Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11154g6.23ON30530514800.0
SAKL0E01342g6.23ON34129310761e-147
Kwal_56.224396.23ON32029910721e-147
KAFR0A050806.23ON31129810041e-137
ZYRO0C07722g6.23ON3732979781e-132
KNAG0M011906.23ON3802999711e-131
NCAS0D021706.23ON3102989531e-129
TDEL0G044606.23ON3692969581e-129
KNAG0K01400singletonON3092999521e-129
NDAI0D008306.23ON3742929511e-128
CAGL0F01815gsingletonON3143039441e-127
KNAG0D02240singletonON3592999471e-127
NDAI0C026206.23ON3112999281e-125
KLLA0D01243g6.23ON3112989061e-122
Kpol_385.5singletonON3062938991e-121
TPHA0M002806.23ON3032958981e-121
Kpol_1061.27singletonON3062938941e-120
NCAS0H008406.23ON3602918961e-119
CAGL0I08151gsingletonON3822978951e-119
KAFR0G026806.23ON3832998861e-118
KLLA0F03795g2.265ON30560770.35
AEL201W3.64ON57459712.3
TPHA0P015103.19ON84730712.5
NDAI0I002306.367ON168068694.6
ZYRO0A01342g2.235ON134363686.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KLTH0C11154g
         (918 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   574   0.0  
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   419   e-147
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   417   e-147
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   391   e-137
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   381   e-132
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   378   e-131
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   371   e-129
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              373   e-129
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   371   e-129
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   370   e-128
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   368   e-127
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   369   e-127
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      362   e-125
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   353   e-122
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   350   e-121
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   350   e-121
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   348   e-120
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   349   e-119
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   349   e-119
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     345   e-118
KLLA0F03795g Chr6 (360687..360706,360840..361737) [918 bp, 305 a...    34   0.35 
AEL201W Chr5 (257940..259664) [1725 bp, 574 aa] {ON} Syntenic ho...    32   2.3  
TPHA0P01510 Chr16 complement(306713..309256) [2544 bp, 847 aa] {...    32   2.5  
NDAI0I00230 Chr9 (34862..39904) [5043 bp, 1680 aa] {ON} Anc_6.36...    31   4.6  
ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} simil...    31   6.0  

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  574 bits (1480), Expect = 0.0
 Identities = 284/305 (93%), Positives = 284/305 (93%)
 Frame = +1

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 180
           MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 181 QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 360
           QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 361 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 540
           DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 541 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 720
           RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTD                
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 721 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 900
                VLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

Query: 901 IESCE 915
           IESCE
Sbjct: 301 IESCE 305

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  419 bits (1076), Expect = e-147
 Identities = 199/293 (67%), Positives = 233/293 (79%)
 Frame = +1

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 180
           M+K R+I K+F A+EQSEGVGA+VRRSIG+ +LRNFTPFLMLDHFNV+PPAGFPDHPHHG
Sbjct: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96

Query: 181 QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 360
           QETITYVLGGM+AHEDFTGS+GVLRPGDLQFMTAGKGI+HSEIPV++ESG P+VGLQLWV
Sbjct: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156

Query: 361 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 540
           DLP  LK+CEPRYRDL   E P  +P   L+VRVISGESYGV S SELAYTPVHFYH+I+
Sbjct: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216

Query: 541 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 720
            K GT FEQ FP +FNVFMYVLKGS+ +N K F QYS++FF  D                
Sbjct: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276

Query: 721 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 879
                +L+QP++Q+GPFVETSK+ M +V  +YQ G NGFERA  W SSI+ G+
Sbjct: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGI 329

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  417 bits (1072), Expect = e-147
 Identities = 196/299 (65%), Positives = 238/299 (79%)
 Frame = +1

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 180
           M K RSILKYFTALEQSEGVGAKVRRSIG+Q+LRNFTPFLMLDHF ++PPAGFPDHPHHG
Sbjct: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74

Query: 181 QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 360
           QET+T++L G +AHEDFTGS+GVLR GDLQFMTAGKG +HSEIPV+LESG P+ G+QLWV
Sbjct: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134

Query: 361 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 540
           DLP  LKDC+PRYRDL  + IP+ + K GL + VISG+SYGV S+ ELAYT VH+YHY+ 
Sbjct: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194

Query: 541 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 720
            +   +FEQ FP++FNVF+YVLKG + + G+ F+++SS+FF TD                
Sbjct: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254

