Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11154g6.23ON30530514960.0
Kwal_56.224396.23ON32029910951e-150
SAKL0E01342g6.23ON34130010941e-150
KAFR0A050806.23ON31130010081e-137
ZYRO0C07722g6.23ON3732979951e-134
KNAG0M011906.23ON3803049841e-133
NCAS0D021706.23ON3102999761e-132
TDEL0G044606.23ON3692969761e-132
NDAI0D008306.23ON3742959761e-131
KNAG0K01400singletonON3092999681e-131
KNAG0D02240singletonON3592999651e-130
CAGL0F01815gsingletonON3143039591e-130
NDAI0C026206.23ON3113019451e-128
Kpol_385.5singletonON3062949241e-125
KLLA0D01243g6.23ON3113009211e-124
Kpol_1061.27singletonON3062949181e-124
TPHA0M002806.23ON3032959141e-123
CAGL0I08151gsingletonON3822979211e-123
NCAS0H008406.23ON3602919141e-122
KAFR0G026806.23ON3832999021e-120
KLLA0F03795g2.265ON30560721.2
ZYRO0A01342g2.235ON134363693.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11154g
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   580   0.0  
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   426   e-150
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   426   e-150
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   392   e-137
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   387   e-134
KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   383   e-133
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   380   e-132
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              380   e-132
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   380   e-131
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   377   e-131
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   376   e-130
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   374   e-130
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      368   e-128
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   360   e-125
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   359   e-124
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   358   e-124
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   356   e-123
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   359   e-123
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   356   e-122
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     352   e-120
KLLA0F03795g Chr6 (360687..360706,360840..361737) [918 bp, 305 a...    32   1.2  
ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} simil...    31   3.8  

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/305 (93%), Positives = 284/305 (93%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
           RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTD                
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
                VLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

Query: 301 IESCE 305
           IESCE
Sbjct: 301 IESCE 305

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  426 bits (1095), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 196/299 (65%), Positives = 238/299 (79%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           M K RSILKYFTALEQSEGVGAKVRRSIG+Q+LRNFTPFLMLDHF ++PPAGFPDHPHHG
Sbjct: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QET+T++L G +AHEDFTGS+GVLR GDLQFMTAGKG +HSEIPV+LESG P+ G+QLWV
Sbjct: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLP  LKDC+PRYRDL  + IP+ + K GL + VISG+SYGV S+ ELAYT VH+YHY+ 
Sbjct: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
            +   +FEQ FP++FNVF+YVLKG + + G+ F+++SS+FF TD                
Sbjct: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 299
                +LDQPI+QYGPFVETSK+ M EV  NYQSGTNGFE+A GW+SSIA G+V SD++
Sbjct: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDIS 313

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  426 bits (1094), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/300 (66%), Positives = 235/300 (78%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           M+K R+I K+F A+EQSEGVGA+VRRSIG+ +LRNFTPFLMLDHFNV+PPAGFPDHPHHG
Sbjct: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITYVLGGM+AHEDFTGS+GVLRPGDLQFMTAGKGI+HSEIPV++ESG P+VGLQLWV
Sbjct: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLP  LK+CEPRYRDL   E P  +P   L+VRVISGESYGV S SELAYTPVHFYH+I+
Sbjct: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
            K GT FEQ FP +FNVFMYVLKGS+ +N K F QYS++FF  D                
Sbjct: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
                +L+QP++Q+GPFVETSK+ M +V  +YQ G NGFERA  W SSI+ G+   +  K
Sbjct: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNAEK 336

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 185/300 (61%), Positives = 223/300 (74%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           R+I K+F A+EQ EGVGA+VRRS+GS   RNFTPFL+LDHF VS PAGFPDHPHHGQETI
Sbjct: 11  RTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQETI 70

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYV  GMIAHEDFTGS+G+LRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWVDLP 
Sbjct: 71  TYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPQ 130

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            +KDCEPRYR+L   EIP V+P   L+V+VISG SYGV S+ ELAYTPV FYH+I+ K G
Sbjct: 131 EMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKKG 190

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q  P NFN F+YV+KGSV +  +TF QYS++FFN D                    
Sbjct: 191 TDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIGG 250

