Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11066g6.25ON73573537140.0
Kwal_56.224476.25ON73573521640.0
SAKL0E01452g6.25ON73773818550.0
KLLA0D01309g6.25ON74472517460.0
ACL001C6.25ON74573716610.0
KNAG0M012306.25ON73874416480.0
Kpol_1037.296.25ON74674216350.0
TPHA0J003706.25ON74371516190.0
KAFR0G026606.25ON73574716140.0
Ecym_30306.25ON74774616100.0
CAGL0E02585g6.25ON73774616040.0
ZYRO0C07678g6.25ON74175215910.0
NCAS0H008606.25ON75550515530.0
YOR001W (RRP6)6.25ON73374415340.0
Suva_15.1766.25ON74574515290.0
Smik_15.1706.25ON77374715150.0
TDEL0G044406.25ON73571715100.0
NDAI0D008506.25ON79077415050.0
TBLA0A071706.25ON77175214950.0
Skud_15.1626.25ON73476514870.0
TDEL0C00180na 1ON58852781.1
TPHA0N008305.227ON55889752.2
KAFR0E025305.477ON84274743.4
NDAI0D016005.409ON327126733.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11066g
         (735 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...  1435   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   838   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   719   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   677   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   644   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   639   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   634   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   628   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   626   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   624   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   622   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   617   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   602   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   595   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   593   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   588   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   586   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   584   0.0  
TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...   580   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   577   0.0  
TDEL0C00180 Chr3 complement(21059..22825) [1767 bp, 588 aa] {ON}       35   1.1  
TPHA0N00830 Chr14 (185748..187424) [1677 bp, 558 aa] {ON} Anc_5....    33   2.2  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    33   3.4  
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}                33   3.6  

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score = 1435 bits (3714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/735 (94%), Positives = 698/735 (94%)

Query: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60
           MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL
Sbjct: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60

Query: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDS 120
           LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDS
Sbjct: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDS 120

Query: 121 PSLHDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAH 180
           PSLHDGAPKKILKPQLLFKRPIDNSESHPF        HALRSLDESLRLTAEQEDVPAH
Sbjct: 121 PSLHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAH 180

Query: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAID 240
           YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTD              IAID
Sbjct: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAID 240

Query: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300
           LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII
Sbjct: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300

Query: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360
           WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL
Sbjct: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360

Query: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420
           KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP
Sbjct: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420

Query: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480
           IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT
Sbjct: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480

Query: 481 TPALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSED 540
           TPALIMATSTFVTEHIRQNA               NEFGQLLNSANTVQNSSPTKMSSED
Sbjct: 481 TPALIMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSSED 540

Query: 541 IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN 600
           IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN
Sbjct: 541 IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN 600

Query: 601 RRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVL 660
           RRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVL
Sbjct: 601 RRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVL 660

Query: 661 KQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPSV 720
           KQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPSV
Sbjct: 661 KQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPSV 720

Query: 721 KKRKKTKGLQKSFRG 735
           KKRKKTKGLQKSFRG
Sbjct: 721 KKRKKTKGLQKSFRG 735

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/735 (54%), Positives = 525/735 (71%), Gaps = 1/735 (0%)

Query: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60
           MA+    +  S+L QV+ TIRASSA++AQDV FYK+LD +I+ S++  SA+LL LIND++
Sbjct: 1   MAKTQEDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVV 60

Query: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDS 120
           +S+D+NND+IE G  GLE++W+N+GEVMDLLFEKSEHALAA +K+ +  +   +QYLDDS
Sbjct: 61  ISIDDNNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGSNIIGNNLQYLDDS 120

Query: 121 PSLHDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAH 180
             L D    KI KPQ  F RP+DN+ESHPF        +ALR LD+ L+LT E+E +PAH
Sbjct: 121 QPLTDTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAH 180

Query: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAID 240
           YP PYEYEIDHQEY+ESVL+I  P+PS PW+ET+A WVDN                +AID
Sbjct: 181 YPHPYEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAID 240

Query: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300
           LEHHDYRTYYGITCLMQISTRE DWL+DTIALRD LW+LNE+FT+PK+ KV HGAFMD+I
Sbjct: 241 LEHHDYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVI 300

Query: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360
           WLQRDLGLY+VSLFDT+HASRLLG PKHSLAYLLERYAHFKTSKKYQL+DWR+RPL K L
Sbjct: 301 WLQRDLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPL 360

Query: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420
           KAYARADTHFLLNIYD MRNSLIEQ KL+Q LH+SR VAKRRFE+T FRP ++TS V+SP
Sbjct: 361 KAYARADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSP 420

Query: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480
           +EREDPWR+L+F YNIPQSKS L++RLYEWRD +ARRDDESPRYV+PNQLLV+L +NAPT
Sbjct: 421 VEREDPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPT 480

Query: 481 TPALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSED 540
               +++ ++FVTEH+R NA               + F   +N  ++ ++   +K+S  D
Sbjct: 481 DTYGLLSVTSFVTEHVRSNAKSLSQLIKKTLASPQDLFTDQINHMDSNKSMVDSKLSPGD 540

Query: 541 IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN 600
           ++ N + F+++             +  G SLF  K +P E YVSYQ ++   ++   L++
Sbjct: 541 VKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVSYQGTQVHHIEPTVLDD 600

Query: 601 RRHQVSKKYEAERDIA-RPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIV 659
           RR  V++      ++  + QV +    +  V D+    E  E +++     KE+ DE++V
Sbjct: 601 RRELVAQNITTTANVTEKLQVAVEKTPAPEVSDELDEGEAKELSDDTVSQLKEDKDEIVV 660

