Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11110g6.26ON28028013090.0
Kwal_56.224436.26ON28024410921e-151
SAKL0E01408g6.26ON3072198351e-111
TDEL0G044306.26ON3472547391e-96
Ecym_30296.26ON3512217348e-96
CAGL0E02541g6.26ON3422377261e-94
KLLA0D01287g6.26ON3452267218e-94
KNAG0I017506.26ON3242657181e-93
ZYRO0C07634g6.26ON3822297221e-93
Kpol_1037.306.26ON3672367081e-91
Suva_15.1746.26ON2952416923e-90
Smik_15.1696.26ON2912446862e-89
ACR001C6.26ON3462276896e-89
YOL001W (PHO80)6.26ON2932416838e-89
TPHA0J003806.26ON3562436741e-86
Skud_15.1616.26ON2932296672e-86
TBLA0A071606.26ON2682336295e-81
NCAS0D021506.26ON3692345386e-66
NDAI0C026406.26ON4272585261e-63
Smik_9.1407.240ON2851982152e-19
Suva_9.1497.240ON2861982091e-18
Skud_9.1197.240ON2851572046e-18
YIL050W (PCL7)7.240ON2851981968e-17
ADL075W7.240ON2071491691e-13
SAKL0F08602g7.240ON4741881751e-13
KNAG0D016307.240ON4381721681e-12
KLTH0A04268g7.240ON5801181672e-12
NCAS0E032207.240ON3412151652e-12
Ecym_43367.240ON3851491634e-12
Kwal_23.58077.240ON4651241635e-12
CAGL0M12342g7.240ON4571191582e-11
KLLA0C08305g7.240ON4092191582e-11
TDEL0H020207.240ON3632101563e-11
KAFR0L008807.240ON3131861553e-11
NCAS0A134807.240ON4481781564e-11
KAFR0I018407.240ON3251461511e-10
NDAI0A025607.240ON5031191493e-10
TPHA0C010907.240ON3851961484e-10
KNAG0L014707.240ON3541711413e-09
ZYRO0C08118g7.240ON4051461308e-08
TBLA0D040707.240ON661801291e-07
Kpol_1033.137.240ON250601252e-07
Smik_5.1897.240ON415601253e-07
Suva_5.1677.240ON424601254e-07
YER059W (PCL6)7.240ON420601237e-07
Skud_5.1737.240ON420601227e-07
NDAI0E047707.240ON3031411191e-06
Kpol_2000.147.289ON3101421191e-06
TBLA0C048507.289ON3681411164e-06
Skud_7.1396.236ON4341851093e-05
Smik_7.1386.236ON4371581041e-04
CAGL0E02233g3.70ON2661111022e-04
KNAG0A014903.70ON262131994e-04
SAKL0F09856g7.289ON3351281004e-04
NCAS0D040706.236ON4731151005e-04
Smik_4.1107.289ON308125996e-04
YGL134W (PCL10)6.236ON433108996e-04
NCAS0A137707.289ON312148978e-04
YDL127W (PCL2)7.289ON308104970.001
Suva_14.503.70ON279104960.001
TPHA0A005803.70ON289153940.002
AFR159C7.289ON308110930.003
Ecym_80387.289ON314112930.003
Suva_4.1187.289ON309111910.005
Kpol_1020.87.289ON296139910.005
ZYRO0C09284g7.289ON311105900.006
CAGL0J09328g7.289ON297145890.007
TBLA0A078903.70ON361126890.010
KLTH0A05346g7.289ON301140880.010
YNL289W (PCL1)3.70ON279104880.011
ZYRO0C02068g3.70ON330118880.011
Smik_14.423.70ON279104880.012
Skud_14.483.70ON279104880.012
YPL219W (PCL8)6.236ON492140890.012
TBLA0J006507.289ON363131880.012
Suva_16.876.236ON501140870.021
TDEL0H015507.289ON309114850.024
SAKL0A03938g6.236ON501139850.032
Kpol_1020.163.70ON282132830.048
NDAI0A022707.289ON330114830.049
TPHA0P008107.289ON24798820.051
Kwal_23.60067.289ON304143830.055
Skud_16.606.236ON500122830.056
KNAG0F018706.236ON48394830.067
Skud_4.1287.289ON308109820.075
KNAG0B029307.289ON312129810.094
Skud_4.797.289ON309111810.095
NDAI0C019805.347ON226117800.11
Smik_6.4246.236ON492122810.12
KLLA0E13223g3.70ON282100790.14
TDEL0E007903.70ON25497770.22
KLLA0F05654g7.289ON311130760.39
AEL195W3.70ON237109750.46
Ecym_12013.527ON44467740.65
SAKL0C12100g3.70ON314113730.77
CAGL0J06336g7.289ON314129721.3
NDAI0A060503.70ON28697711.4
NCAS0A098703.70ON29479711.5
KAFR0A082803.70ON241113701.9
KAFR0C015603.70ON26779692.2
Kwal_23.52313.70ON25690692.4
CAGL0E05918g6.236ON481121692.9
TPHA0A032507.289ON28955674.5
Skud_16.4947.547ON655105667.7
NCAS0A009606.236ON45199668.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11110g
         (280 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   508   0.0  
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   425   e-151
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   326   e-111
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   289   1e-96
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   287   8e-96
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   284   1e-94
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   282   8e-94
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   281   1e-93
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   282   1e-93
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   277   1e-91
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   271   3e-90
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   268   2e-89
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   270   6e-89
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   267   8e-89
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   264   1e-86
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   261   2e-86
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   246   5e-81
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     211   6e-66
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   207   1e-63
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    87   2e-19
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    85   1e-18
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    83   6e-18
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    80   8e-17
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    70   1e-13
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    72   1e-13
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    69   1e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    69   2e-12
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    68   2e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    67   4e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    67   5e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    65   2e-11
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    65   2e-11
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    65   3e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    64   3e-11
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    65   4e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    63   1e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    62   3e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    62   4e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    59   3e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    55   8e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    54   1e-07
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   2e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    53   3e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    53   4e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    52   7e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    52   7e-07
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    50   1e-06
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    50   1e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    49   4e-06
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    47   3e-05
Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W ...    45   1e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    44   2e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    43   4e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    43   4e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     43   5e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    43   6e-04
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    43   6e-04
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    42   8e-04
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    42   0.001
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    41   0.002
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    40   0.003
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    40   0.003
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    40   0.005
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    40   0.005
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    39   0.006
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    39   0.007
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    39   0.010
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    39   0.010
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    39   0.011
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.011
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    39   0.012
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    39   0.012
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    39   0.012
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    39   0.012
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    38   0.021
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    37   0.024
SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly...    37   0.032
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    37   0.048
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      37   0.049
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    36   0.051
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    37   0.055
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    37   0.056
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    37   0.067
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    36   0.075
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    36   0.094
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    36   0.095
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    35   0.11 
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    36   0.12 
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    35   0.14 
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    34   0.22 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    34   0.39 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    33   0.46 
Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar t...    33   0.65 
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    33   0.77 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    32   1.3  
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    32   1.4  
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    32   1.5  
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    32   1.9  
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    31   2.2  
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    31   2.4  
CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {...    31   2.9  
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    30   4.5  
Skud_16.494 Chr16 complement(859384..861351) [1968 bp, 655 aa] {...    30   7.7  
NCAS0A00960 Chr1 (190738..192093) [1356 bp, 451 aa] {ON} Anc_6.2...    30   8.1  

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/280 (88%), Positives = 249/280 (88%)

Query: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60
           MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI
Sbjct: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60

Query: 61  NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAF 120
           NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAF
Sbjct: 61  NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAF 120

Query: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILP 180
           SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILP
Sbjct: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILP 180

Query: 181 RDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240
           RDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA
Sbjct: 181 RDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240

Query: 241 HYVMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKKPA 280
           HYVM                               CKKPA
Sbjct: 241 HYVMKTPPAPREAEAPKKKRAHEESESAGSQASSSCKKPA 280

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  425 bits (1092), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 220/244 (90%)

Query: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60
           MSDKESG  SAK+P   +       E PVPEVALP DFSQC RTDLVILISRMLSFL RI
Sbjct: 1   MSDKESGCLSAKNPGSPKSPGERLEEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRI 60

Query: 61  NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAF 120
           NDS+PKD++ ELTRFHSRVPPQISVYDY+MRLTRYSSLEPAVL+ASVYYIDLLSAMY +F
Sbjct: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSF 120

Query: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILP 180
           SLNSLTVHRFLLTATTV SKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLK+VNYRILP
Sbjct: 121 SLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILP 180

Query: 181 RDDNILNCKAERREGLFVTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240
           RDDNI NCKAE++ GLFVT TY+K  RGPNNGFNVLDTYY+KIIEIVGS+DSSPDKTKRA
Sbjct: 181 RDDNISNCKAEKKAGLFVTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRA 240

Query: 241 HYVM 244
           HYVM
Sbjct: 241 HYVM 244

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  326 bits (835), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 153/219 (69%), Positives = 188/219 (85%)

Query: 26  EDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISV 85
           E    ++ LP++F +C RT LV+LISRMLS LI++NDS+ KD + +LTRFHSRVPP ISV
Sbjct: 41  EQTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKNLKLTRFHSRVPPGISV 100

Query: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145
           Y+YL+RL +YSSLEPAVLIA+VYYIDLLS++Y +F+LNSLTVHRFLLTATTV SKGL DS
Sbjct: 101 YNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDS 160