Query: 721 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 897
                +LDQPI+QYGPFVETSK+ M EV  NYQSGTNGFE+A GW+SSIA G+V SD++
Sbjct: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  391 bits (1004), Expect = e-137
 Identities = 185/298 (62%), Positives = 223/298 (74%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           R+I K+F A+EQ EGVGA+VRRS+GS   RNFTPFL+LDHF VS PAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GMIAHEDFTGS+G+LRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWVDLP 
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            +KDCEPRYR+L   EIP V+P   L+V+VISG SYGV S+ ELAYTPV FYH+I+ K G
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q  P NFN F+YV+KGSV +  +TF QYS++FFN D                    
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIE 906
            +LDQP++Q+GPF+E++++ + EV  N+Q G NGFERA GW SSI  G++  DV K E
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFE 308

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  381 bits (978), Expect = e-132
 Identities = 185/297 (62%), Positives = 218/297 (73%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RS+LK F A+EQ EGVGA+VRRSIG+ ++R F PFLMLD F V PPAGFPDHPHHGQETI
Sbjct: 74  RSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETI 133

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TY L GMIAHEDFTGS+GVL PGDLQFMTAGKGI+HSEIPV LE G+ S GLQLWVDLP 
Sbjct: 134 TYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPA 193

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            LK+CEPRYRDL   + P V+    L VRVISG+SYGV S+ ELAYTPVHFYH+IT K G
Sbjct: 194 ELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKG 253

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q FP +FNVF Y+LKGS+ VN + F ++S+VFF+TD                    
Sbjct: 254 TEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGG 313

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 903
            +LDQ +LQ+GPFVETS++ M +V  NYQ G NGFE A  W S IA G+  ++  K+
Sbjct: 314 KILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKL 370

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  378 bits (971), Expect = e-131
 Identities = 180/299 (60%), Positives = 223/299 (74%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           R+I K+F A EQ EGVGA+VRRS+GS   RNF+PFL+LDHF VS PAGFPDHPHHGQETI
Sbjct: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GMIAHEDF GS+GVLRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWVDLP 
Sbjct: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            +KDC PRYR+L   EIP  +P   L+++VISG+S+G+ S+ ELAYTPV FYHYI+ K G
Sbjct: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q  P+NFNVF+YV+KG+V ++G+ F QYS+VF+N +                    
Sbjct: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 909
            +LDQP++Q+GPFVET+++ + EV  N+Q G NGFERA GW SSI  G++  DV   E+
Sbjct: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEA 374

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  371 bits (953), Expect = e-129
 Identities = 179/298 (60%), Positives = 220/298 (73%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RS+LK F A+EQ EGVGA VRRSIGS + RNF+PFL++D+F VS PAGFPDHPHHGQETI
Sbjct: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYVL GMIAHEDFTGSRGVLRPGDLQFMTAGK I+HSEIPV++ +G   +G+QLWVDLP 
Sbjct: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            LK+CEPRYR+L   EIP V+P   L VRV+SG+SYGV S+ +LAYTP+ +Y   T+K G
Sbjct: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q FP++FNVF+Y++KGSV +N     QYS++FF TD                    
Sbjct: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIE 906
            +LDQPI+Q+GPFVE+ ++++ EV  NYQ   NGFERA+GW S IA G+   DV   E
Sbjct: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFE 305

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  373 bits (958), Expect = e-129
 Identities = 176/296 (59%), Positives = 219/296 (73%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSI+K F A +Q EGVGA VRRSIG+ ++R F+PFLMLDHF VSPPAGFPDHPHHGQETI
Sbjct: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TY+LGGM+AHEDF+ S+G+L PGDLQFMTAGK IIHSEIPV+++SG P+VGLQLWVDLP 
Sbjct: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            LK+CEPRYRDL   +IP ++P   L+V VISG SYGV S  +LAYTPVH+YH+ T K G
Sbjct: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q FP  FN FMY+LKGS+ +  K F Q+S+VFF+TD                    
Sbjct: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 900
            +L Q ++Q+GPFVET+++ + EV  NYQ+  NGF+R + W S+IA G+  S+  K
Sbjct: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  371 bits (952), Expect = e-129
 Identities = 178/299 (59%), Positives = 218/299 (72%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RS+ K F ALEQ+EGVGA VRRSIG +  RNF+PFL+LDHF VS P+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TY+  GMIAHEDFTGS+G+LRPGDLQFMTAGKGI+HSEIPV  +    +VGLQLWVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
           ++KDC PRYR+L  +EIP  QP   L+V+VISG+SYGV S+ ELAYTPV FYHYI+ K G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
             F Q  P N+N F+YV++GSV+V+G+ + QYS++F+N +                    
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 909
            +LDQ I+Q+GPFVETS + M EV  NYQ G NGFE+A  W SSI  G+   D+   ES
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNFES 304