Query: 660 LKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAAGPPS 719
           LK+RK L        +      E LD ++ +KI+ A ++  R+  KRFDPYA  A+GP  
Sbjct: 661 LKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTATASVPRKSTKRFDPYAIQASGPDG 720

Query: 720 VKKRKKTKGLQKSFR 734
           VK+RKKT+G+QKSF+
Sbjct: 721 VKRRKKTRGIQKSFK 735

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/738 (49%), Positives = 494/738 (66%), Gaps = 23/738 (3%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L+ ++ T+RA+SA++AQD+ F+K+LD  I+ SV   S++LL LIN++LLS+DENND IE
Sbjct: 9   LLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSIDENNDTIE 68

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDSPSLHDGAPKKI 131
            G +  + +W ++G++MD LFEKS+HA  A ++    + +  VQYLDDS   +    K+I
Sbjct: 69  YGKDNFQESWKDIGDIMDNLFEKSDHAFDALKRNSINQGNSNVQYLDDSSRSNLNPSKRI 128

Query: 132 LKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDH 191
            KPQL FK PIDN+ESHPF        HALR L E L+ T E E++P+HYP PY YEID 
Sbjct: 129 EKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYPHPYGYEIDT 188

Query: 192 QEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYRTYYG 251
           QEYNES+LQI +P+PS PW++T+  WVD  +              IA+DLEHHDYR+YYG
Sbjct: 189 QEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLEHHDYRSYYG 248

Query: 252 ITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIV 311
           I CLMQISTRE+DWL+DTIALR++L +LNE+FTDP + KV HGAFMDIIWLQRDLG+Y+V
Sbjct: 249 IVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWLQRDLGIYVV 308

Query: 312 SLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFL 371
           SLFDTYHASR LG P+HSLAYLLE++A FKTSKKYQL+DWR+RPL K ++AYARADTHFL
Sbjct: 309 SLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRAYARADTHFL 368

Query: 372 LNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLM 431
           LNIYD +RNSLIEQNKL+ VLHDSRNVAKRRFE+T+FRPKIV++ VFSPIE+++PWR LM
Sbjct: 369 LNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIEKDEPWRNLM 428

Query: 432 FQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTF 491
           +QYNIP S+  L+R+LYEWRD +ARRDDESPRYV+PNQLLVSL   APT PA +++ S F
Sbjct: 429 YQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDPAGVLSVSNF 488

Query: 492 VTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSED---------IE 542
           +T+++R N+                    L N   +  N+  +++  +D         I+
Sbjct: 489 ITDYVRSNSKMLSNLIKKT-------LESLKNGDVSTNNAGSSQLEEKDLSQVLSISQIQ 541

Query: 543 KNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFV-PCEEYVSYQESRASLVDHNSLENR 601
                F           +A   +   S LF    +   +  V Y ++   ++D N L+ R
Sbjct: 542 NMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQLQER 601

Query: 602 RHQVSKKY-EAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVL 660
           + +VS+K  E +    R  V++    +  V  K+   +D+ +   E    +   DE+IVL
Sbjct: 602 KLEVSEKLKEVQEPDFRLHVNVTTKETDEVS-KDVSEKDDVNRASETDPLETNKDEIIVL 660

Query: 661 KQRKTLADKEQRAVDKATPSIEPLDLQSARKIL--EAPSNNVRRPKKRFDPYATLAAGPP 718
           K++K    ++++ V  +T  +EP+D ++A K+L     S+  +  K+RFDPY +   GP 
Sbjct: 661 KKKKRHEPQDRKKVGNST-DVEPMDYKNAEKLLGNSKKSSKQKTTKRRFDPYTSENVGPQ 719

Query: 719 SVKKRKK-TKGLQKSFRG 735
           S KKRKK T G   SF+ 
Sbjct: 720 SAKKRKKPTPGKNMSFKN 737

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/725 (46%), Positives = 477/725 (65%), Gaps = 14/725 (1%)

Query: 6   GSED-GSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64
            SED  ++L+ ++ T+R+SSA+ AQD+ FYK+LD +I  S+ + S  +L LIND+LLS+D
Sbjct: 2   SSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSID 61

Query: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDSPSL 123
            NND+I+QG +    +W ++  +MD LFEKS+HAL              +++YL+D    
Sbjct: 62  PNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDRS 121

Query: 124 HDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQ 183
           ++   K+I KPQL FK P+DN+E HPF        H+L+  + SL++  E+E +P+HYP 
Sbjct: 122 NNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYPH 181

Query: 184 PYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEH 243
           PYEYEIDHQ+YN+S+L  +EP+PS  WDETEA WVD  +              +AIDLEH
Sbjct: 182 PYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLEH 241

Query: 244 HDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQ 303
           HDYR+YYGI CLMQIS RE DW++DTIALR++L+ILN++FTDP +TKVLHGAFMDIIWLQ
Sbjct: 242 HDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWLQ 301

Query: 304 RDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAY 363
           RDLGLYIV LFDTYHASR+LG PKHSLAYLLER+A+FKTSKKYQL+DWR+RPL K + AY
Sbjct: 302 RDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLAY 361

Query: 364 ARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIER 423
           ARADTHFLLNI+D +RNSL+EQNK+S VLH+SR VAKRRFE+++FRPK+ +S VFSPIE+
Sbjct: 362 ARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIEK 421

Query: 424 EDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPA 483
           ++PW+ +MFQYNIP SK LL+RRLYEWRD +ARRDDESPRYV+PNQLLVSL   APT P 
Sbjct: 422 DEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEPI 481

Query: 484 LIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQ----LLNSANTVQNSSPTKMSSE 539
            +++ S++V+EH+R N+                        LL SA +        +++ 
Sbjct: 482 NVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITTS 541