Query: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVTATYAKE 205
           FCTN HYAKVGGVQCSEL+VLE+EFLKRVNYRI+PRDDNI NCK E ++G+F+T   A +
Sbjct: 161 FCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLADK 220

Query: 206 NRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
            +GPNNGFNVLDTYY+K+I++VG  +SSPDKT +  YV+
Sbjct: 221 IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVL 259

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  289 bits (739), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 149/254 (58%), Positives = 187/254 (73%), Gaps = 12/254 (4%)

Query: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60
           + D E   A+   P  +E +K   G D +  + LP  FS+C RTDL +LISRML+FLI+I
Sbjct: 4   IEDAEVTVAARDKPIPSESSK--EGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQI 61

Query: 61  NDSIP---KDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY 117
           NDS+     +N+  LTRFHSRVPP ISVY+YL+RLT+YSSLE  VL+ +VYYIDLLS++Y
Sbjct: 62  NDSLALSKPENARGLTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVY 121

Query: 118 TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYR 177
             F+L+SLTVHRFLLTATTV SKGLCDSFCTN+HYAKVGGV  SEL++LE EFLKRVNYR
Sbjct: 122 PVFTLSSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYR 181

Query: 178 ILPRDDNILNCKAERREGLF-------VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSY 230
           ILPRDDNI  CK E +   F       +      +N   N+G+NVLD Y++KI+++VGSY
Sbjct: 182 ILPRDDNIDWCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSY 241

Query: 231 DSSPDKTKRAHYVM 244
            SSPDK+K  +YV+
Sbjct: 242 ASSPDKSKVVNYVL 255

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  287 bits (734), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 173/221 (78%), Gaps = 4/221 (1%)

Query: 28  PVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYD 87
           PVPE  LP  F  C RT LV+LISRMLS LIR+ND+  + N+ +LTRFHSRVPP ISVYD
Sbjct: 19  PVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNTLQLTRFHSRVPPSISVYD 78

Query: 88  YLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFC 147
           YL+RLT+YSSLE  VL+ASVYYIDLLS+++  F L+SLTVHRFLLTATTV SKGLCDSFC
Sbjct: 79  YLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDSFC 138

Query: 148 TNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLF----VTATYA 203
           TN+HYAKVGGVQC+EL+VLE+EFL RVNYRILPRD+NI  C  E +EG F    + A   
Sbjct: 139 TNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPADAE 198

Query: 204 KENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
           ++ +   N F+VL+ YY ++I ++G+ D+SPDK+   ++ +
Sbjct: 199 QDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  284 bits (726), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 137/237 (57%), Positives = 180/237 (75%), Gaps = 13/237 (5%)

Query: 18  EDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSE--LTRF 75
           +D + +T E+ +P + LP DF +CP+ DLVILI+RML F+I+INDS  K+N  +  LTRF
Sbjct: 4   QDAQINTDEE-IPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRF 62

Query: 76  HSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTAT 135
           HS++ P ISV++Y  RLT+YS LE +VL+++VYYIDLLS +Y AF+LNSLT HRFLLTAT
Sbjct: 63  HSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTAT 122

Query: 136 TVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREG 195
           T+ SKGLCDSFCTN+HY+KVGGVQC+EL+VLE+EFL++VNYRI+PRD+NI  CK E ++ 
Sbjct: 123 TIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKN 182

Query: 196 LFVTATYAKENRGP----------NNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHY 242
            F+     + +  P          N G+NVL  YY KIIE+VG Y SSPDKTK+ +Y
Sbjct: 183 FFILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  282 bits (721), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 137/226 (60%), Positives = 178/226 (78%), Gaps = 4/226 (1%)

Query: 22  PDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSS-ELTRFHSRVP 80
           P  G +    + LP ++ +C RT LV++ISRMLSFLI+IND+    N + ELTRFHS+  
Sbjct: 9   PQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAA 68

Query: 81  PQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSK 140
           P I+VY YL+RLT+YSSLE +VL+++VYYIDLLSA+Y  F+LNSLTVHRFLLTATT+ SK
Sbjct: 69  PSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASK 128

Query: 141 GLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREG--LFV 198
           GLCDSFCTN+HY+KVGGVQCSEL++LE+EFL+RV YRI+PRDDNI NCK E++ G  + +
Sbjct: 129 GLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQKLGSNMLI 188

Query: 199 TATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
               A + RGP+NGFNVL  YY+KI+++VG+  +SPDKT    + M
Sbjct: 189 PMKNASQ-RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKM 233

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  281 bits (718), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 186/265 (70%), Gaps = 32/265 (12%)

Query: 8   GASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK- 66
           G  AK  +  E+T   TG + +  V+LP++FS C R DL+ LISRML FLI+IND   + 
Sbjct: 4   GGVAKQANRNEET---TGCE-IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQK 59

Query: 67  ------------------DNSSE--LTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIAS 106
                             D SSE  LTRFHS VPP ISVY+YL+RLT+YS+LEP+VL+ S
Sbjct: 60  KTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTS 119

Query: 107 VYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVL 166
           +YYIDLLS++Y AF++NSLTVHRFLLTATTV SKGLCDSFCTN+HYAKVGGVQ SEL++L
Sbjct: 120 IYYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNIL 179

Query: 167 ESEFLKRVNYRILPRDDNILNCKAERREGLF-------VTATYAKENRGPNNGFNVLDTY 219
           ESEFLK++NYR+LPRDDNI  CK E R   F       +T      +   N+G+NVL  Y
Sbjct: 180 ESEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMY 239

Query: 220 YQKIIEIVGSYDSSPDKTKRAHYVM 244
           Y KII++VG + SS DK+K+A+YV 
Sbjct: 240 YHKIIQLVGKFSSSLDKSKKANYVF 264

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  282 bits (722), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 141/229 (61%), Positives = 174/229 (75%), Gaps = 13/229 (5%)

Query: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK---DNSSELTRFHSRVPPQISV 85
           VP V LP  FS+C RTDLVILISRML+FLI++NDS      D+ + LT+FHS+VPP ISV
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145
           Y+YLMRLT+YSSL+  VL+A+VYYIDL+S++Y  F+LNSLTVHRFLLTATTV SKGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVTATYAKE 205
           FCTN+HYAKVGGV CSEL+VLE E L+R+NYRI+PRDDNI  C  E +   FV  T   +
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221

Query: 206 NRGP----------NNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
           +  P          N+G+NVLDTYY KI+++VGS  S+ DK+K  +Y  
Sbjct: 222 DWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTF 270

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  277 bits (708), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/236 (55%), Positives = 173/236 (73%), Gaps = 18/236 (7%)

Query: 27  DPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNS-----------SELTRF 75
           + +  + LP  F  C R+DLV LI+RMLSFLI +ND+ P + +             LTRF
Sbjct: 41  ENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRF 100

Query: 76  HSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTAT 135
           HSRVPP ISVY+YL+RLT+YSSLE  VL+++VYYIDLLS++Y  F +NSLTVHRFLLTAT
Sbjct: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTAT 160

Query: 136 TVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREG 195
           T+ SKGLCDSFCTNSHY+KVGGV CSEL++LE+EFL+RVNYRI+PRDDNI  CK E ++ 
Sbjct: 161 TIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQN 220

Query: 196 LFV-------TATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
            F              ++   N+GFN+LD YY KI+++VGS+ +S DK+++A+Y +
Sbjct: 221 KFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL 276

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  271 bits (692), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 179/241 (74%), Gaps = 17/241 (7%)

Query: 17  TEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK---DNSSELT 73
           +EDT+ D     +P++ LP++F +C RTDLV+LISRML  LI IN++      D+   LT
Sbjct: 9   SEDTQEDQS---IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLT 65

Query: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133
           R+HS++PP IS+++Y +RLT++SSLE  VLI S+YYIDLL   Y  F+LNSLT HRFLLT
Sbjct: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLT 125

Query: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193
           ATTV +KGLCDSF TN+HY+KVGGV+C EL++LE++FLKRVNYRILPRD NI  C  E++
Sbjct: 126 ATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQK 185

Query: 194 EGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYV 243
           +  FV            +Y+  NR   +G+NVLD YYQ+I+++VGS+D+SPDK++R +Y 
Sbjct: 186 QKTFVIDKNALGSVDLGSYSYANRS-KSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYA 244

Query: 244 M 244
           +
Sbjct: 245 L 245

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  268 bits (686), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 183/244 (75%), Gaps = 19/244 (7%)

Query: 15  DLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS----IPKDNSS 70
           DL+E+   D G   + +V LP DF++C RTDLV+LISRML  LI IN++    IP +N  
Sbjct: 7   DLSENMHEDQG---IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIP-ENQI 62

Query: 71  ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRF 130
            LTR+HS++PP IS+++Y +RLT++SSLE  VL+ S+YYIDLL   Y  F+LNSLT HRF
Sbjct: 63  TLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRF 122

Query: 131 LLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKA 190
           LLTATT+ +KGLCDSF TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI+ C  
Sbjct: 123 LLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSI 182

Query: 191 ERREGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRA 240
           E+++  FV            +Y+  +R P +G+NVLD YY++I+++VGS+++SPDK+K+ 
Sbjct: 183 EQKQKKFVIDKNALGSFDLDSYSYTDR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKI 241

Query: 241 HYVM 244
            YV+
Sbjct: 242 DYVL 245

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  270 bits (689), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 138/227 (60%), Positives = 171/227 (75%), Gaps = 6/227 (2%)