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIESC 304
            +LDQP++Q+GPF+E++++ + EV  N+Q G NGFERA GW SSI  G++  DV K E  
Sbjct: 251 LILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEGS 310

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  387 bits (995), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 218/297 (73%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RS+LK F A+EQ EGVGA+VRRSIG+ ++R F PFLMLD F V PPAGFPDHPHHGQETI
Sbjct: 74  RSVLKNFIAIEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETI 133

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TY L GMIAHEDFTGS+GVL PGDLQFMTAGKGI+HSEIPV LE G+ S GLQLWVDLP 
Sbjct: 134 TYNLKGMIAHEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPA 193

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            LK+CEPRYRDL   + P V+    L VRVISG+SYGV S+ ELAYTPVHFYH+IT K G
Sbjct: 194 ELKNCEPRYRDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKG 253

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q FP +FNVF Y+LKGS+ VN + F ++S+VFF+TD                    
Sbjct: 254 TEFAQEFPKDFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGG 313

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 301
            +LDQ +LQ+GPFVETS++ M +V  NYQ G NGFE A  W S IA G+  ++  K+
Sbjct: 314 KILDQEVLQHGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEARKL 370

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  383 bits (984), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 181/304 (59%), Positives = 225/304 (74%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           M + R+I K+F A EQ EGVGA+VRRS+GS   RNF+PFL+LDHF VS PAGFPDHPHHG
Sbjct: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITYV  GMIAHEDF GS+GVLRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWV
Sbjct: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLP  +KDC PRYR+L   EIP  +P   L+++VISG+S+G+ S+ ELAYTPV FYHYI+
Sbjct: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
            K GT F Q  P+NFNVF+YV+KG+V ++G+ F QYS+VF+N +                
Sbjct: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
                +LDQP++Q+GPFVET+++ + EV  N+Q G NGFERA GW SSI  G++  DV  
Sbjct: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPA 371

Query: 301 IESC 304
            E+ 
Sbjct: 372 FEAA 375

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/299 (59%), Positives = 220/299 (73%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RS+LK F A+EQ EGVGA VRRSIGS + RNF+PFL++D+F VS PAGFPDHPHHGQETI
Sbjct: 8   RSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQETI 67

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYVL GMIAHEDFTGSRGVLRPGDLQFMTAGK I+HSEIPV++ +G   +G+QLWVDLP 
Sbjct: 68  TYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDLPK 127

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            LK+CEPRYR+L   EIP V+P   L VRV+SG+SYGV S+ +LAYTP+ +Y   T+K G
Sbjct: 128 KLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKKTG 187

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q FP++FNVF+Y++KGSV +N     QYS++FF TD                    
Sbjct: 188 TEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLVGG 247

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303
            +LDQPI+Q+GPFVE+ ++++ EV  NYQ   NGFERA+GW S IA G+   DV   E 
Sbjct: 248 QILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFEK 306

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  380 bits (976), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/296 (59%), Positives = 219/296 (73%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSI+K F A +Q EGVGA VRRSIG+ ++R F+PFLMLDHF VSPPAGFPDHPHHGQETI
Sbjct: 65  RSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQETI 124

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TY+LGGM+AHEDF+ S+G+L PGDLQFMTAGK IIHSEIPV+++SG P+VGLQLWVDLP 
Sbjct: 125 TYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDLPE 184

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            LK+CEPRYRDL   +IP ++P   L+V VISG SYGV S  +LAYTPVH+YH+ T K G
Sbjct: 185 KLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSKKG 244

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q FP  FN FMY+LKGS+ +  K F Q+S+VFF+TD                    
Sbjct: 245 TEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLIGG 304

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
            +L Q ++Q+GPFVET+++ + EV  NYQ+  NGF+R + W S+IA G+  S+  K
Sbjct: 305 EILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEAKK 360

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  380 bits (976), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/295 (59%), Positives = 222/295 (75%), Gaps = 3/295 (1%)

Query: 2   NKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPA-GFPDHPHHG 60
           +  R+ILKYF   EQSEGVGA+VRR+IG+ E+  F PFLMLDHF V+PP  GFPDHPHHG
Sbjct: 70  DDARTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHG 129

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITY+L GMIAHEDFTGS+GVLRPGDLQFMTAGKGI+HSE+PV ++ G P +GLQLWV
Sbjct: 130 QETITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWV 189