Query: 540 DIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQK-KFVPCEEYVSYQESRASLVDHNSL 598
            I+    +F     + + +K  +   S  S LF     +     V Y     +L+  + L
Sbjct: 542 QIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHEL 601

Query: 599 ENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED-NE--SAEEENKARKEEMD 655
             R+H++++  E E    + Q  +  ++      + +  E+ NE  +++   +  +E  D
Sbjct: 602 LKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDPSQEEIEENKD 661

Query: 656 EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNV---RRPKKRFDPYAT 712
           EVI L++R++ ++ +++ +     S E +D  +   +L +  NN    +  K+RFDPY+ 
Sbjct: 662 EVITLRKRQSQSNNKRKTISPPA-SHEIMDYAAGSDLLNSTKNNTNSQKHKKRRFDPYSV 720

Query: 713 LAAGP 717
              GP
Sbjct: 721 EHVGP 725

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/737 (45%), Positives = 468/737 (63%), Gaps = 31/737 (4%)

Query: 6   GSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDE 65
            +++  +  ++++TIRA++A++AQD+ FY++L PS+   +++ SA ++ LIN++LLSVDE
Sbjct: 3   STDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSVDE 62

Query: 66  NNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSP 121
           NN+ ++ G +  E +W  +  VMD +FEKS+HA          R+ G     +QYL DS 
Sbjct: 63  NNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEG---VNMQYLADS- 118

Query: 122 SLHDGAP-KKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAH 180
           S  D  P K+I KPQLLFK P+DN+E HPF        HAL+ L+ESL L  E+E+VPAH
Sbjct: 119 SHDDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAH 178

Query: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAID 240
           YP PYEYEID Q YN+SVL++ E +   PW+ TE  WVDN +              +A+D
Sbjct: 179 YPHPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVD 238

Query: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300
           LEHHDYR+YYGI CLMQIS+R KDWL+DTIALRDDL +LN +  DP + KV HGAFMD+I
Sbjct: 239 LEHHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMI 298

Query: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360
           WLQRDLGLY+VSLFDTYHASR LG PKHSLAYLLE +A FKTSKKYQL+DWRVRPLPK L
Sbjct: 299 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPL 358

Query: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420
           + YAR+DTHFLL+IYD++RN+L++  KL++VL+ SRNVAKRRFE+T+FRP+I  S+V+SP
Sbjct: 359 RDYARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSP 418

Query: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480
           IE  +PWR LM+QYN+P SK  L+++LYEWRD VARRDDES RYV+PNQLLVSL   +P+
Sbjct: 419 IESTEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPS 478

Query: 481 TPALIMATSTFVTEHIRQNAXXXX---XXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMS 537
             A +++ ST+VT+++R NA                      +  +S   + N + T +S
Sbjct: 479 ETAGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERALSNPAAT-LS 537

Query: 538 SEDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNS 597
              I+     F   L +   +  + C     S LF          V Y   +  ++  N 
Sbjct: 538 LHMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNV 597

Query: 598 LENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED---NESAEEENKARKEEM 654
           L+ R+H + +K+ ++     P   I A S  +  +    +ED   +E  E +N+ +K+E 
Sbjct: 598 LQTRKHALLQKFTSQP--VEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNEVQKDEP 655

Query: 655 D----EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL------EAPSNNVRRPK 704
           D    E++VL+++K      Q+    ++   E +D  +A+++L       A   +  RP+
Sbjct: 656 DFEKSEIVVLRKKKKA--HAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDKDRPR 713

Query: 705 KR-FDPYATLAAGPPSV 720
           KR FDPY      P  V
Sbjct: 714 KRKFDPYGQDNNAPSGV 730

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/744 (45%), Positives = 468/744 (62%), Gaps = 28/744 (3%)

Query: 8   EDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENN 67
           E   +L++ + T+RASS++  QDV F+ NLD ++A+SV  +   +L +INDIL S+DEN+
Sbjct: 5   EQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSIDENS 64

Query: 68  DIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL--AAGEKRDNGELSKTVQYLDDSPSLHD 125
               + +E +  +W +   + D LFEKS+ ++   A   R NG+    VQYLDD      
Sbjct: 65  KPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLVGNDS 124

Query: 126 GAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPY 185
            + K+I KPQL F RP+DNSES PF        +AL+ L ESL++    E++P+HYP PY
Sbjct: 125 SSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHYPNPY 184

Query: 186 EYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHD 245
           +YEI +QEYN  +L+   P+PS PW E+E  WVD+T+              +AIDLEHHD
Sbjct: 185 DYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDLEHHD 244

Query: 246 YRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRD 305
           YR+YYGI CLMQISTR+ D+L+DTIALRD+L ILN+VFTDP +TKV HGAFMDIIWLQRD
Sbjct: 245 YRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIWLQRD 304

Query: 306 LGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYAR 365
           LGLYIVSLFDT+HAS+ LG PKHSLAYLLE  A+FKTSKKYQL+DWR+RPL K +  YAR
Sbjct: 305 LGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMSVYAR 364

Query: 366 ADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERED 425
           ADTHFLLNI+D MRN LI+ NKL+ VL +SR VAKRRFE++ FRPK+    VF+PIE+E 
Sbjct: 365 ADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPIEKES 424

Query: 426 PWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALI 485
           PWRTLMFQYN+   K  LV+ LYEWRD +ARRDDESPRY++PNQLL+SL+   PT P  +
Sbjct: 425 PWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTDPVSL 484

Query: 486 MATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFG-QLLNSANTVQNSSPTKMSSEDIEKN 544
           ++ +++VT+ +R N+               ++ G Q   + NT   S+P  ++   I+  
Sbjct: 485 VSVNSYVTDCVRSNS--KVLANLIKSFVESSKLGPQSSYTPNTENTSTPFVLTLSQIKDI 542