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  370 bits (951), Expect = e-128
 Identities = 176/292 (60%), Positives = 221/292 (75%), Gaps = 3/292 (1%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPA-GFPDHPHHGQET 189
           R+ILKYF   EQSEGVGA+VRR+IG+ E+  F PFLMLDHF V+PP  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 190 ITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLP 369
           ITY+L GMIAHEDFTGS+GVLRPGDLQFMTAGKGI+HSE+PV ++ G P +GLQLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 370 MHLKDCEPRYRDLLNNEIPSV--QPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITR 543
             LK+CEPRYR+L  NEIP V    +  + V+VISG +YGV S+ +LAYTP+HFYHYI+ 
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 544 KPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXX 723
           K G  F+Q  P +FNVF+YV+KG+V+++ + F Q ++VFFN D                 
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 724 XXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 879
               +LDQP++Q+GPFVET+++++Y+V  NYQ G NGFERA  W SSIA G+
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGI 364

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  368 bits (944), Expect = e-127
 Identities = 177/303 (58%), Positives = 218/303 (71%)
 Frame = +1

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 180
           M   RSI K+F   EQ EGVGA+VRRS+G+ + R F+PFLMLD F V  PAGFPDHPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 181 QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 360
           QETITYVL GM+AHEDFTG++GVL  GDLQFMTAGKGI+HSEIPV++ESG    GLQ WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 361 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 540
           DLP  LK CEPRYR+L  ++IP V+P   L V+VISG+SYGV S+ +LAYTP+H YHY+T
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 541 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 720
            K GT +EQ FP NFNVFMYV+KG V V  + F ++++VFFNTD                
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 721 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 900
                +LDQ  +Q+GPFVET ++++ +V  NYQ G NGFERA+GW SSI  G+    V +
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

Query: 901 IES 909
            E+
Sbjct: 301 NEA 303

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  369 bits (947), Expect = e-127
 Identities = 173/299 (57%), Positives = 220/299 (73%)
 Frame = +1

Query: 7   KPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQE 186
           K RSI  +F   E +EGVGA+V+RS+GS + R FTPFLMLD F V  P+GFPDHPHHGQE
Sbjct: 59  KLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQE 118

Query: 187 TITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDL 366
           TITYV+ G+IAHEDFTGS+GVLRPGDLQFMTAGKGI+HSE+PVE+E G P+ GLQLWVDL
Sbjct: 119 TITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDL 178

Query: 367 PMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRK 546
           P  LK+CEPRYR+L + +IP V+P   LEVRVISG+SYG  S+ +LAYTP+ FY+ +  K
Sbjct: 179 PKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASK 238

Query: 547 PGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXX 726
            GT F Q  PS+FN F+YV+KGSV++N K F Q +++FF+TD                  
Sbjct: 239 AGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAII 298

Query: 727 XXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 903
              +LDQP++Q+GPFVET ++ +YE   NY+  T GFERA+GW S IA G+  S+  ++
Sbjct: 299 GGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQL 357

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  362 bits (928), Expect = e-125
 Identities = 175/299 (58%), Positives = 219/299 (73%), Gaps = 1/299 (0%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RS+ K F A+EQ EGVGA VRRSIGS + RNF+PFL++DHF VS PAGFPDHPHHGQETI
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYVL GMIAHEDFTGS+GVLRPGDLQFMTAGK I+HSEIPV++E+G P +G+QLWV LP+
Sbjct: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            LK+ EPRYR+L  ++IP ++P   L VRVISG+SYG  S+ +LAYTP+ +Y +   K G
Sbjct: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTD-XXXXXXXXXXXXXXXXXXX 729
             F Q  P NFN F+Y+ KG+V +NG  + +YS+VFF+TD                    
Sbjct: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247

Query: 730 XXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIE 906
             +LDQPILQ+GPFVET ++++ +V  NYQ   NGFERA+GW SSIA G++  DV   E
Sbjct: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFE 306

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  353 bits (906), Expect = e-122
 Identities = 168/298 (56%), Positives = 219/298 (73%)
 Frame = +1

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 180
           ++K RS+LK+F A+EQSEG GA V+RSIG+ ++RNF PFLMLD+F+VSPPAGFP+HPHHG
Sbjct: 6   VSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHG 65

Query: 181 QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 360
           QETITYVL GM+AHEDFTGS+GVLR GDLQFMTAGK I+HSEIPV++++G  + GLQLWV
Sbjct: 66  QETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWV 125