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQ--PKAGLEVRVISGESYGVGSMSELAYTPVHFYHY 178
           DLP  LK+CEPRYR+L  NEIP V    +  + V+VISG +YGV S+ +LAYTP+HFYHY
Sbjct: 190 DLPRELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHY 249

Query: 179 ITRKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXX 238
           I+ K G  F+Q  P +FNVF+YV+KG+V+++ + F Q ++VFFN D              
Sbjct: 250 ISDKAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTE 309

Query: 239 XXXXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 293
                  +LDQP++Q+GPFVET+++++Y+V  NYQ G NGFERA  W SSIA G+
Sbjct: 310 FAIIGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGI 364

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 178/299 (59%), Positives = 218/299 (72%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RS+ K F ALEQ+EGVGA VRRSIG +  RNF+PFL+LDHF VS P+GFPDHPHHGQETI
Sbjct: 6   RSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQETI 65

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TY+  GMIAHEDFTGS+G+LRPGDLQFMTAGKGI+HSEIPV  +    +VGLQLWVDLP 
Sbjct: 66  TYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLPK 125

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
           ++KDC PRYR+L  +EIP  QP   L+V+VISG+SYGV S+ ELAYTPV FYHYI+ K G
Sbjct: 126 NMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKEG 185

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
             F Q  P N+N F+YV++GSV+V+G+ + QYS++F+N +                    
Sbjct: 186 INFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIAG 245

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303
            +LDQ I+Q+GPFVETS + M EV  NYQ G NGFE+A  W SSI  G+   D+   ES
Sbjct: 246 LILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNFES 304

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  376 bits (965), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 173/299 (57%), Positives = 220/299 (73%)

Query: 3   KPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQE 62
           K RSI  +F   E +EGVGA+V+RS+GS + R FTPFLMLD F V  P+GFPDHPHHGQE
Sbjct: 59  KLRSIANHFIPREVAEGVGARVKRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQE 118

Query: 63  TITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDL 122
           TITYV+ G+IAHEDFTGS+GVLRPGDLQFMTAGKGI+HSE+PVE+E G P+ GLQLWVDL
Sbjct: 119 TITYVIDGLIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDL 178

Query: 123 PMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRK 182
           P  LK+CEPRYR+L + +IP V+P   LEVRVISG+SYG  S+ +LAYTP+ FY+ +  K
Sbjct: 179 PKDLKNCEPRYRNLRSEDIPVVKPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASK 238

Query: 183 PGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXX 242
            GT F Q  PS+FN F+YV+KGSV++N K F Q +++FF+TD                  
Sbjct: 239 AGTEFAQEIPSDFNAFLYVMKGSVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAII 298

Query: 243 XXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 301
              +LDQP++Q+GPFVET ++ +YE   NY+  T GFERA+GW S IA G+  S+  ++
Sbjct: 299 GGKILDQPLVQHGPFVETDQEKLYEAFMNYEGYTKGFERAKGWRSDIASGINESEAKQL 357

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  374 bits (959), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/303 (58%), Positives = 218/303 (71%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           M   RSI K+F   EQ EGVGA+VRRS+G+ + R F+PFLMLD F V  PAGFPDHPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITYVL GM+AHEDFTG++GVL  GDLQFMTAGKGI+HSEIPV++ESG    GLQ WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLP  LK CEPRYR+L  ++IP V+P   L V+VISG+SYGV S+ +LAYTP+H YHY+T
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
            K GT +EQ FP NFNVFMYV+KG V V  + F ++++VFFNTD                
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
                +LDQ  +Q+GPFVET ++++ +V  NYQ G NGFERA+GW SSI  G+    V +
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

Query: 301 IES 303
            E+
Sbjct: 301 NEA 303

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  368 bits (945), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 219/301 (72%), Gaps = 1/301 (0%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RS+ K F A+EQ EGVGA VRRSIGS + RNF+PFL++DHF VS PAGFPDHPHHGQETI
Sbjct: 8   RSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHHGQETI 67

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYVL GMIAHEDFTGS+GVLRPGDLQFMTAGK I+HSEIPV++E+G P +G+QLWV LP+
Sbjct: 68  TYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLWVALPI 127