Query: 545 SRMFEKFLEDFSYEKAADC-GIS-LGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRR 602
              F K  E+F   +++ C  IS L  S F       +  VSY +++ + V  + LE+R 
Sbjct: 543 GMRFTKLTENF---QSSSCQKISPLQRSSFFGDLSKGKVTVSYNDAKTTPVSQSVLESRS 599

Query: 603 HQVSKKYEAERD-------IARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMD 655
            Q ++  +A  D       I  P + +   S     +    + D+++ E+  K  KE+MD
Sbjct: 600 KQFNEYMKAFGDIEYKIPSIVEPVMDLPIPSGTTSTE----SADSKTVEKPPKNIKEDMD 655

Query: 656 EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEA----PSNNVRRPKKRFDPYA 711
           E++VLK+ K    K +   + A   I  +D     K+L              KKRFDP++
Sbjct: 656 EIVVLKKVKRELPKPKGNDEDAEREI--VDYSKEDKVLVQRQFDKKKKNNNNKKRFDPFS 713

Query: 712 TLAAGPPSVKKRKK-TKGLQKSFR 734
            ++ GP + KKRK  TKG   SF+
Sbjct: 714 AISEGPKAPKKRKAVTKGKNASFK 737

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/742 (45%), Positives = 470/742 (63%), Gaps = 24/742 (3%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L+ V++T+RA+S++ AQDV FY+NLD  I+TS+N  S  +  +IN +LLS++ENN+ +E
Sbjct: 9   LLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSINENNEELE 68

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSPSLHDGAPKK 130
            G EGLE  W +   VMD LFEKS+ +L    +      +K+  QYL DS        K+
Sbjct: 69  SGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQSDSNPSKR 128

Query: 131 ILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEYEID 190
           + KPQL F RP+DNSES PF        H+++S  +SL +  E E++P+HY  PYE EID
Sbjct: 129 VTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYAHPYEVEID 188

Query: 191 HQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYRTYY 250
            QEYN SVLQ++EP+ S PW+ +E+ WVD ++              IA+DLEHHDYR+YY
Sbjct: 189 KQEYNASVLQVAEPLKSQPWN-SESTWVDTSEALQSMLDKLKECTEIAVDLEHHDYRSYY 247

Query: 251 GITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYI 310
           GI CLMQISTR++D+L+DT+ALRD+L ILNEVF DP I KVLHGAFMDIIWLQRDLGLY+
Sbjct: 248 GIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWLQRDLGLYV 307

Query: 311 VSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHF 370
           VSLFDTYHASR LG P+HSLAYLLE+YA+FKTSKKYQL+DWRVRPL K + AYARADTHF
Sbjct: 308 VSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHAYARADTHF 367

Query: 371 LLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTL 430
           LLNIYD +RN LI +NKL++VL +SRNVAKRRFE++ FRPK+ +  VF+PIE+E+PWRTL
Sbjct: 368 LLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIEKEEPWRTL 427

Query: 431 MFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATST 490
           ++QYN+P +K  L++R++EWRDM+ARRDDESPRY++PNQL++SL    P  PA +++ S 
Sbjct: 428 VYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDPAGVISVSN 487

Query: 491 FVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTV-----QNSSPTKMSSEDIEKNS 545
            +T+H+R N+               +     L +   +     Q  +  K++   I+  +
Sbjct: 488 VMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLTISQIQNMT 547

Query: 546 RMFEKFLEDFS-YEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQ 604
            +F++   + S  EK  D    +   LF   F+   E V Y   +  +V +  L  R  +
Sbjct: 548 ALFKEIASNPSIIEK--DVSKKIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQLAGRAEE 605

Query: 605 VSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDN---------ESAEEENKARKEEMD 655
           V + +  E +     ++I +++   V + EA  ++          E+A   N    E+M+
Sbjct: 606 V-EGFMNEANNTTLAINIESSAEMHVEEPEAKEKNALFSPPISNVENASSSNTDGFEDMN 664

Query: 656 EVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKRFDPYATLAA 715
           ++IVLK  K   + +     +  P+ E +D      IL        + K++ DP+     
Sbjct: 665 DIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRENSK-KRKGDPFGEENG 723

Query: 716 --GPPSVKKRKK-TKGLQKSFR 734
             GP + KKRK+  +G   SF+
Sbjct: 724 LEGPKAAKKRKQINRGKNVSFK 745

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/715 (45%), Positives = 457/715 (63%), Gaps = 19/715 (2%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L  V++++RA+SA+ AQDV FY++LD  IA+S+ N S ++  +IN I+ SVDEN++ + 
Sbjct: 6   LLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENSEGLV 65

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSK-TVQYLDDSPSLHDGAPKK 130
           +G E L+ +W ++G ++D LFE ++H++ A  K      +   ++YL+DS +       +
Sbjct: 66  EGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESDNVTR 125

Query: 131 ILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEYEID 190
           + KPQL F  P+DNSE+HPF        +A+  LDE L++    ED P HYPQPYE EID
Sbjct: 126 LSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYETEID 185

Query: 191 HQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYRTYY 250
            QEYNE VLQ S+P+PS  W+ETEA WVDN +              +A+DLEHHD+R+YY
Sbjct: 186 KQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDFRSYY 245

Query: 251 GITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYI 310
           GITCLMQISTR  D+L+DTIALRD L +LN VFTDPKITK+LHGAFMDIIWLQRDLGLYI
Sbjct: 246 GITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDLGLYI 305

Query: 311 VSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHF 370
           VSLFDTYHASR LG P+HSLAYLLER+AHFKTSK+YQL+DWR RPL KA+ AYARADTHF
Sbjct: 306 VSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARADTHF 365