Query: 16  LTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIP-KDNSSELTR 74
           ++  T  +T E  V E+ LP  F  C RT LV+LISRML+ LI +ND+   K    +LTR
Sbjct: 1   MSVQTSHETSES-VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTR 59

Query: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTA 134
           FHSRVPP ISVY+YL+RLT+YSSLE  VL+ASVYYIDLL+ +Y  F L+SLTVHRFLLTA
Sbjct: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTA 119

Query: 135 TTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERRE 194
           TTV SKGLCDSFCTN+HYAKVGGVQCSEL+VLE+EFL+RVNYRILPRDDNI  C  ER+E
Sbjct: 120 TTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQE 179

Query: 195 GLFVTATYAKEN----RGPNNGFNVLDTYYQKIIEIVGSYDSSPDKT 237
            +F  +    +     +  NNGF VL+ YY ++I ++G ++ SPDK+
Sbjct: 180 RIFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKS 226

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  267 bits (683), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 130/241 (53%), Positives = 180/241 (74%), Gaps = 17/241 (7%)

Query: 17  TEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRIND---SIPKDNSSELT 73
           +E+   D G   +P+V LP DF++C RTDLV+LISRML  LI IN+   +   D+   LT
Sbjct: 9   SENIHEDQG---IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLT 65

Query: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133
           R+HS++PP IS+++Y +RLT++SSLE  VL+ S+YYIDLL  +Y  F+LNSLT HRFLLT
Sbjct: 66  RYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLT 125

Query: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193
           ATTV +KGLCDSF TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI  C  E++
Sbjct: 126 ATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQK 185

Query: 194 EGLFVT----------ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYV 243
           +  FV            +Y+  NR P +G+NVLD YY++I+++VGS+++SPDK+++  YV
Sbjct: 186 QKKFVIDKNALGSLDLDSYSYVNR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYV 244

Query: 244 M 244
           +
Sbjct: 245 L 245

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  264 bits (674), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 177/243 (72%), Gaps = 27/243 (11%)

Query: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS---IPKDNSS--------------- 70
           +  + LP  F +C R+DLV+LISRML+FLI+IND    + ++NS+               
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 71  --ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVH 128
              LTRFHSRVPP ISV +YL+RLT+Y+SLE +VL++S+YYIDLLS++Y  F +NSLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 129 RFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188
           RFLL ATTV SKGL DSFCTNSHYAKVGGV+CSEL++LE++FL+R+NYRI+PRDDNI  C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 189 KAERREGLF-------VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAH 241
           K E++   F       + A    E   PN+G+NVL+ YY+K+++IVG   +S DK+K+ +
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271

Query: 242 YVM 244
           Y++
Sbjct: 272 YII 274

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  261 bits (667), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 173/229 (75%), Gaps = 14/229 (6%)

Query: 29  VPEVALPNDFSQCPRTDLVILISRMLSFLIRIND---SIPKDNSSELTRFHSRVPPQISV 85
           +P+V LP +F +C RTDLV+LISRML  LI IN+   +   D+   LTR+HS+VPP IS+
Sbjct: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKPDDQITLTRYHSKVPPNISI 77

Query: 86  YDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDS 145
           ++Y +RLT++SSLE  VL+ S+YYIDLL   Y  F+LNSLT HRFLLTATTV +KGLCDS
Sbjct: 78  FNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLCDS 137

Query: 146 FCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFVT------ 199
           F TN+HYAKVGGV+C EL++LE++FLKRVNYRI+PRD NI  C  E+++  FV       
Sbjct: 138 FSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNAPG 197

Query: 200 ----ATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
                +Y+  +R P +G+NVLD YY++I+++VGS+++SPDK+K+  YV+
Sbjct: 198 SFDLDSYSYVSR-PKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL 245

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  246 bits (629), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 167/233 (71%), Gaps = 11/233 (4%)

Query: 22  PDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS------IPKDNSSEL--T 73
           P +GE+    V L  +F +C + DL+ LISRMLSF I INDS      +  +  S L  T
Sbjct: 3   PSSGEE-AQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLT 61

Query: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133
           RFHS+VPP IS++DYL+RLT+YSSLE +VLI SVYYIDLLS +Y  FSLNSLTVHR+LLT
Sbjct: 62  RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT 121

Query: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193
           ATT+ SKGLCDSFCTNSHYAKVGG++C+EL+VLE+EFL+RV YR++PRD+ I  CK E +
Sbjct: 122 ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK 181

Query: 194 EGLF--VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244
                 +       +   N+G+NVL TYY K++++VG+  SS +  +  +Y+ 
Sbjct: 182 YSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  211 bits (538), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 109/234 (46%), Positives = 152/234 (64%), Gaps = 20/234 (8%)

Query: 16  LTED-TKPDTGEDP----VPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSS 70
           LT+D +K  T E P    +  + +P ++ +C R+DLV+L+SRML  LI+ ND     ++S
Sbjct: 8   LTKDGSKESTAESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNS 67

Query: 71  ------ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNS 124
                  LTRFHSR+PP IS+++YL RLT+Y  +E  VL++ +YYIDL +A Y  F+ NS
Sbjct: 68  SSDSNMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNS 127

Query: 125 LTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDN 184
           LT HRFLLTA TV  KGLCDSFCT + YAK+GGVQ  EL++LE+ FL+ VNYRI+PR  N
Sbjct: 128 LTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSN 187

Query: 185 ILNCKAERREGLFV---------TATYAKENRGPNNGFNVLDTYYQKIIEIVGS 229
           +   K ER   +F            ++   +  P+NG++VL+ YYQ I+ I G+
Sbjct: 188 VTLIKLERGNQVFTLDHLDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITGA 241

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  207 bits (526), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/258 (44%), Positives = 161/258 (62%), Gaps = 18/258 (6%)

Query: 5   ESGGASAKHPDLTEDTKPDT---GEDPVP-EVALPNDFSQCPRTDLVILISRMLSFLIRI 60
           ++   S+  P     + P+     E+P   ++ LP  F +CPR DLV+LISRML  LI+I
Sbjct: 26  KTSNTSSDTPSTQSHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKI 85

Query: 61  NDSIPKDN---SSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY 117
           ND+   DN   S+  TRFHSRV P IS+ +YL+RLT++  L+P+VL+ +VYYIDLLSA++
Sbjct: 86  NDTKANDNNLPSNYATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVF 145

Query: 118 TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYR 177
            +FS NSLT HRF+LTA  V SK LCDS  + +HYAK GGVQ +EL +LE+ FLK + YR
Sbjct: 146 PSFSFNSLTAHRFILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYR 205

Query: 178 ILPRDDNILNCKAERREGLFV--------TATYAKENRGPNNGFNVLDTYYQKIIEIVG- 228
           +LPRD N   C  E     F         + T     + P++G+NVL  YY++II+I+G 
Sbjct: 206 VLPRDKNTDLCSMEYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIGV 265

Query: 229 --SYDSSPDKTKRAHYVM 244
                 SPD     +++M
Sbjct: 266 QRPISPSPDAVTVDYFLM 283

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 100/198 (50%), Gaps = 29/198 (14%)

Query: 4   KESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS 63
           K+S  A     DL ++T  ++ E+ +  V  P D       +L+I++S +L+ +I +ND+
Sbjct: 75  KKSLEAETNKQDLNDETNGESSENVLNIVDFPTD-------ELIIMVSALLNKIITVNDA 127

Query: 64  -------IPKDNSSE----LTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDL 112
                  +P D   +    +  F+ +  P+I V  YL R+ +Y      + ++ + Y D 
Sbjct: 128 TTDISQQVPGDTEEKFLTPILAFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDR 187

Query: 113 LSAMY-----------TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCS 161
           +S  Y             F ++S  +HR L+T  T+ +K L D F +NS YAKVGG+   
Sbjct: 188 ISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQ 247

Query: 162 ELHVLESEFLKRVNYRIL 179
           EL+ LE +FL   ++++L
Sbjct: 248 ELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 85.1 bits (209), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 101/198 (51%), Gaps = 29/198 (14%)

Query: 4   KESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRIND- 62
           K+S  + +   D+ E+T  + GE  +  V  P D       +L++++S +L+ +++ ND 
Sbjct: 76  KDSRDSQSDVHDMEEETSREDGESVLNIVDFPTD-------ELILMVSALLNKIVKANDE 128

Query: 63  ------SIPKDNSSELTR----FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDL 112
                  + +D   EL      F+ +  P+I+V  YL R+ +Y      + ++ + Y D 
Sbjct: 129 TTDPSQQVVEDGEDELLAPVLAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDR 188

Query: 113 LSAMYTA-----------FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCS 161
           +S  Y +           F ++S  +HR L+T  T+ +K + D F +NS YAKVGG+   
Sbjct: 189 ISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQ 248

Query: 162 ELHVLESEFLKRVNYRIL 179
           EL+ LE +FL   ++++L
Sbjct: 249 ELNHLELQFLVLCDFKLL 266

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 83.2 bits (204), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 22/157 (14%)

Query: 45  DLVILISRMLSFLIRIND-------SIPKDNSSELTR----FHSRVPPQISVYDYLMRLT 93
           +L+ +IS +L+ ++  ND        + KDN  EL      F+ +  P+ISV  YL R+ 
Sbjct: 109 ELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLERIQ 168