Query: 361 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 540
           DLP  +K+ EPRYRDL   EIP   P   L V+VISGESYGV S++ELAYTPV FYH+I 
Sbjct: 126 DLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIA 185

Query: 541 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 720
            K  T F Q F  +F+ F+Y++KGS+ ++ + + + S++FF  D                
Sbjct: 186 NKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFA 245

Query: 721 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDV 894
                  +Q ++QYGPFVE+S++N+ +VI NYQ+G NGFE A+ WS  I  GV  ++V
Sbjct: 246 IIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEV 303

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  350 bits (899), Expect = e-121
 Identities = 173/293 (59%), Positives = 210/293 (71%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSI K+F A EQ+EGVGA+VRRSIG+  LR F+PFLMLDHFNV+P AGFPDHPHHGQETI
Sbjct: 8   RSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GMIAHEDFTG +GVL  GDLQFMTAGK I H+E+PV+  SG   VGLQLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            +K+ EPRYRDL N EIP   P   LEV VISG SYGV S+ +LAYTP+ FY Y  +K G
Sbjct: 128 DMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q+F  +FNVF+YVL+G++ +  + F QYSS+FFNTD                    
Sbjct: 188 TEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIGG 247

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSD 891
            +LDQ  +Q+GPFVE +K+ + +V  +YQS +NGFERA+ W SSI  G+  +D
Sbjct: 248 KILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKEND 300

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  350 bits (898), Expect = e-121
 Identities = 170/295 (57%), Positives = 211/295 (71%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSILK+F A EQ+EGVGA+VRRSIG+ ++R F+PFLMLDHFNV PPAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GM+AHEDFTGS+G+LRPGDLQFMTAGK + HSE+PV +E+G    GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
           +LK+ EPRYRDL    IP  +P   LE+ VISG+SYG+ S+ +LAYTPV FY Y  RK G
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           + F Q F  ++NVF+Y++KGSV +  + F Q+SS+FFNTD                    
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 897
            +L Q  +Q+GPFVE + + + +V  NY+S T GFERA  W SSI  G+  S  A
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  348 bits (894), Expect = e-120
 Identities = 173/293 (59%), Positives = 208/293 (70%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSI K+F + EQSEGVGA+VRRSIG+  LR F+PFLMLDHFNV+P AGFPDHPHHGQETI
Sbjct: 8   RSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GMIAHEDFTG +GVL  GDLQFMTAGK I H+E+PV+  SG   VGLQLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            +K+ EPRYRDL N +IP   P   LE+ VISG SYGV S+ +LAYTP+ FY Y  +K G
Sbjct: 128 DMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q F  +FNVF+YVLKG+V +  + F QYSS+FFNTD                    
Sbjct: 188 TEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIGG 247

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSD 891
            +LDQ  +Q+GPFVE +K+ + +V  +YQS +NGFERA+ W SSI  G+   D
Sbjct: 248 KILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDD 300

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  349 bits (896), Expect = e-119
 Identities = 166/291 (57%), Positives = 209/291 (71%)
 Frame = +1

Query: 7   KPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQE 186
           K RSILK+F A EQSEG GA VRRS+GS ++  F+PFLMLD F V+PP GFPDHPHHGQE
Sbjct: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119

Query: 187 TITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDL 366
           TITYV GG++AHEDFTGS+GVL PGDLQFMTAGKGI+H E+PV +   A S GLQ WVDL
Sbjct: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179

Query: 367 PMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRK 546
           P  LK+CEPRYR+L  + IP VQ    L V+VISG+SY V S+ +LAYTP+ FY++I+ K
Sbjct: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239

Query: 547 PGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXX 726
            GT F Q  P +FN F+YV KG++ +  + F  +SSVFF TD                  
Sbjct: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299

Query: 727 XXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 879
              +LDQ ++Q+GPFVET+++ + EV  NY++G NGFE+A GW SSI+ G+
Sbjct: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGI 350

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  349 bits (895), Expect = e-119
 Identities = 169/297 (56%), Positives = 205/297 (69%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSIL +F A EQ EGVGA+VRRS+G+ ++R FTPFLMLD F V+PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYV  GMIAHED TGS+GVL  GDLQFMTAGKGI+HSEIPV  + G P  GLQLWVDLP 
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            +K+ +PRYR+L  NE P   P   LEVRVISG+SYGV S+ +LAYTPVH YH++  K G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q  P +FNVF+YV+KGS+ VN      +SS FF+ D                    
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 903
            +LDQ ++Q+GPFVET+++ + EV  NYQ   NGFE A  W SSI  G+   +  K+
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKL 379

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  345 bits (886), Expect = e-118
 Identities = 164/299 (54%), Positives = 213/299 (71%)
 Frame = +1