Query: 371 LLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTL 430
           LLNI+D +RN LI+++KL+ +LH+SR VAKRRFE++ ++P + +S VFSP E + PWR++
Sbjct: 366 LLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMPWRSM 425

Query: 431 MFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATST 490
           ++QYNIP  K  LV+RL+EWRD +ARRDDESPRY++PNQL+ SL    PT PA +++ + 
Sbjct: 426 IYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVISVNR 485

Query: 491 FVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQN--SSPTKMSSEDIEKNSRMF 548
            +T+ +R NA               N        + T ++  +S   +S+  I+     F
Sbjct: 486 MMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETSSNDLSTSQIKFIVSQF 545

Query: 549 EKFLEDFSYEKA--ADCGISLG--SSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQ 604
           E  LE +S   +   D     G  S +F K F   ++ ++Y +    L+    L +R+ +
Sbjct: 546 ENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQLSDRQKE 605

Query: 605 VSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEE------ENKARKEEMDEVI 658
           V    +   +IA     +    +H    K+   E  E   +      E+K  +E++DE+I
Sbjct: 606 VDAAMKQAEEIA---FSMEVQDTHKESMKQPFPEPEEVISQSHLPAFEDKEEQEDLDEII 662

Query: 659 VLKQRKTLADKEQRAVDKATPSIEP-LDLQSARKILEAPSNNVRRPKKR-FDPYA 711
           VLK  K   +++ R   ++  S    +D     KIL +  N  R P KR +DP++
Sbjct: 663 VLKDTKDRRNRQHRGRGRSADSDHTVIDYSKGDKIL-SQDNRRRTPNKRKYDPFS 716

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/747 (45%), Positives = 471/747 (63%), Gaps = 36/747 (4%)

Query: 8   EDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENN 67
           E   +L+ V+ T+RASS + AQDV FY++LD  ++ S+N ++  L  ++N I+LS+DEN 
Sbjct: 5   EQKKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENY 64

Query: 68  DIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL---AAGEKRDNGELSKTVQYLDDSPSLH 124
           + +++G E L  +W ++  ++D LFEKS+ +L     G K+     +   +Y +++ +  
Sbjct: 65  ETLDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKK--KPTNPPFEYFENATTTE 122

Query: 125 DGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQP 184
           +   K+I KPQL F  PIDNSESHPF        +AL+++DES +L    E+VP HY  P
Sbjct: 123 NIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAHP 182

Query: 185 YEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHH 244
           YEYEID+Q YN+S+LQ+ EP+PS  W ETE  WVDN +              IAIDLEHH
Sbjct: 183 YEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEHH 242

Query: 245 DYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQR 304
           DYRTYYGI CLMQISTRE D+L+DTIALR+DL +LNEVFTDP + KVLHGAFMDIIWLQR
Sbjct: 243 DYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQR 302

Query: 305 DLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYA 364
           DLGLYIVSLFDT+HASR LG P+HSLAYLLE +A+FKTSKKYQL+DWRVRPL KA+ AYA
Sbjct: 303 DLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAYA 362

Query: 365 RADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERE 424
           RADTHFLLNIYD +RN L+E NKL  VL++SRNVAKRRFE++ FRP++ + +V+S +E+E
Sbjct: 363 RADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEKE 422

Query: 425 DPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPAL 484
           DPWRTLMFQYNIP  +  L++ L+EWRDM+ARRDDESPRY++PNQL+V+L    PT PA 
Sbjct: 423 DPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPAG 482

Query: 485 IMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSA-NTVQNS--SPTKMSSEDI 541
           +++ S  VT+++R N+               ++  QL   A N  + S  S  KM+   I
Sbjct: 483 VISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKMTVSQI 542

Query: 542 EKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENR 601
           ++ + +F +       EK   C     +   Q K      Y      +  ++++ + E  
Sbjct: 543 KETASVFIQIA-----EKLGTC----NNDQQQSKSFARSNYFGSLSKKLDIIEYKNGE-- 591

Query: 602 RHQVSKKYEAER-DIARPQVH-IRAASSHAVCDKEAGAEDNESAEEENK--------ARK 651
           +H V ++    R +    QV+ +          KE      +  EE  K        A+ 
Sbjct: 592 KHSVKQQQLVSRFNTYTKQVNELTNVRYELPVHKEPPQLQKDDVEEVKKTIIADSIPAKP 651

Query: 652 E-EMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRR--PKKRFD 708
           E ++DEV+VLK+     +K +   ++    I+ +D   + KIL+      +R   K++FD
Sbjct: 652 EIDLDEVVVLKKVNRQPNKTKLEENE---KIDFIDYSKSEKILKGDKQRKKRESKKRQFD 708

Query: 709 PYATLAAGPPSVKKRKK-TKGLQKSFR 734
           P+A    GP + +KRK  T+G   S++
Sbjct: 709 PFAASNEGPKAARKRKSGTRGRNLSYK 735

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/746 (44%), Positives = 464/746 (62%), Gaps = 29/746 (3%)

Query: 11  SVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDII 70
           ++L +++ T+RA+S++ AQD+ F ++LD S+   ++  S  ++ L+N+++LS  + N+ +
Sbjct: 8   ALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILSTSKANNDL 67

Query: 71  EQGSEGLESAWSNVGEVMDLLFEKSEHAL---AAGEKRDNGELSKTVQYLDDSPSLHDGA 127
           E G + LE+AW ++  ++D LFEKS+H+L          + +L   +QYL+         
Sbjct: 68  EVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVDSQRDGKL 127

Query: 128 PKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEY 187
            ++I+KPQL FK P+DNSE HPF        HAL+ L+E   LT E E VPAHYP PYEY
Sbjct: 128 SQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAHYPHPYEY 187