Query: 94  RYSSLEPAVLIASVYYIDLLSAMYTAFS-----------LNSLTVHRFLLTATTVGSKGL 142
           +Y      + ++ + Y D +S  Y  FS           ++S  +HR L+T  T+ +K L
Sbjct: 169 KYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICTKFL 228

Query: 143 CDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
            D F +NS YAKVGG+   EL+ LE +FL   ++++L
Sbjct: 229 SDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 80.1 bits (196), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 98/198 (49%), Gaps = 29/198 (14%)

Query: 4   KESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRIND- 62
           K+S  + AK   L E+T   T      +V + N  +  P  +L+++IS +L+ +I  ND 
Sbjct: 75  KKSLESEAKTHSLDEETNEQT------DVKILN-IADFPTDELILMISALLNRIITANDE 127

Query: 63  ------SIPKDNSSELTR----FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDL 112
                  +  +   EL      F+ +  P+I+V  YL R+ +Y      + ++ + Y D 
Sbjct: 128 TTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDR 187

Query: 113 LSAMY-----------TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCS 161
           +S  Y             F ++S  +HR L+T  T+ +K L D F +NS YAKVGG+   
Sbjct: 188 ISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQ 247

Query: 162 ELHVLESEFLKRVNYRIL 179
           EL+ LE +FL   ++++L
Sbjct: 248 ELNHLELQFLILCDFKLL 265

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 76/149 (51%), Gaps = 15/149 (10%)

Query: 37  DFSQCPRTDLVILISRMLSFLIRINDSI-PKDNS---------SELTRFHSRVPPQISVY 86
           D +Q P   L+ +++ +L  +I+ ND + P D           + +  F  +  P I++ 
Sbjct: 17  DIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLG 76

Query: 87  DYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA-----FSLNSLTVHRFLLTATTVGSKG 141
           DY  R+ +Y  +   V ++ + Y D ++    A     F ++S  +HR ++ A TV +K 
Sbjct: 77  DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKF 136

Query: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEF 170
             D F +NS YA+VGG+   EL+ LE +F
Sbjct: 137 FSDFFYSNSRYARVGGISLEELNRLELQF 165

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 90/188 (47%), Gaps = 25/188 (13%)

Query: 37  DFSQCPRTDLVILISRMLSFLIRINDSIPKDN---------SSELTRFHSRVPPQISVYD 87
           D +  P   L+ +++ +L+ +++ ND +   N         +S++  F  +  P IS+  
Sbjct: 290 DIATFPNNKLLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVLSFRGKHVPAISLDQ 349

Query: 88  YLMRLTRYSSLEPAVLIASVYYIDLLSAM----------YTAFSLNSLTVHRFLLTATTV 137
           Y  R+ +Y      V ++ + Y D ++               F ++S  +HR ++ A TV
Sbjct: 350 YFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTV 409

Query: 138 GSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLF 197
            +K   D F +NS YA+VGG+   EL+ LE +FL   ++ +      I++ +  +R G  
Sbjct: 410 STKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFEL------IISIEELQRYGDL 463

Query: 198 VTATYAKE 205
           ++  + KE
Sbjct: 464 LSKFWKKE 471

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 34/172 (19%)

Query: 42  PRTDLVILISRMLSFLIRINDSIPK--------------DNSSELTRFHSRVPPQISVYD 87
           P  D++ +++ +L  ++  ND +                D  + +T F+ +  PQI++  
Sbjct: 239 PIDDILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTINAITSFYGKHVPQITIEQ 298

Query: 88  YLMRLTRYSSLEPAVLIASVYYIDLLS--------------------AMYTAFSLNSLTV 127
           YL+R+ +Y      + ++ + + D +S                    A +  F ++S  +
Sbjct: 299 YLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDSDEQAPHQTFVMDSYNI 358

Query: 128 HRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           HR L+   TV +K   D F +N+ YA+VGG+   E++ LE +FL   ++++L
Sbjct: 359 HRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFLILCDFKLL 410

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 5/118 (4%)

Query: 67  DNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLS-----AMYTAFS 121
           D ++E+  F  +  P I+++ Y  R+ +Y      V ++ + Y D ++     A    F 
Sbjct: 427 DLAAEILSFRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFV 486

Query: 122 LNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           ++S  +HR +++A TV +K   D F +NS YA+VGG+   EL+ LE +FL   ++ ++
Sbjct: 487 MDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 91/215 (42%), Gaps = 53/215 (24%)

Query: 31  EVALPNDF---SQCPRTDLVILISRMLSFLIRINDSIPK------------DNSSE---- 71
           E A  NDF   ++     L+ +IS +L  LI+ ND + +            DNS E    
Sbjct: 119 ENASVNDFIDITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLV 178

Query: 72  --LTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA---------- 119
             +  F  +  P I +  Y  R+ +Y      VL+A + Y D +S +             
Sbjct: 179 RSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNI 238

Query: 120 -----------------FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSE 162
                            F L+S  +HR +++A TV +K   D F +NS YAKVGG+   E
Sbjct: 239 STHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDE 298

Query: 163 LHVLESEFLKRVNYRILPRDDNILNCKAERREGLF 197
           ++ LE +FL   N+ ++   + I     +R  GL 
Sbjct: 299 MNYLELQFLLISNFDLIISSEEI-----QRYSGLL 328

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 74/149 (49%), Gaps = 15/149 (10%)

Query: 37  DFSQCPRTDLVILISRMLSFLIRIND----------SIPKDNSSELTRFHSRVPPQISVY 86
           D ++ P   L+ +++ +L  +I+ ND           I     + +  F  +  P I++ 
Sbjct: 186 DIAKFPTDKLLEMLTSLLYKIIKSNDRLKSFEQEKHDINSKYVAHVLSFRGKHIPAITLG 245

Query: 87  DYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA-----FSLNSLTVHRFLLTATTVGSKG 141
           DY  R+ +Y  +   V ++ + Y D ++    A     F ++S  +HR ++ A TV +K 
Sbjct: 246 DYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAVTVSTKF 305

Query: 142 LCDSFCTNSHYAKVGGVQCSELHVLESEF 170
             D F +NS YA+VGG+   EL+ LE +F
Sbjct: 306 FSDFFYSNSRYARVGGISLHELNRLELQF 334

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 61  NDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLS-----A 115
           ND+ P + +SE+  F  +  P I++  Y  R+ +Y      V ++ + Y D ++      
Sbjct: 311 NDTRP-NIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHG 369

Query: 116 MYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVN 175
               F ++S  +HR +++A TV +K   D F +NS YA+VGG+   EL+ LE +FL   +
Sbjct: 370 KEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCD 429

Query: 176 YRIL 179
           + ++
Sbjct: 430 FELI 433

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 14/119 (11%)

Query: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA--------------F 120
           F  +  PQI++Y Y  R+ +Y      V ++ + Y D +S    +              F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
            ++S  +HR ++   TV +K   D F +NS YA+VGG+  SEL+ LE +FL   ++ +L
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 98/219 (44%), Gaps = 43/219 (19%)

Query: 1   MSDKESGGASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRI 60
           + D+++G +S   PD   +   D  +  +       D +  P   L+ +++ +L+ +I+ 
Sbjct: 157 IDDEQTGSSSTSQPDHHSN---DETQHSLNNNNHHMDIATFPTYKLLDMLTGLLTKIIKS 213

Query: 61  NDSI---PKDNSS---------ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVY 108
           NDS+   P   +S         E+  F  +  P I++  Y  R+ +Y      VL++ + 
Sbjct: 214 NDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLV 273

Query: 109 YIDLLSAMYTA----------------------------FSLNSLTVHRFLLTATTVGSK 140
           + D ++    A                            F ++S  +HR ++ A TV +K
Sbjct: 274 HFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTK 333

Query: 141 GLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
            + D F +NS YA+VGG+   EL+ LE +FL   ++R++
Sbjct: 334 FISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 85/210 (40%), Gaps = 50/210 (23%)

Query: 17  TEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSS------ 70
           TE   P + + P  EV    D +  P   L+ +++ +L  +I+ ND +   N +      
Sbjct: 125 TEPIMPVSRDKPSEEVL---DIATFPTEKLLEMLTALLDKIIKSNDRLASSNPTLNQERE 181

Query: 71  ----------ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLS------ 114
                      +  F  +  PQIS+  Y  R+ +Y      V ++ + Y D +S      
Sbjct: 182 LMNNNNVYLNSVLSFRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSN 241

Query: 115 -------------------------AMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTN 149
                                        AF ++S  +HR L+   TV +K   D F +N
Sbjct: 242 NNDTTNDNDLQYDMPAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSN 301

Query: 150 SHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           S YA+VGG+   EL+ LE +FL   ++ +L
Sbjct: 302 SRYARVGGISLQELNHLELQFLVLCDFELL 331

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 89/186 (47%), Gaps = 30/186 (16%)

Query: 24  TGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSI-----------PK----DN 68
           + ED + EV  P+  +  P   L+ +++ +L  +I+ ND+I           PK    D+
Sbjct: 106 SNEDEIFEVFNPDKIASLPMNKLLEMLTTLLETIIQSNDNINNVHPLKMNEIPKILEHDS 165

Query: 69  S---SELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA------ 119
           +   + +  F  +  PQI++  Y  R+ +Y      V ++ + Y D +     +      
Sbjct: 166 TGCLNAMLSFKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYG 225

Query: 120 ------FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKR 173
                 F ++S  +HR ++   TV +K L D F +NS YAKVGG+   EL+ LE +FL  
Sbjct: 226 HDNPQIFVMDSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLIL 285

