283 (8%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALGSS 123
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  + L +    +  E  AL   
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 124 R-GNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  L++   ++       ++ +S    ++ A++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPGF 170

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           ++IDH HFQYN  +    + +I       +   A  + ++LCFK + L+ +P +F +LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 243 RSLFS-PSFKFSRFMSV----------ALSTVI--TFCLMFSPLYVFGGMKNVLQSIHRI 289
             + +  +F+F  +  +           +++V+   F + F P      + ++ Q + R+
Sbjct: 231 AYVLNFKNFEFKSYKDLIFIVQWKHLFKMASVVLGIFFICFGPF-----LYDLPQVMTRL 285

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVKYADNFTQDQLQKLSTFAT 331
           FPFSRG+     A NFW + + + K    F   +L  +  FAT
Sbjct: 286 FPFSRGLTHAYWAPNFWAIYSFLDKIL-TFVMLKLPYVHAFAT 327

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 126/266 (47%), Gaps = 26/266 (9%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L + +  V+  +      
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI SE  L+    +Y       +R QS    ++ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           ++IDH HFQYN  +  + + +I    +  +   A+ +  S+CFK + L+ +P +F +LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLLR 241

Query: 243 RSLFS-PSFKFSRFMSVALSTVITFCLMFSPLYVFGGM-------------KNVLQSIHR 288
             + +  +FKF  +          F + ++ L+  G +               + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKD------FLFLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVIVK 313
           +FPFSRG+     A NFW + + + K
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDK 321

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  103 bits (256), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 98/373 (26%), Positives = 155/373 (41%), Gaps = 73/373 (19%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LPL +WY      W LDYPP  AY  + L + +  ++  +      
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             GN       + R TVI+SE  L++   ++  K             +I A++I+  P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIFINK----SATNEKSANFIVASSIVLSPGF 163

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN  +  + + AI       +      F  +LCFK + L+ +P FF +LL 
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLLR 223

Query: 243 RSLFS-PSFKF------------SRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRI 289
             +    +FKF             R + + L  +  F + F+P      +  + Q + R+
Sbjct: 224 AYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMPQLLERL 278

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVK----------YADNF------------TQDQL-QK 325
           FPFSRG+     A NFW + +++ K          Y   F            T D++ Q+
Sbjct: 279 FPFSRGLTHAYWAPNFWALYSLLDKVLTFVMLRLPYVHRFIIKFVAPPLIPATIDEIKQR 338

Query: 326 LST-------------FATAAGFLP--SFALVVLYPKKHMIPY-----------GLAACS 359
           LS              F       P  +F L + Y    +IP             L  C 
Sbjct: 339 LSQNNVGTRGLVQDVYFVILPQIQPKLTFLLTLFYQILAVIPVLFNPSFKRFAGSLTLCG 398

Query: 360 MAFFLFGFQVHEK 372
            + FLFG+ VHEK
Sbjct: 399 FSSFLFGWHVHEK 411

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/374 (24%), Positives = 158/374 (42%), Gaps = 75/374 (20%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LP+S+WY+     W LDYPP  AY  + L + +  V+  +      
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        + R TVI S+  L++   +Y       +R QS    ++ A++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPGF 181

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
            +IDH HFQYN  +  + + +I       +   AI +  ++CFK + L+ +P +F +LL 
Sbjct: 182 FMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 243 RSLFS-PSFKFSRFMSVALSTVITFCLMFSPLYVFGGM-------------KNVLQSIHR 288
             + +  +FKF  +          F + ++ L+  G +               + Q + R
Sbjct: 242 AYVLNVNNFKFKSYKD------FLFLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVLSR 295

Query: 289 IFPFSRGIFEDKVA-NFWCVSNVIVK--------------YADNFTQ-----DQLQKLST 328
           +FPFSRG+     A NFW + + + K              +A  F +       L++++ 
Sbjct: 296 LFPFSRGLTHAYWAPNFWALYSFMDKILTTIMLRLPYVHTFATKFIKPPLIPQNLKEINE 355

Query: 329 FATAAG-------------FLP------SFALVVLYPKKHMIPY-----------GLAAC 358
              A                LP      +F L + Y    ++P             L  C
Sbjct: 356 RLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQILAVLPLLFDPSFKRFVGSLTLC 415

Query: 359 SMAFFLFGFQVHEK 372
            +A FLFG+ VHEK
Sbjct: 416 GLASFLFGWHVHEK 429

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 121/263 (46%), Gaps = 20/263 (7%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKL--GSVLNPEWFALG 121
           DFE  R+W+ +T  LPL +WY      W +DYPPL A+  +AL ++  G+V       L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181
           +      P +  + R TVI SE  LY+   +Y +        Q     ++   ++   P+
Sbjct: 119 AEGRYGWPTV-VFQRLTVIASEVLLYVVLQVYVSS----SAAQERTVNFVVTTSVALSPA 173

Query: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241
            +L+DH HFQYN  +  + V +I    +  +      F ++LC K + L+ +P +F +LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 242 SRSLFS-PSFKFSRFMSVALSTV---------ITFCLMFSPLYVFGGMKNVLQSIHRIFP 291
              +     F+F  +  +  +           +   +M      F G+    Q + R+FP
Sbjct: 234 RAYVLDLGEFRFRSYRDLVFAVRWGNLCRLGGVVLAIMAVTFAPFAGVMP--QLMARLFP 291