Query: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYR 247
           EID+Q Y++SVL I EP+    WDE E  WVDN                IA+DLEHHDYR
Sbjct: 188 EIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVDLEHHDYR 247

Query: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307
           +YYG+ CLMQISTRE DWL+DTIALR DL +LNE+FTDP I KV HGAFMDIIWLQRDLG
Sbjct: 248 SYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDIIWLQRDLG 307

Query: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367
           LY+VSLFDTYHASR LG PKHSLAYLLE +A+FKTSKKYQL+DWR+RPL K +K YARAD
Sbjct: 308 LYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPMKTYARAD 367

Query: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427
           THFLLNIYD +RNSLI+++KLS VLH SRNVAKRRFE+T+FRPK+++  VFSPIE++DPW
Sbjct: 368 THFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSPIEKDDPW 427

Query: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487
           RTLM QYN+P  K  L+R+LY+WRDMVAR+DDES RYV+PNQLLVSL   AP+ P+ ++ 
Sbjct: 428 RTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPSDPSGLLT 487

Query: 488 TSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSED------- 540
             +++ +H+R NA                E     +   +++N + T +S++D       
Sbjct: 488 VKSYIPDHVRANA----RVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEMSVSL 543

Query: 541 IEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLEN 600
           I+   R F+  L++          +   S LF+       + V+Y      LV+   L +
Sbjct: 544 IKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDRELLD 603

Query: 601 RRHQVSKKYEAERDIARPQV--HIRAASSHAVCDKEAGAEDNESAEEENKAR----KEEM 654
           R+  +S+K+      A   +  HI   SS++    +  +     ++EE+K      KE+ 
Sbjct: 604 RKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSDDLKEDK 663

Query: 655 DEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL------EAPSNNVRRPKKRFD 708
            E+IVLK+++      +       P  E +D  +   IL      + P++     K++F 
Sbjct: 664 HEIIVLKRKRDYGSNTKST--SKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKRKFH 721

Query: 709 PYATLAAGPPSVKKRKKTKGLQKSFR 734
                + G  ++KK  ++KG   S++
Sbjct: 722 SDLQGSIGAAAIKK-PRSKGKTVSYK 746

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/746 (44%), Positives = 468/746 (62%), Gaps = 28/746 (3%)

Query: 6   GSEDG-SVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64
            S+ G +VL +V+ T+RAS+A+ +QDV F+K++D S+A S+      +  ++N+ILLS+D
Sbjct: 2   SSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSID 61

Query: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDSPSL 123
            NN+ ++  +E LE        VMD+LFEK++ +L     K    +  K +Q+LDD    
Sbjct: 62  NNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNVA 121

Query: 124 HDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQ 183
            +   ++I KPQL FK P+DNSESHPF        +AL+S++ES +L    ED+P H+ Q
Sbjct: 122 ENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQQ 181

Query: 184 PYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEH 243
           PYEYEI +QEYN  +L+  EP+PS  W +T A WVDN +              IA+DLEH
Sbjct: 182 PYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLEH 241

Query: 244 HDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQ 303
           HD+R+YYG+ CLMQISTR +D+++DTIALRDDL +LNEVFT+P ITKV HGAFMDIIWLQ
Sbjct: 242 HDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWLQ 301

Query: 304 RDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAY 363
           RDLGLYIVSLFDT+HAS+ LG PKHSLAYLLE+YA+FKTSKKYQL+DWR RPL KA+ AY
Sbjct: 302 RDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMAY 361

Query: 364 ARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIER 423
           ARADTHFLLNI+D MRN LI   KL+ VL +SRNVA RRFE++ ++PKI  +++F+P+E+
Sbjct: 362 ARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVEK 421

Query: 424 EDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPA 483
           E PWRTLM+QYNIP  K  L+R LYEWRDM+ARRDDESPRYV+PNQLLVSL    P  P 
Sbjct: 422 ESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDPI 481

Query: 484 LIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMS------ 537
            +++ S+ VT+H+R+N+                     L    ++ N  P+ +       
Sbjct: 482 SVVSVSSVVTDHVRRNSKTLANLIKKKLEEIK------LGEVKSINNRLPSSLDVSQDEL 535

Query: 538 ----SEDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLV 593
               S  IE  +  F++     +    +   ++  S +  +  +  E  V Y    A  V
Sbjct: 536 QFLPSHKIELMTGAFKEIENQLTQATKSKQAMT-SSVVLSEILLHPEHAVKYHNGSACSV 594

Query: 594 DHNSLENRRHQVSKK--YEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARK 651
           + + L++R     K     A ++I    + +  ++S+A  + E          +    ++
Sbjct: 595 EESELKDRYLSYIKATLLAASKNI---NMVLETSNSNAPLETEETHNKKSDQIQVIPEKQ 651

Query: 652 EEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKKR--FDP 709
           E+MDE++VLK++K  ++ ++   D      EP+D   A  IL + +  V++  K+  FDP
Sbjct: 652 EDMDEIVVLKKKKIHSNDQKAKHDDGDIVEEPVDYSKAN-ILASDNREVKKKDKKRVFDP 710

Query: 710 YATLAAGPPSVKKRK-KTKGLQKSFR 734
           Y++   GP + KKR+  TKG + SF+
Sbjct: 711 YSSTGEGPKAAKKRRLVTKGKKISFK 736

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/752 (44%), Positives = 458/752 (60%), Gaps = 49/752 (6%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L +V+ T+RA++A+ AQDV FY++LD  +A S++  S  L+ +IN  LL +D+N+ ++E
Sbjct: 9   LLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCIDQNSRLLE 68