Query: 174 VNYRIL 179
            ++ +L
Sbjct: 286 CDFNLL 291

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 35/178 (19%)

Query: 37  DFSQCPRTDLVILISRMLSFLIRINDSI---------------PKDNSSE-----LTRFH 76
           + ++ P   L+ +++ +L  +++ ND +                +DNS+      +  F 
Sbjct: 225 NIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFR 284

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSA---------------MYTAFS 121
            +  PQIS++ Y  R+ +Y      V ++ + Y D +S                    F 
Sbjct: 285 GKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFV 344

Query: 122 LNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           ++S  +HR ++   TV +K   D F +NS YA+VGGV   EL+ LE +FL   ++ ++
Sbjct: 345 MDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 70/146 (47%), Gaps = 23/146 (15%)

Query: 57  LIRINDSIPKDN-------------SSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVL 103
           +++ ND+I + N             ++ L  FH +  P I++  Y  R+ +Y      V 
Sbjct: 150 IVKSNDAIERANDHDTLLLDSTNPFANSLLCFHGKHVPDITIEKYFNRIQKYCPTTNDVF 209

Query: 104 IASVYYIDLLSAMYTA----------FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYA 153
           +  +   D ++               F ++S  +HRF++   TV +K L D F +NS YA
Sbjct: 210 LLLLIAFDRIAKRCNTDSFGNKSQQLFVMDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYA 269

Query: 154 KVGGVQCSELHVLESEFLKRVNYRIL 179
           KVGG+   E++ LE +FL   +++++
Sbjct: 270 KVGGISVHEMNNLELQFLVLCDFKLI 295

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA--------------F 120
           F  +  PQI+++ Y  R+ +Y      V ++ + Y D +S    +              F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
            ++S  +HR ++   TV +K   D F +NS YA+VGG+   EL+ LE +FL   ++ ++
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFLILCDFELM 470

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 84/196 (42%), Gaps = 49/196 (25%)

Query: 33  ALPNDFSQCPRTDLVILISRMLSFLIRINDSI---PKDNSSE----------LTRFHSRV 79
           A P + ++     L+ ++S +L  ++  ND +     DN+ +          ++ F  + 
Sbjct: 153 ATPENIAEFQTDKLLDMLSTLLDKIVLSNDRLHINTMDNTIDEHIDSTIIKPVSCFRGKH 212

Query: 80  PPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--------------------- 118
            PQIS+  Y  R+ +Y  +   V ++ + Y D +S                         
Sbjct: 213 VPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNV 272

Query: 119 ---------------AFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSEL 163
                           F ++S  +HR ++TA TV +K   D F +NS YA+VGG+   EL
Sbjct: 273 KQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQEL 332

Query: 164 HVLESEFLKRVNYRIL 179
           + LE +FL   +++++
Sbjct: 333 NHLELQFLILCDFQLM 348

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 75/171 (43%), Gaps = 37/171 (21%)

Query: 46  LVILISRMLSFLIRINDSIPKDNSSELTR---------------------FHSRVPPQIS 84
           L+ +++ +L  +++ ND +   +S+ L +                     F  +  PQI+
Sbjct: 161 LIKMLTALLDKIVQANDRLETPDSATLLKVNDDARDTDGYYESAVNAILSFKGKHIPQIT 220

Query: 85  VYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA----------------FSLNSLTVH 128
           +  Y  R+ +Y      V ++ + Y D +S    +                F +NS  +H
Sbjct: 221 LEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIH 280

Query: 129 RFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           R ++    V +K   D F +N+ YAKVGG+   E++ LE +FL   ++ +L
Sbjct: 281 RLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 59/146 (40%), Gaps = 41/146 (28%)

Query: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLS-------------------- 114
           F  +  PQIS+  Y  R+ +Y      V ++ + Y D +S                    
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 115 ---------------------AMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYA 153
                                A    F ++S  +HR ++  TTV +K   D F +NS YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 154 KVGGVQCSELHVLESEFLKRVNYRIL 179
           +VGG+   EL+ LE +FL   ++ +L
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 2/80 (2%)

Query: 100 PAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQ 159
           PA  I S    + LS     F ++S  +HR ++   TV +K   D F +N+ YAKVGG+ 
Sbjct: 560 PAARIPSDS--NALSPNSQVFVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGIT 617

Query: 160 CSELHVLESEFLKRVNYRIL 179
             EL+ LE +FL   ++++L
Sbjct: 618 LQELNHLELQFLLLCDFKLL 637

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 59/141 (41%), Gaps = 33/141 (23%)

Query: 13  HPDLTEDTKPDTGED-PVPEVALPNDFSQCPRTDLVILISRMLSFLIRIND--------- 62
           H DLT    P   +   VP  +L  + ++ P T L+ +++ +L+ +I+ ND         
Sbjct: 359 HTDLTPHHSPTRLDSYSVPPSSL--NIAEFPTTKLLEMLTALLNKIIKSNDCLAGIQPDA 416

Query: 63  ----SIPKDNSSELTRFHSRVP--------------PQISVYDYLMRLTRYSSLEPAVLI 104
               + P  N   LT  +  VP              PQI+++ Y  R+ +Y  +   V +
Sbjct: 417 LTNVNTPPQN---LTTNNGEVPNYLSSILSFRGKHIPQITLFQYFQRIQKYCPISNDVFL 473

Query: 105 ASVYYIDLLSAMYTAFSLNSL 125
           + + Y D +S      S N +
Sbjct: 474 SLLVYFDRISKRCNTISSNDV 494

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 37/60 (61%)

Query: 120 FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           F ++S  +HR ++   TV +K   D F +NS YA+VGG+   EL+ LE +FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 64  IPKDNS--SELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLS 114
           + KDNS    +  F  +  PQIS+  Y  R+ +Y  +   V I+ + Y D +S
Sbjct: 29  MNKDNSMAQSVLSFRGKHIPQISLEQYFQRIQKYCPITNDVFISLLVYFDRIS 81

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 120 FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           F ++S  +HR ++   TV +K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 120 FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           F ++S  +HR ++   TV +K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 120 FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           F ++S  +HR ++   TV +K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 120 FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
           F ++S  +HR ++   TV +K L D F +NS Y++VGG+   EL+ LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (43%), Gaps = 25/141 (17%)

Query: 63  SIPKDNSSE-LTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYID---------- 111
           +IP D+    L  F      +I + +YL  L R+  +    L+A + Y+D          
Sbjct: 143 NIPADDIKHVLQSFLGNHRLKIELEEYLNTLQRHCPMNTIDLLALLIYLDRIIQNLYKYP 202

Query: 112 -----LLSAMYTAFS---------LNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGG 157
                +   M + F          +NS TVHR +L   TV SK L D   +N  YA+  G
Sbjct: 203 LDKKPIYQFMASRFQHKQTCLSRIVNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASG 262

Query: 158 VQCSELHVLESEFLKRVNYRI 178
           +   EL+ LE +FL+  N+ +
Sbjct: 263 LTLEELNYLEFQFLRLTNFNL 283

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 76/142 (53%), Gaps = 15/142 (10%)

Query: 53  MLSFLIRINDSIP--KDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYI 110
           M+ FL    DSI   K +S+E     + +P   S+++++  L ++S+++ + L+AS  Y+
Sbjct: 19  MICFLASTTDSIIQLKPSSNE-----ANIP---SIFEFIKGLIKHSNVQTSTLMASTVYL 70

Query: 111 DLLSAMYTA--FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVL 166
             L ++  A  + + S T HR  L    + +K L DS   N H+ K   G +  ++++ +
Sbjct: 71  TKLRSILPANVYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNTI 129

Query: 167 ESEFLKRVNYRILPRDDNILNC 188
           E E L  +N+  + + ++++ C
Sbjct: 130 ERELLAYLNWDTIIKQEDLIGC 151

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 13/141 (9%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           S +PP   +Y ++  L  +S+++   L+ +V Y+  L A+     + + + T HR  L  
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIET-TRHRMFLGC 103

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAER 192
             + +K L DS   N H+AK   G +Q  E++ +E E L    + +    +++L C A  
Sbjct: 104 LIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREILTYFKWDLQITVNDLLTCLAP- 162

Query: 193 REGLFVTATYAKENRGPNNGF 213
               F+      E R  N  F
Sbjct: 163 ----FIKQVKDDEKRQKNQNF 179

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 82/185 (44%), Gaps = 21/185 (11%)

Query: 7   GGASAKHPDLTEDT--KPDTGEDPVPEVALPNDFSQCPRT---DLVILISRMLSFLIRIN 61
           GG   + P   E+   K D G +    + +P D ++ P     D +   S  +  L++++
Sbjct: 222 GGLHIRPPHGEEENREKADFGSENPLLLGIP-DNAEVPYISVDDALANFSETIELLLKLS 280

Query: 62  D----SIPKDN--SSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL-- 113
           D    +I K++    E   F+ +  P +S  D+L R+      EPAV + + + +D L  
Sbjct: 281 DDEKCTISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKCEYEPAVYLVATFLMDTLFL 340

Query: 114 -------SAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVL 166
                  +A+     L    VHR ++ +  + +K L D   ++ +++KV GV    L  L
Sbjct: 341 TRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKL 400

Query: 167 ESEFL 171
           E   L
Sbjct: 401 EISLL 405

>Smik_7.138 Chr7 (249640..250953) [1314 bp, 437 aa] {ON} YGL134W
           (REAL)
          Length = 437