Query: 292 FSRGIFEDKVA-NFWCVSNVIVK 313
           FSRG+     A NFW + + + K
Sbjct: 292 FSRGLTHAYWAPNFWAIYSFVDK 314

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 98/417 (23%), Positives = 166/417 (39%), Gaps = 75/417 (17%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           DF+  R+W+ +T  LPL +WY+     W LDYPP  AY  + L + + + +  +      
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
            +G        + R TVI SE  L++   +Y       ++ QS    ++ A++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN  +  + + +I           A  +  +LCFK + L+ +P +F +LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 243 RSLFS-PSFKFS------------RFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRI 289
             +     F+F             R   +    +    + F+P       +++ Q + R+
Sbjct: 229 TYVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPF-----ARDMPQLLSRL 283

Query: 290 FPFSRGIFEDKVA-NFWCVSNVIVKYAD--------------------------NFTQDQ 322
           FPFSRG+     A NFW + ++  K                             +  + +
Sbjct: 284 FPFSRGLTHAYWAPNFWALYSLCDKVLTVALLKVPLFHRLILKVLSPKIFPASLDIIRQR 343

Query: 323 LQKLSTFATAA-------GFLP------SFALVVLYPKKHMIPY-----------GLAAC 358
           L+K +   T           LP      +F L +LY    ++P             L  C
Sbjct: 344 LKKNANHGTKGLVEDVYFVVLPQITPATTFLLTLLYQVLAVLPLLFDASFKRFLGSLTLC 403

Query: 359 SMAFFLFGFQVHEKXXXXXXXXXXXXFCSTDWNVLAIVSWINNVALFTLWPLLKKDK 415
             A FLFG+ VHEK                D  +L     +      +L+PLL K+ 
Sbjct: 404 GFASFLFGWHVHEK-AIMLVIIPFSFLVVYDRRLLTSFKLVTTAGYVSLFPLLYKND 459

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/376 (23%), Positives = 148/376 (39%), Gaps = 79/376 (21%)

Query: 64  DFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGK-LGSVLNPEWFALGS 122
           D E  R+W+ LT  LPL  WY      W LDYPP  AY  + L + + +V+  +      
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 123 SRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182
             G        ++R TVI +E  L++   ++                +I A++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVFINT----SDESERTVNFIIASSIALSPGF 208

Query: 183 ILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLLS 242
           +++DH HFQYN  +  + + +I       +      F   LCFK + L+ +P +F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 243 RSLFS-PSFKFSRF--------------MSVALSTVITFCLM-FSPLYVFGGMKNVLQSI 286
             + +  +F F  +              + V + +++  C + F P+        + Q I
Sbjct: 269 AYVLNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPV--------LPQLI 320

Query: 287 HRIFPFSRGI--------------FEDKVANFW---------CVSNVIVK---------- 313
            R+FPFSRG+              F D++  F          C + +++           
Sbjct: 321 SRLFPFSRGLTHAYWAPNFWAVYAFMDRILTFIMLKMPYVHKCATKIVLPPLIPNSIEEI 380

Query: 314 ----YADNFTQDQLQKLSTFATAAGFLP--SFALVVLYPKKHMIPY-----------GLA 356
                A N+    L +   F       P  +FAL + Y    +IP             L 
Sbjct: 381 KNRIGASNYGTRGLVQDILFIILPQVQPRLTFALTLFYQILAIIPVLFNPSFKRFIGCLT 440

Query: 357 ACSMAFFLFGFQVHEK 372
            C  + FLFG+ VHEK
Sbjct: 441 LCGFSSFLFGWHVHEK 456

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 98  LTAYHSYALGKLGSVLNPEWFALGSSRGNETPELKAYMRFTVILSEAALY-IPAVLYFTK 156
           ++  H Y L   GSV        G  R  +TPE  AY+R  +++S  A Y  P +L  TK
Sbjct: 167 ISNDHKYKLCDFGSVS-------GYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTK 219

Query: 157 WFGIKRR 163
            F +  +
Sbjct: 220 GFSVNDK 226

>TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {ON}
           Anc_8.717 YOR269W
          Length = 431

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 429 WLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVW 471
           W IG     TPRF PG   P PS+S+   T+ R S L  +  W
Sbjct: 315 WKIG-----TPRFKPGTNEPLPSISSSQRTFTRLSTLKGHGSW 352

>NCAS0H01390 Chr8 complement(265088..267538) [2451 bp, 816 aa] {ON}
           Anc_6.123 YBR225W
          Length = 816

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/108 (18%), Positives = 49/108 (45%), Gaps = 5/108 (4%)

Query: 226 KQMALFYSPIFFAYLLSRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNV--- 282
           K+  L Y+     YL  R     S+     +  ++ TV+   + F+PLY +G ++ +   
Sbjct: 215 KKRVLSYTSFLTDYLKVRKSAFESYSLDVDVITSIETVLKSYISFNPLYDYGEIERILEL 274

Query: 283 --LQSIHRIFPFSRGIFEDKVANFWCVSNVIVKYADNFTQDQLQKLST 328
             LQ+   +   + GIF +++  +      +++ ++    + L+ + +
Sbjct: 275 WYLQADKFLLQSNSGIFSNEIIQYLLKRKSLLRQSNQSNNNSLEAIES 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.142    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,697,089
Number of extensions: 2273687
Number of successful extensions: 6252
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6252
Number of HSP's successfully gapped: 55
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)