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKTVQYLDDSPSLHDGAPKKI 131
            G E LE +  +   +MD LFEKS+ +L     R        + YLDD+        K+I
Sbjct: 69  GGKEKLEDSRKDFSNLMDNLFEKSDRSLDILRGRAPDRKGAALMYLDDAARSDMIPAKRI 128

Query: 132 LKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEYEIDH 191
           LKPQ+ F+RPIDN+E+HPF        HALR L + +RL    ED+P HYPQPYEYEI++
Sbjct: 129 LKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYPQPYEYEIEN 188

Query: 192 QEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYRTYYG 251
           QEYNES+L+I+EP+PS PWD +E  WVDN +              IA+DLEHHDYR+YYG
Sbjct: 189 QEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLEHHDYRSYYG 248

Query: 252 ITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLGLYIV 311
           I CLMQ+STR+ D+L+DT+ALRDDL +LNEVF +P I KV HGAFMDIIWLQRDLGLYIV
Sbjct: 249 IVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWLQRDLGLYIV 308

Query: 312 SLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARADTHFL 371
           SLFDTYHASR LG P+HSLAYLLE +A FKTSKKYQL+DWRVRPL KA+ AYARADTHFL
Sbjct: 309 SLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSAYARADTHFL 368

Query: 372 LNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPWRTLM 431
           LNIYD +RN LI +NKL+ VL +SRNVAKR F+++ +RPK+  S V+SP++R D W+ LM
Sbjct: 369 LNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVDRADGWKVLM 428

Query: 432 FQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMATSTF 491
            QYNIP  K +LV+ LYEWRD +ARRDDESPRYV+PNQLL  L    P  P  +++ S  
Sbjct: 429 NQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDPTGVISVSPT 488

Query: 492 VTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSEDIEK--NSRMFE 549
           VT+H+R NA                   Q+ ++ + ++  S       D+ +       E
Sbjct: 489 VTDHVRTNA-------KALANLIVKSLQQIADAGSDIKVESVQHKDQHDLSQVLTVGQIE 541

Query: 550 KFLEDFSYEKAADCGISLGSS--------LFQKKF-VPCEEYVSYQESRASLVDHNSLEN 600
             +  F     A  G+S G++        +F      PC  +V Y  S    V    +E 
Sbjct: 542 SQVSQFHDLSKAFKGLSQGTNSSNSSSSIIFGNILHAPC-GFVGYGRSLKKPVTDKQIEK 600

Query: 601 RRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEM------ 654
           R+ ++S+  E           I A ++  + +++ G+E      ++ K  + +       
Sbjct: 601 RKLELSEALE----------FIDAETATTIQEEDRGSELTHEPADDKKVSENDESKKEEA 650

Query: 655 ---------DEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRRPKK 705
                    +E+I LK+ K    K +R+ +++ P  EP+D + ++KILE    +    K+
Sbjct: 651 KETEPEEDKNEIITLKKVKDRGKKSKRS-NESEPE-EPIDYKKSKKILETEKKSKSTKKR 708

Query: 706 RFDPYAT---LAAGPPSVKKRKKTKGLQKSFR 734
            FDPYA        P   KKR+  +G   SF+
Sbjct: 709 AFDPYAASNDAGNAPKPKKKRRMARGKSASFK 740

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/505 (56%), Positives = 370/505 (73%), Gaps = 7/505 (1%)

Query: 1   MAQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDIL 60
           M++    ++ ++L +V+ T+RA+SA+ AQDV FY+++D  IA S+   S ++  +IN +L
Sbjct: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60

Query: 61  LSVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL---AAGEKRDNGELSKTVQYL 117
           LS+DEN++ ++   E LE  W + G +MD LFEKS+ ++     G    NG+    +QY+
Sbjct: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQ--SGMQYI 118

Query: 118 DDSPSLHDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDV 177
           D+         K+ILKPQL F  PIDN+ESHPF         AL+ L+ES+++  E E  
Sbjct: 119 DEFSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETS 178

Query: 178 PAHYPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXI 237
           P HYPQPYEYEIDHQEYN+ +LQ  +P+PS  W + E  WVD                 I
Sbjct: 179 PMHYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEI 238

Query: 238 AIDLEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFM 297
           A+DLEHHDYRTYYGITCLMQISTR+ D+LIDT+ALR+DL ILN VF +P ITKV HGAFM
Sbjct: 239 AVDLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFM 298

Query: 298 DIIWLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLP 357
           DIIWLQRDLGLY+V LFDT+HASR +G PKHSLAYLLE++A FKTSKKYQL+DWR+RPL 
Sbjct: 299 DIIWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLS 358

Query: 358 KALKAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSH- 416
           KA+ AYARADTHFLLNI+D MRNSLIEQNKL+ VL +SRNVAKRRFE+++FRPK++ ++ 
Sbjct: 359 KAMHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNG 418

Query: 417 -VFSPIEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLA 475
            V+SPIE++DPW+T+MFQYNIP  K  L++ LY+WRD +ARRDDESPR+V+PNQLLVSL 
Sbjct: 419 LVYSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLV 478

Query: 476 VNAPTTPALIMATSTFVTEHIRQNA 500
              P     +++ S  VT+++R N+
Sbjct: 479 AYTPIDAPGVVSVSNSVTDYVRSNS 503

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 637 AEDNESAEEENKARKEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL--- 693
           A + E    E   + E++DEVIVL++       + +  ++  P +E +D     K+L   
Sbjct: 650 ATNAEGQVNEMIEKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTND 709

Query: 694 ---EAPSNNVRRPKKRFDPYATLAAGPPSVKKRKK-TKGLQKSFR 734
                  NN    +KRFDPY+    GP + KKRK  T+G   SF+
Sbjct: 710 KNSRGGRNNNGNKRKRFDPYSAANEGPAAPKKRKNVTRGKNVSFK 754