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 24  TGEDPVPEVALPNDFSQCPRT-DLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQ 82
           +G+  VP + +        RT DL++ +S   S  I  N  + K    E   F+ +  P 
Sbjct: 254 SGDVEVPHIPVGEALENLKRTIDLLLKLSNNKS-CIGSNSGMEK---KEYANFYMKSKPS 309

Query: 83  ISVYDYLMRLTRYSSLEPAVLIASVYYIDLL---------SAMYTAFSLNSLTVHRFLLT 133
           +S  D+L R+      EP V + +++ I++L           +     L    VHR ++ 
Sbjct: 310 LSSVDFLKRIQDKCKYEPTVYLVAMFLIEMLFLTRNKNGDDGLQLKRKLKEKEVHRVIIA 369

Query: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
           A  + +K L D   ++ +++KV G+    L  LE   L
Sbjct: 370 AVRLSTKLLEDYVHSHEYFSKVCGISKRLLTKLEVSLL 407

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 60/111 (54%), Gaps = 6/111 (5%)

Query: 84  SVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKG 141
           S+  ++ RL RY+++    L+A+V Y++ L  +    A  L S T+HR  L    + SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI-LPRDDNILNCK 189
             DS   N H+A+   G     +++++E + L+ +N+ I +  DD IL+ +
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLILDLR 163

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 65  PKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--AFSL 122
           P  + +EL+    R+P   S+  ++ +L RY+++    L+ +V Y++ L  +    A  L
Sbjct: 43  PPSSPTELSGKEPRLP---SLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGL 99

Query: 123 NSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI-L 179
            S T+HR  L    + +K   DS   N H+AK   G     +++++E + L  +N+ + +
Sbjct: 100 PS-TIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNWDLRV 158

Query: 180 PRDDNILNCKA 190
            ++D IL+ + 
Sbjct: 159 EQEDLILDLQT 169

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/128 (21%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 83  ISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSK 140
           +S+ D++  L  +S+++   L+++V Y+  L ++   T + + + T HR  L    + +K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 141 GLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERREGLFV 198
            L DS   N H+++   G +   E++ +E E L+  ++++     +++ C +   + +  
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITCLSSFLKPIKD 160

Query: 199 TATYAKEN 206
             TY ++ 
Sbjct: 161 QTTYQRQQ 168

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 46/115 (40%), Gaps = 8/115 (6%)

Query: 65  PKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL--------SAM 116
           P D     + F  + PP +S  D++ R+      +P V + + Y +  L          +
Sbjct: 330 PLDEMIAFSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKL 389

Query: 117 YTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
              F      VHR ++    + +K L D   ++ ++ KV G+    L  LE   L
Sbjct: 390 KLRFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 81  PQISVYDYLMRLTRYSSLE-PAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGS 139
           P   + +++ RL ++S+++ P ++  SVY   L S + +       T HR  L    + +
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILAA 104

Query: 140 KGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNC-----KAER 192
           K L DS   N H+A+   G +   E++ +E E L+  ++ +    ++++ C     K  +
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITCLSPFLKKIK 164

Query: 193 REGLF 197
            E LF
Sbjct: 165 EEKLF 169

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query: 71  ELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL-------SAMYTAFSLN 123
           E + F+ +  P +S  D+L R+      +P V + + + ID L       + +    +L 
Sbjct: 296 EYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQ 355

Query: 124 SLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
              VHR ++ A  + +K L D   ++ +++KV G+    L  LE   L
Sbjct: 356 EKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 72/148 (48%), Gaps = 22/148 (14%)

Query: 53  MLSFLIRINDSI--------PKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLI 104
           M+ FL     SI        PK N++ +      +P   ++ +++  L ++S+++   L+
Sbjct: 19  MIQFLASTTASIIQVKPHSEPKTNTAHI------IP---TLSNFIKALIKHSNVQTPTLM 69

Query: 105 ASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQC 160
           A+  Y+  L ++     + + + T HR  L    + +K L DS   N H+A+   G +Q 
Sbjct: 70  ATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLNDSSPMNKHWAQYTDGLLQI 128

Query: 161 SELHVLESEFLKRVNYRILPRDDNILNC 188
            E++ +E E L+  ++ +  +  +++ C
Sbjct: 129 REVNTIERELLEYFDWDVTIKTKDLIIC 156

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 88  YLMRLTRYSSLE-PAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSF 146
           ++ RL ++S+++ P ++  SVY   L S + +       T HR  L    + +K L DS 
Sbjct: 52  FINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSS 111

Query: 147 CTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188
             N H+A+   G +   E++ +E E L+  ++ +    D+++ C
Sbjct: 112 PLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +V Y++ L  +    A  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNY 176
             + +K   DS   N H+AK   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 75/153 (49%), Gaps = 10/153 (6%)

Query: 40  QCPRTDLVI--LISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSS 97
           + P TD +I  L    L+ L  IN+ +P    S      S++P   S+  ++ +L RY++
Sbjct: 14  KSPVTDDMIKFLTHTTLNVLPNINNELPSPPVSPGNSKESKLP---SLKTFITKLVRYTN 70

Query: 98  LEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV 155
           +  + L+ +  Y+  L  +    A  L S T+HR  L    + +K   DS   N H+A+ 
Sbjct: 71  VYTSTLLTTACYLKKLQRILPKDANGLPS-TIHRIFLACLILSAKFHNDSSPLNKHWAEY 129

Query: 156 --GGVQCSELHVLESEFLKRVNYRILPRDDNIL 186
             G     +++++E + L  +N+ I  +++++ 
Sbjct: 130 TDGLFSLEDVNLMEVQLLALLNWDIRIKEEDLF 162

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 83  ISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA--FSLNSLTVHRFLLTATTVGSK 140
           +S+ D++  L + S+++   L+++V Y+  L ++  A  + + + + HR  L    + +K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 141 GLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188
            L DS   N H+ +   G +   E++ +E E L+  N+ +   + ++++C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 81  PQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVG 138
           P +S+ D++  L   S+++   L+++V Y+  L ++       + + T HR  L    + 
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIET-TRHRIFLGCLILA 99

Query: 139 SKGLCDSFCTNSHYAKVGG--VQCSELHVLESEFLKRVNYRILPRDDNILNC 188
           SK L DS   N H+ +     +   E++ +E E L+  N+ +L  + +++ C
Sbjct: 100 SKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 6/111 (5%)

Query: 79  VPPQISVYDYLMRLTRYSSLE-PAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTV 137
            PP +    ++ RL ++S+++ P ++  SVY + L S + +       T HR  L    +
Sbjct: 46  APPLV---KFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLIL 102

Query: 138 GSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNIL 186
            +K L DS   N H+A+   G +   E++ +E E L   ++ +    D+++
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLI 153

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 66/139 (47%), Gaps = 7/139 (5%)

Query: 52  RMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYID 111
            M+++L  I +SI +   S      +  PP +    ++  L   S+++   L+A+  Y+ 
Sbjct: 18  EMIAYLSNITESIIQVRRSNSMISIALPPPPL--VKFITNLCLKSNVQTPTLMATTVYLK 75

Query: 112 LLSAMY--TAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
            L  +     + + S T HR  L    + SK L DS   N H+A+   G +Q  E++ +E
Sbjct: 76  KLKNIIPPNVYGIES-TRHRIFLGCLILASKTLNDSSPLNKHWARYTSGILQLREVNTIE 134

Query: 168 SEFLKRVNYRILPRDDNIL 186
            E L+  ++ I    D+++
Sbjct: 135 RELLEYFDWNIQITTDDLV 153

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 5/105 (4%)

Query: 88  YLMRLTRYSSLEPAVLIASVYYIDLLSAMYTA--FSLNSLTVHRFLLTATTVGSKGLCDS 145
           ++  L  YS+++   L+A+  Y+  L ++  A  F + + T HR  L    + +K L DS
Sbjct: 50  FIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLILAAKTLNDS 108

Query: 146 FCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188
              N H+A    G +   E++ +E E L+  ++ +    + ++ C
Sbjct: 109 SPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 72/145 (49%), Gaps = 13/145 (8%)

Query: 53  MLSFLIRINDSIPKDNSSELTRFHSRVP---PQISVYDYLMRLTRYSSLEPAVLIASVYY 109
           M+++L R  +SI      ++   HS +    P   +  ++ +L +YS+++   L+A+  +
Sbjct: 19  MITYLARSTESI-----IQVRETHSMIDVAIPAPKLELFIKKLVKYSNVQTPTLMATTVF 73

Query: 110 IDLLSAMYTA--FSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHV 165
           +  L ++  A  + + + T HR  L    + +K L DS   N H+A+   G +   E++ 
Sbjct: 74  LTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDSSPLNKHWAQYTDGLLHLKEVNT 132

Query: 166 LESEFLKRVNYRILPRDDNILNCKA 190
           +E E L+  ++ +    ++++   A
Sbjct: 133 IERELLEYFDWNLTLSTNDLIQSLA 157

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 64  IPKDNSSELTRFHSR--------VPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSA 115
           +P +N S+L    S         +P   S+  ++ R+ RY++++ + L+ +V Y++ L  
Sbjct: 32  LPHNNGSQLPSPPSSPVDGKAPSIPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKK 91

Query: 116 MYTAFSLN-SLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLK 172
           +  A ++    T+HR  L    + +K   DS   N H+A    G     +++++E + L 
Sbjct: 92  LLPADAVGIPSTIHRLFLACLILSAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLS 151