Query: 13  RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 192
           RSI+ +F   E  EG GA+V+RSIGS E R F PFLMLD F+V+PPAGFPDHPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 193 TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 372
           TYVL GMIAHEDFTG  G+L PGDLQFMTAG+GI+HSEIPV +E+G    GLQLWVDLP 
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 373 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 552
            LK  EPRYR+L   +IP   P   L+V VISG+SY V S+++LAYTPVH YH++T K G
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 553 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 732
           T F Q FP +FNVF+YV+KG+V++N K F + +++FF+ D                    
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 733 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 909
            +L+QP++Q GPFVET KQ + +V  +++S  NGFERA+ W S+I +G+  ++  ++ +
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARELRT 383

>KLLA0F03795g Chr6 (360687..360706,360840..361737) [918 bp, 305 aa]
           {ON} similar to uniprot|P40484 Saccharomyces cerevisiae
           YIL106W MOB1 Mps One Binder;(putative) transcriptional
           regulator involved in mitosis
          Length = 305

 Score = 34.3 bits (77), Expect = 0.35
 Identities = 17/60 (28%), Positives = 28/60 (46%)
 Frame = +1

Query: 391 PRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPGTTFEQH 570
           P++ D +  ++ + Q +A       SG  +G G +++  YTP H   YI    GT    H
Sbjct: 56  PQFNDNMPQQLSTPQKQATTAHLFQSGLDHGAGPVTDFNYTPSHQRPYIQSTSGTVVSSH 115

>AEL201W Chr5 (257940..259664) [1725 bp, 574 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL293W (MSB3) and
           YOL112W (MSB4)
          Length = 574

 Score = 32.0 bits (71), Expect = 2.3
 Identities = 15/59 (25%), Positives = 23/59 (38%)
 Frame = +3

Query: 231 YGFSRRLKTGRPPVYDCWQRXXXXXXXXRA*EWRTLCGATTVGRSSDAPQRLRTSLQRL 407
           YGF ++ +      YD W          R  +WR L     +G   D P R  +  ++L
Sbjct: 148 YGFKKQTQYVSEEAYDAWWEGYSKYCIRRKHKWRALLAKAGLGLDGDNPDRFPSKSEKL 206

>TPHA0P01510 Chr16 complement(306713..309256) [2544 bp, 847 aa] {ON}
           Anc_3.19 YNL321W
          Length = 847

 Score = 32.0 bits (71), Expect = 2.5
 Identities = 9/30 (30%), Positives = 21/30 (70%)
 Frame = +2

Query: 341 WGYNCGSIFRCTSKIANLATETCSIMRFQV 430
           +G+ CGS ++ T +  + A +TC ++R+++
Sbjct: 537 YGFECGSAYKTTQRYLSTAMDTCHVIRYEL 566

>NDAI0I00230 Chr9 (34862..39904) [5043 bp, 1680 aa] {ON} Anc_6.367
            YCR089W
          Length = 1680

 Score = 31.2 bits (69), Expect = 4.6
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = -2

Query: 392  GSQSLRCIGRSTHSCSPTEGAPLSSS--TGIS-E*IIPLPAVINWRSPGLKTPREPVKSS 222
            G  S  CIG   H+CSPT  +   SS  T IS   ++ +PA+I   SP +    + + S+
Sbjct: 1357 GKSSTLCIG---HNCSPTPSSSFESSMTTSISFSTLVSIPALITTTSPSVP---QYISST 1410

Query: 221  CAIIPPRT 198
              I   RT
Sbjct: 1411 STISSDRT 1418

>ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} similar
           to uniprot|P32597 Saccharomyces cerevisiae YIL126W STH1
           helicase related protein snf2 homolog
          Length = 1343

 Score = 30.8 bits (68), Expect = 6.0
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +1

Query: 490 SMSELAYTPVHFYHYITR--KPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQ-YSSVF 660
           S S+L+YT  H+YH   R    GT  + + P  + +  +VL   +  + KTF   +++ F
Sbjct: 601 SQSKLSYTITHYYHTKNRLILTGTPLQNNLPELWALLNFVLP-KIFNSAKTFEDWFNTPF 659

Query: 661 FNT 669
            NT
Sbjct: 660 ANT 662

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,898,027
Number of extensions: 2194866
Number of successful extensions: 5837
Number of sequences better than 10.0: 25
Number of HSP's gapped: 5808
Number of HSP's successfully gapped: 25
Length of query: 306
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 197
Effective length of database: 40,982,805
Effective search space: 8073612585
Effective search space used: 8073612585
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 33 (17.3 bits)