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            LK+ EPRYR+L  ++IP ++P   L VRVISG+SYG  S+ +LAYTP+ +Y +   K G
Sbjct: 128 DLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFNMNKKG 187

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTD-XXXXXXXXXXXXXXXXXXX 243
             F Q  P NFN F+Y+ KG+V +NG  + +YS+VFF+TD                    
Sbjct: 188 VEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETEFAIIG 247

Query: 244 XXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303
             +LDQPILQ+GPFVET ++++ +V  NYQ   NGFERA+GW SSIA G++  DV   E 
Sbjct: 248 GLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDVPAFEK 307

Query: 304 C 304
            
Sbjct: 308 S 308

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  360 bits (924), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/294 (58%), Positives = 210/294 (71%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSI K+F A EQ+EGVGA+VRRSIG+  LR F+PFLMLDHFNV+P AGFPDHPHHGQETI
Sbjct: 8   RSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYV  GMIAHEDFTG +GVL  GDLQFMTAGK I H+E+PV+  SG   VGLQLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            +K+ EPRYRDL N EIP   P   LEV VISG SYGV S+ +LAYTP+ FY Y  +K G
Sbjct: 128 DMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q+F  +FNVF+YVL+G++ +  + F QYSS+FFNTD                    
Sbjct: 188 TEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIGG 247

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDV 298
            +LDQ  +Q+GPFVE +K+ + +V  +YQS +NGFERA+ W SSI  G+  +D 
Sbjct: 248 KILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDA 301

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 168/300 (56%), Positives = 220/300 (73%)

Query: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60
           ++K RS+LK+F A+EQSEG GA V+RSIG+ ++RNF PFLMLD+F+VSPPAGFP+HPHHG
Sbjct: 6   VSKVRSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHG 65

Query: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120
           QETITYVL GM+AHEDFTGS+GVLR GDLQFMTAGK I+HSEIPV++++G  + GLQLWV
Sbjct: 66  QETITYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWV 125

Query: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180
           DLP  +K+ EPRYRDL   EIP   P   L V+VISGESYGV S++ELAYTPV FYH+I 
Sbjct: 126 DLPNDIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIA 185

Query: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXX 240
            K  T F Q F  +F+ F+Y++KGS+ ++ + + + S++FF  D                
Sbjct: 186 NKKNTEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFA 245

Query: 241 XXXXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300
                  +Q ++QYGPFVE+S++N+ +VI NYQ+G NGFE A+ WS  I  GV  ++V +
Sbjct: 246 IIAGKYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQ 305

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/294 (58%), Positives = 208/294 (70%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSI K+F + EQSEGVGA+VRRSIG+  LR F+PFLMLDHFNV+P AGFPDHPHHGQETI
Sbjct: 8   RSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQETI 67

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYV  GMIAHEDFTG +GVL  GDLQFMTAGK I H+E+PV+  SG   VGLQLWVDLP 
Sbjct: 68  TYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLPT 127

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            +K+ EPRYRDL N +IP   P   LE+ VISG SYGV S+ +LAYTP+ FY Y  +K G
Sbjct: 128 DMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKAG 187

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q F  +FNVF+YVLKG+V +  + F QYSS+FFNTD                    
Sbjct: 188 TEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIGG 247

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDV 298
            +LDQ  +Q+GPFVE +K+ + +V  +YQS +NGFERA+ W SSI  G+   D 
Sbjct: 248 KILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDA 301

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 170/295 (57%), Positives = 211/295 (71%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSILK+F A EQ+EGVGA+VRRSIG+ ++R F+PFLMLDHFNV PPAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYV  GM+AHEDFTGS+G+LRPGDLQFMTAGK + HSE+PV +E+G    GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
           +LK+ EPRYRDL    IP  +P   LE+ VISG+SYG+ S+ +LAYTPV FY Y  RK G
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           + F Q F  ++NVF+Y++KGSV +  + F Q+SS+FFNTD                    
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVA 299
            +L Q  +Q+GPFVE + + + +V  NY+S T GFERA  W SSI  G+  S  A
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDESQAA 300

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  359 bits (921), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/297 (56%), Positives = 205/297 (69%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSIL +F A EQ EGVGA+VRRS+G+ ++R FTPFLMLD F V+PP GFPDHPHHGQETI
Sbjct: 83  RSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETI 142