Query: 173 RVNYRI 178
            +++ +
Sbjct: 152 LLDWNL 157

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 71/140 (50%), Gaps = 11/140 (7%)

Query: 53  MLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDL 112
           M+ FL   ++S+ +  + E +   ++V   +S+ D++  L   S+++   L+++  Y+  
Sbjct: 19  MIEFLASTSNSVIQVRTGESS---AKV---VSLVDFIKGLVVQSNVQTPTLMSTAVYLSK 72

Query: 113 LSAMYTAFSLNSL--TVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLES 168
           L ++  A +++ +  T HR  L    + +K L DS   N H+A    G +   E++ +E 
Sbjct: 73  LRSIIPA-NVHGMETTRHRVFLGCLIIAAKNLNDSSPMNKHWASYTNGLLNTREVNTIER 131

Query: 169 EFLKRVNYRILPRDDNILNC 188
           E L+  ++ +     +++ C
Sbjct: 132 ELLEYFDWNLRISTQDLVTC 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  +    A  L S T+HR  L  
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLAC 105

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNY 176
             + +K   DS   N H+A+   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 63/118 (53%), Gaps = 9/118 (7%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           S++P   S+  ++ RL R++++  + L+ +  Y++ L  +    A  L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI-LPRDDNILNCK 189
             + +K   DS   N H+AK   G     +++++E + ++ +N+ + +  DD IL+ +
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDLILDLR 196

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  +    A  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNY 176
             + +K   DS   N H+A+   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 77  SRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTA 134
           +R+P   S+  ++ RL RY+++    L+ +  Y++ L  +    A  L S T+HR  L  
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLAC 105

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNY 176
             + +K   DS   N H+A+   G     +++++E + L+ +N+
Sbjct: 106 LILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 57/140 (40%), Gaps = 13/140 (9%)

Query: 50  ISRMLSFLIRIND-----SIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLI 104
           I  +L    +IND     +I  ++  +   F  + PP +S  D++ R+         V +
Sbjct: 326 IELILQLSKKINDNANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYL 385

Query: 105 ASVYYIDLL--------SAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVG 156
            + Y + L+          +     L     HR +++   + +K L D   + ++  KV 
Sbjct: 386 GATYLLQLVFLTRDEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVF 445

Query: 157 GVQCSELHVLESEFLKRVNY 176
           G+    L  LE  F+  VN+
Sbjct: 446 GISKRLLTKLEISFMASVNF 465

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 65/131 (49%), Gaps = 7/131 (5%)

Query: 51  SRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYI 110
           + M+ FL+   +SI +   SE +    ++P   S+  ++ RL  +S+++   L++++ Y+
Sbjct: 17  NEMIDFLVSTTNSIIQI-ESETSSTSQQIP---SLALFIKRLIVHSNVQTPTLMSTLVYL 72

Query: 111 DLLSAMYTAFSLN-SLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
             L  +  +  +    T HR  +    + +K L DS   N H+ +   G  +  E++ +E
Sbjct: 73  TKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSSPLNRHWTQYTNGLFKIQEINTIE 132

Query: 168 SEFLKRVNYRI 178
            E L+  N+ +
Sbjct: 133 RELLEYFNWDV 143

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 59/140 (42%), Gaps = 9/140 (6%)

Query: 45  DLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLI 104
           DL++ +S+ +     I  +I  ++  +   F  + PP +S  D++ R+         V +
Sbjct: 336 DLILQLSKKIDENANIL-AISAEDPQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAIVYL 394

Query: 105 ASVYYIDLL--------SAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVG 156
            + Y + L+          +     L     HR +++   + +K L D   + ++  KV 
Sbjct: 395 GATYLLQLVFLTRDELDGPIKLKAKLQEDQTHRIIISTIRIATKLLEDFVHSQNYICKVF 454

Query: 157 GVQCSELHVLESEFLKRVNY 176
           G+    L  LE  FL  VN+
Sbjct: 455 GISKRLLTKLEISFLASVNF 474

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 37.4 bits (85), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 56/114 (49%), Gaps = 5/114 (4%)

Query: 81  PQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVG 138
           P  S+ +++  L  +S+++   L+A+  Y+  L ++     + + + T HR  L    + 
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 139 SKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNCKA 190
           +K L DS   N H+A    G +   E++ +E E L+  ++ +     +++ C A
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITCLA 157

>SAKL0A03938g Chr1 (367076..368581) [1506 bp, 501 aa] {ON} weakly
           similar to uniprot|Q6B153 Saccharomyces cerevisiae
           YPL219W PCL8 Cyclin interacts with Pho85p
           cyclin-dependent kinase (Cdk) to phosphorylate and
           regulate glycogen synthase also activates Pho85p for
           Glc8p phosphorylation
          Length = 501

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 62/139 (44%), Gaps = 14/139 (10%)

Query: 27  DPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVY 86
           + +PE++     S    T     IS +L    ++ D +P  +  +   F  +  P +S  
Sbjct: 327 EEIPELSSEEALSMFSET-----ISMLLKLSSKLQDPVP--DLPQHIPFIMKSSPSLSYE 379

Query: 87  DYLMRLTRYSSLEPAVLIASVYYIDLL-------SAMYTAFSLNSLTVHRFLLTATTVGS 139
           +YL R+       P V + + Y +  L       S +  +F L    +HR ++ +  + +
Sbjct: 380 EYLERIHSKLMFSPVVYLTATYLLHELTLTRQQDSKLALSFPLKITQIHRIIIASIRLAA 439

Query: 140 KGLCDSFCTNSHYAKVGGV 158
           K L D   ++++++KV GV
Sbjct: 440 KLLEDFVHSHAYFSKVCGV 458

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 65/132 (49%), Gaps = 9/132 (6%)

Query: 63  SIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--AF 120
           S+P   +S       R+P   S+  ++ +L RY+++  + L+ +  Y+  L  +    A 
Sbjct: 36  SLPTPPTSPSDSKQQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDAT 92

Query: 121 SLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI 178
            L S T+HR  L    + +K   DS   N H+A+   G     +++++E + L  +N+ +
Sbjct: 93  GLPS-TIHRMFLACLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNWDL 151

Query: 179 -LPRDDNILNCK 189
            +  +D IL+ +
Sbjct: 152 RINENDLILDLR 163

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 36.6 bits (83), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 25/114 (21%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 79  VPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATT 136
           +PP   + +++  L  +S+++   L+A+  Y+  L  +     + + + T HR  L    
Sbjct: 50  IPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCLI 105

Query: 137 VGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNC 188
           + +K L DS   N H+ K   G +   E++ +E E L+   + +      ++ C
Sbjct: 106 LAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 3/98 (3%)

Query: 84  SVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTV-HRFLLTATTVGSKGL 142
           S+  ++  + +YS ++   L+AS  +++ L  +   +     T  HR  L    + SK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 143 CDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI 178
            DS   N H+ K   G +   E++ +E E L+ +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 21/143 (14%)

Query: 83  ISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLN-SLTVHRFLLTATTVGSKG 141
           +S+ +++  L   S+++   L+++  Y+  L ++  A  L    T HR  L    + +K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYR---------------ILPRDDN 184
           L DS   N H+A    G +   E++ +E E L+  ++                + P  D 
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAICLAPFLAPIKDQ 164

Query: 185 ILNCKAERREGLFVTATYAKENR 207
           +L   A+++E LF+ +  A + R
Sbjct: 165 LL---AKKQELLFLHSPLAGQPR 184

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 8/122 (6%)

Query: 63  SIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL--------S 114
           ++  ++  +   F  + PP +S  D++ R+         V + + Y + L+         
Sbjct: 352 AVSSEDPQKFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNG 411

Query: 115 AMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRV 174
            +     L     HR +++A  + +K L D   + ++  KV G+    L  LE  F+  V
Sbjct: 412 PVKLKAKLQEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASV 471

Query: 175 NY 176
           N+
Sbjct: 472 NF 473

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 45/94 (47%), Gaps = 8/94 (8%)

Query: 73  TRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL--------SAMYTAFSLNS 124
           +RF  +  P +S  D++ R+      +  V +++ Y + +L        +++   F L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 125 LTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGV 158
             +HR ++    + +K L D   ++ +++KV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 81  PQISVYDYLMRLTRYSSLE-PAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGS 139
           P   +  ++  L ++S+++ P ++  SVY   L S + +       T HR  L    + +
Sbjct: 45  PAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 140 KGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNIL 186
           K L DS   N H+A+   G +   E++ +E E L+  ++ +    D+++
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLI 153

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 60/129 (46%), Gaps = 5/129 (3%)

Query: 53  MLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSL-EPAVLIASVYYID 111
           M+ +L ++ +SI      E+    S  PP  ++ +++  L   S +  P ++ ++VY + 
Sbjct: 19  MIKYLAKVTESIVTHLRPEVR--SSDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVR 76

Query: 112 LLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGG--VQCSELHVLESE 169
           L   +         T HR  L    + +K L D+   N H++K     +   E++++E E
Sbjct: 77  LKDILPPNIIGIETTRHRLFLGCLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERE 136

Query: 170 FLKRVNYRI 178
            L  + +R+
Sbjct: 137 LLSYLRWRV 145

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 23/111 (20%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 85  VYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKGL 142
           ++ ++ ++   S+++   L+A+  Y++ L  +     + + + T HR  L    + +K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 143 CDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAE 191
            DS   N H++    G ++  E++ +E E L+  N+ +     +++N  A 
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDVKITSSDLINALAH 157

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 7/117 (5%)

Query: 70  SELTRFHS--RVP-PQISVYDYLMR-LTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSL 125
           SE  ++ S  +VP  + S+  YLM  L R  S    V++AS Y+  L +++      N  
Sbjct: 70  SETVKYLSTKKVPNEKSSIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPE 129

Query: 126 TVH---RFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRIL 179
            VH   R  L+   +  K L D   +   ++ + G+   +L +LE   L R+NY ++
Sbjct: 130 FVHCSKRIFLSCLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLV 186

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/122 (20%), Positives = 50/122 (40%), Gaps = 8/122 (6%)

Query: 63  SIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL--------S 114
           +I  ++  +   F  + PP +S  D++ R+         V + + Y + L+         
Sbjct: 344 AISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNG 403

Query: 115 AMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRV 174
            +     L     HR +++   + +K L D   + ++  KV G+    L  LE  F+  V
Sbjct: 404 PIKLKTKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACV 463

Query: 175 NY 176
           N+
Sbjct: 464 NF 465

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 76  HSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLN-SLTVHRFLLTA 134
           H+ VP   S+  ++ RL RY+++  + L+ +V Y++ L  +  + +     T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 135 TTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLK 172
             + +K   DS   N H+ K   G     +++++E + L+
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQ 149

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 84  SVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKG 141
           S+  ++ RL R++++  + L+ +  Y++ L  +    A  L S TVHR  L    + +K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 142 LCDSFCTNSHYAKVGG--VQCSELHVLESEFLKRVNY 176
             DS   N H+AK         +++++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 57/130 (43%), Gaps = 8/130 (6%)

Query: 52  RMLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLE-PAVLIASVYYI 110
            M+ FL     S+   N +++     R    +S+ D++  L R+S+++ P ++  +VY  
Sbjct: 18  EMVHFLAATTASVISINDTDV-----RHGSTVSLVDFIKSLIRHSNVQTPTLMATTVYLT 72

Query: 111 DLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLES 168
            L S +         T HR  +    + +K L DS   N H+     G     +++ +E 
Sbjct: 73  KLRSILPHDVCGIETTRHRIFIGCLILAAKNLNDSSPLNKHWTNYTDGLFTLEDVNTIER 132

Query: 169 EFLKRVNYRI 178
           E L   ++ +
Sbjct: 133 ELLSLFSWNL 142

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 54/109 (49%), Gaps = 11/109 (10%)

Query: 84  SVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--AFSLNSLTVHRFLLTATTVGSKG 141
           S++ ++ RL RY+++  A L+ +  Y++ L  +    A  + S T HR  L    + +K 
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPS-TAHRIFLACLILSAKF 111

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLK------RVNYRILPRD 182
             DS   N H+ K   G     +++++E + L+      RV +R L RD
Sbjct: 112 HNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AER440C
          Length = 444

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 2/67 (2%)

Query: 127 VHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNIL 186
           +++ L+ A  + +K   D   TN  +++  G++CS ++  E E+L    +R+   +D   
Sbjct: 225 IYQNLMVAFVLANKFNDDKTFTNKSWSQATGMKCSVINTYEREWLAVFEWRLF--EDGFE 282

Query: 187 NCKAERR 193
           N +A R 
Sbjct: 283 NYEAYRE 289

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 11/113 (9%)

Query: 84  SVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTATTVGSKG 141
           S+  ++ +L RY+++  + L+ +V Y+  L  +    A  L S T HR  L    + +K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 142 LCDSFCTNSHYAKV--GGVQCSELHVLESEFLK------RVNYRILPRDDNIL 186
             DS   N+H+++   G     +++++E + L+      R+N   L +D   L
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHWDLRINQDALAQDLQWL 166

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 63/129 (48%), Gaps = 10/129 (7%)

Query: 53  MLSFLIRINDSIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDL 112
           ML+FLI   +S+ K     + + +S  P ++S++  +  L   S ++ + L+A+  Y+D 
Sbjct: 30  MLTFLISKTNSMIK-----IKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDR 82

Query: 113 LSAMYTAFSLN-SLTVHRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESE 169
           LS +  +       T HR  L    + SK L DS   N H+ K   G +   E++ +E E
Sbjct: 83  LSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERE 142

Query: 170 FLKRVNYRI 178
            L   N+ I
Sbjct: 143 LLSYFNWDI 151

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLL 132
           +  R+P   S+  ++  L RY+++    L+ +V Y++ L  +    A  L S T+HR  L
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFL 103

Query: 133 TATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLE 167
               + +K   DS   N H+ K   G     +++++E
Sbjct: 104 ACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 78  RVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTAT 135
           R+P   S+  ++ RL RY+++    L+ +V Y++ L  +    A  L S T+HR  L   
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPS-TIHRIFLACL 106

Query: 136 TVGSKGLCDSFCTNSHYAK 154
            + +K   DS   N H+ K
Sbjct: 107 ILSAKFHNDSSPLNKHWVK 125

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 50/113 (44%), Gaps = 15/113 (13%)

Query: 80  PPQISVYD----------YLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--AFSLNSLTV 127
           PP   +YD          ++ +L  Y+ +    L+ ++ Y++ L  +    A  + S T+
Sbjct: 41  PPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPS-TL 99

Query: 128 HRFLLTATTVGSKGLCDSFCTNSHYAKV--GGVQCSELHVLESEFLKRVNYRI 178
           HR  L    + +K   DS   N H+ K   G     +++++E   L  +N+ +
Sbjct: 100 HRIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 78  RVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMY--TAFSLNSLTVHRFLLTAT 135
           R+P   S+  ++ RL RY+++    L+ +V Y++ L  +    A  L S T+HR  L   
Sbjct: 56  RLP---SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACL 111

Query: 136 TVGSKGLCDSFCTNSHYAK 154
            + +K   DS   N H+ +
Sbjct: 112 IISAKFHNDSSPLNKHWTR 130

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 76  HSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYT--AFSLNSLTVHRFLLT 133
           H R  P  S+  ++ RL RY+++  + L+ +  Y++ L  +    A  L S T HR  L 
Sbjct: 53  HKRTLP--SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLA 109

Query: 134 ATTVGSKGLCDSFCTNSHYAK-VGGVQCSE 162
              + +K   DS   N H+A    G+ C E
Sbjct: 110 CLILSAKFHNDSSPQNKHWAAYTDGLFCLE 139

>CAGL0E05918g Chr5 complement(585960..587405) [1446 bp, 481 aa] {ON}
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 481

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 13/121 (10%)

Query: 51  SRMLSFLIRIND-----SIPKDNSSELTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIA 105
           +  L  L+R+++     S   DN+     F  +  P IS +D++ R+         + + 
Sbjct: 317 TETLDILLRLSENENMISEKADNNENYHYFSMKSAPSISHHDFIQRIQNKCMFGSIIYLG 376

Query: 106 SVYYIDLL--------SAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGG 157
           + Y + +L          +     L    VHR ++    + +K L D   ++ +  KV G
Sbjct: 377 ATYLLQILFLTREYNDGPLRLKHKLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCG 436

Query: 158 V 158
           +
Sbjct: 437 I 437

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 126 TVHRFLLTATTVGSKGLCDSFCTNSHYAKVGG--VQCSELHVLESEFLKRVNYRI 178
           T HR  L    + +K L DS   N H+AK     +   E++ +E E L   ++ +
Sbjct: 91  TRHRIFLGCLILSAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>Skud_16.494 Chr16 complement(859384..861351) [1968 bp, 655 aa] {ON}
           YPR190C (REAL)
          Length = 655

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 44/105 (41%), Gaps = 5/105 (4%)

Query: 116 MYTAFSLNSLTVHRFLLTATTVGSK----GLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
           M    SL SLTV  +L  AT+   K     L    C   +  ++  +  + +  L  +FL
Sbjct: 160 MQNVISLGSLTVQDYLSNATSESMKYTISSLFVQLCEMGYLIEISKLHYTPIEDL-WQFL 218

Query: 172 KRVNYRILPRDDNILNCKAERREGLFVTATYAKENRGPNNGFNVL 216
              +Y+ +PR+  + + K   +  +     +AK    PN    +L
Sbjct: 219 YDKHYKAIPRNSPLSDLKKRSQAKMNAKTDFAKIMNKPNELSRIL 263

>NCAS0A00960 Chr1 (190738..192093) [1356 bp, 451 aa] {ON} Anc_6.236
           YGL134W
          Length = 451

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 8/99 (8%)

Query: 81  PQISVYDYLMRLTRYSSLEPAVLIASVYYIDLL--------SAMYTAFSLNSLTVHRFLL 132
           P +S  D++ R+         V +++ Y   +L          +     L    VHR ++
Sbjct: 324 PSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDRDERDGPIKLKHKLQENEVHRMII 383

Query: 133 TATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFL 171
               VG+K + D   ++ ++ KV GV    L  LE   L
Sbjct: 384 ATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTLL 422

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,000,829
Number of extensions: 1114748
Number of successful extensions: 2916
Number of sequences better than 10.0: 113
Number of HSP's gapped: 2936
Number of HSP's successfully gapped: 117
Length of query: 280
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 172
Effective length of database: 41,097,471
Effective search space: 7068765012
Effective search space used: 7068765012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)