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYV  GMIAHED TGS+GVL  GDLQFMTAGKGI+HSEIPV  + G P  GLQLWVDLP 
Sbjct: 143 TYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPS 202

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            +K+ +PRYR+L  NE P   P   LEVRVISG+SYGV S+ +LAYTPVH YH++  K G
Sbjct: 203 DMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTG 262

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q  P +FNVF+YV+KGS+ VN      +SS FF+ D                    
Sbjct: 263 TEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAG 322

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKI 301
            +LDQ ++Q+GPFVET+++ + EV  NYQ   NGFE A  W SSI  G+   +  K+
Sbjct: 323 RILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKL 379

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  356 bits (914), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/291 (57%), Positives = 209/291 (71%)

Query: 3   KPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQE 62
           K RSILK+F A EQSEG GA VRRS+GS ++  F+PFLMLD F V+PP GFPDHPHHGQE
Sbjct: 60  KERSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQE 119

Query: 63  TITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDL 122
           TITYV GG++AHEDFTGS+GVL PGDLQFMTAGKGI+H E+PV +   A S GLQ WVDL
Sbjct: 120 TITYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDL 179

Query: 123 PMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRK 182
           P  LK+CEPRYR+L  + IP VQ    L V+VISG+SY V S+ +LAYTP+ FY++I+ K
Sbjct: 180 PADLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNK 239

Query: 183 PGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXX 242
            GT F Q  P +FN F+YV KG++ +  + F  +SSVFF TD                  
Sbjct: 240 AGTEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVI 299

Query: 243 XXXVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGV 293
              +LDQ ++Q+GPFVET+++ + EV  NY++G NGFE+A GW SSI+ G+
Sbjct: 300 GGKILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGI 350

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  352 bits (902), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/299 (54%), Positives = 213/299 (71%)

Query: 5   RSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHGQETI 64
           RSI+ +F   E  EG GA+V+RSIGS E R F PFLMLD F+V+PPAGFPDHPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 65  TYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWVDLPM 124
           TYVL GMIAHEDFTG  G+L PGDLQFMTAG+GI+HSEIPV +E+G    GLQLWVDLP 
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 125 HLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPG 184
            LK  EPRYR+L   +IP   P   L+V VISG+SY V S+++LAYTPVH YH++T K G
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 185 TTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDXXXXXXXXXXXXXXXXXXXX 244
           T F Q FP +FNVF+YV+KG+V++N K F + +++FF+ D                    
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 245 XVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAKIES 303
            +L+QP++Q GPFVET KQ + +V  +++S  NGFERA+ W S+I +G+  ++  ++ +
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEARELRT 383

>KLLA0F03795g Chr6 (360687..360706,360840..361737) [918 bp, 305 aa]
           {ON} similar to uniprot|P40484 Saccharomyces cerevisiae
           YIL106W MOB1 Mps One Binder;(putative) transcriptional
           regulator involved in mitosis
          Length = 305

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 131 PRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYITRKPGTTFEQH 190
           P++ D +  ++ + Q +A       SG  +G G +++  YTP H   YI    GT    H
Sbjct: 56  PQFNDNMPQQLSTPQKQATTAHLFQSGLDHGAGPVTDFNYTPSHQRPYIQSTSGTVVSSH 115

>ZYRO0A01342g Chr1 (104605..108636) [4032 bp, 1343 aa] {ON} similar
           to uniprot|P32597 Saccharomyces cerevisiae YIL126W STH1
           helicase related protein snf2 homolog
          Length = 1343

 Score = 31.2 bits (69), Expect = 3.8,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 164 SMSELAYTPVHFYHYITR--KPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQ-YSSVF 220
           S S+L+YT  H+YH   R    GT  + + P  + +  +VL   +  + KTF   +++ F
Sbjct: 601 SQSKLSYTITHYYHTKNRLILTGTPLQNNLPELWALLNFVLP-KIFNSAKTFEDWFNTPF 659

Query: 221 FNT 223
            NT
Sbjct: 660 ANT 662

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,501,860
Number of extensions: 1323584
Number of successful extensions: 2371
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2373
Number of HSP's successfully gapped: 23
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)