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/744 (44%), Positives = 458/744 (61%), Gaps = 41/744 (5%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L++VI  +RA+S++ +QDV FYKNLD   +  + + + +L  + N+I+LS+DE+++  E
Sbjct: 9   LLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSIDEHHESFE 68

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSPSLHDGA 127
              E +   W+N G +MD L E S+H+L     A   +  G     +QYL +    +   
Sbjct: 69  LKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGS---DLQYLGEFSGKNFSP 125

Query: 128 PKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEY 187
            K++ KPQL FK PIDNSESHPF        +AL+ L ESLRL  + E+ P+HYP PYEY
Sbjct: 126 TKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEY 185

Query: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYR 247
           EIDHQEY+  +LQI E +PS  WD++   WVD +               IA+DLEHHDYR
Sbjct: 186 EIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYR 245

Query: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307
           +YYGI CLMQISTRE+D+L+DT+ LR++L ILNEVFT+P I KV HGAFMDIIWLQRDLG
Sbjct: 246 SYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLG 305

Query: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367
           LY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + AYARAD
Sbjct: 306 LYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAYARAD 365

Query: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427
           THFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP   +S V+SPIE+E PW
Sbjct: 366 THFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIEKESPW 425

Query: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487
           + LM+QYNIP  + +LVR LY+WRD++ARRDDESPR+V+PNQLL +L    PT    +++
Sbjct: 426 KILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDVIGVVS 485

Query: 488 TSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSEDIEKNSRM 547
            +  VTEH+RQNA                    L N  NT + ++P  + S + + +  +
Sbjct: 486 LTNGVTEHVRQNAKLLANLIR----------DALRNIKNTNEEATP--IPSSETKADGIL 533

Query: 548 FEKF--------LEDFSYEKAADCGIS-----LGSSLFQKKFVPCEEY-VSYQESRASLV 593
            E          +E FS    ++   S       SS+   K +P EE+ ++Y  S+  L 
Sbjct: 534 LETISVPQIRDVMERFSVLCNSNISKSRAKPVTNSSILLGKILPREEHDIAY--SKDGLP 591

Query: 594 DHNSLENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEE 653
           +    E+ R +      A  ++      I       V  +E    D  SA   +    + 
Sbjct: 592 NKVKTEDIRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDPASAPNHS-PEIDN 650

Query: 654 MDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL--EAPSNNVRRPKKRFDPYA 711
           +D+++VLK++     K+Q A +K     + +D      IL  +   NN ++ K+RFDP +
Sbjct: 651 LDDLVVLKKKNI--QKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRRFDPSS 708

Query: 712 TLAAGPPSVKKRK-KTKGLQKSFR 734
           + + GP + KKR+   KG   SF+
Sbjct: 709 SDSNGPRAAKKRRPAAKGKNLSFK 732

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/745 (43%), Positives = 460/745 (61%), Gaps = 32/745 (4%)

Query: 4   AHGSEDGSVL-NQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLS 62
           A  SE+  VL ++V+  IRA+S++ AQDV FY+NLD   +  + + S++L  ++N I+LS
Sbjct: 18  AMASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLS 77

Query: 63  VDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSP 121
           +DE++D +E   E +   W + G +MD L EKS+H+L    +  N   S   +QYL D  
Sbjct: 78  IDEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFS 137

Query: 122 SLHDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHY 181
                  K++ KPQL FK PIDNSESHPF        +AL+ L +SLR+   +E+ P HY
Sbjct: 138 GKDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHY 197

Query: 182 PQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDL 241
           P PYEYEIDHQEYN ++LQI   +PS PWD +E  W+++                IA+DL
Sbjct: 198 PHPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDL 257

Query: 242 EHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIW 301
           EHHDYR+YYG+ CLMQ+STRE+D+L+DT+ LR+DL ILNEVFT+P I KV HGAFMDIIW
Sbjct: 258 EHHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIW 317

Query: 302 LQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALK 361
           LQRDLGLY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + 
Sbjct: 318 LQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMT 377

Query: 362 AYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPI 421
           AYARADTHFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP   +S V+SP 
Sbjct: 378 AYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPT 437

Query: 422 EREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTT 481
           E+E+PWR LM+QYNI   +  LV+ LYEWRD++ARRDDESPR+++PNQLL +L    P  
Sbjct: 438 EKENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPID 497

Query: 482 PALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXN---EFGQLLNSANTVQNSSPTKMSS 538
              +++ S  VT+H+RQNA               +   E  ++++S    +++S   ++ 
Sbjct: 498 VIGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSS--KFKSASLEAITV 555

Query: 539 EDIEKNSRMFEKFLED-FSYEKAADCGISLGSSLFQKKFVPCEEY-VSYQESRASLVDHN 596
             I      F  F  +  + +++ D   S  SS+   K +P EE  + Y++S   L    
Sbjct: 556 SQIRDIMDRFSVFSSNSVTEDRSMD---STASSILFGKILPYEEGDIVYEDS--GLPHKV 610

Query: 597 SLENRRHQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENK----ARKE 652
            +E+ R +  +   A   +   +  +         +K    E +E  + E       + E
Sbjct: 611 KVEDMRDRAQRFNSALVGLEDIKFEV---------EKPVNVEKSEMVKIETTPEPPTKIE 661

Query: 653 EMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAP--SNNVRRPKKRFDPY 710
           + DEV+VLK+++    K+Q A      + E +D      +L +    NN ++ K+RFDP 
Sbjct: 662 DPDEVVVLKKKRI--HKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRRFDPS 719

Query: 711 ATLAAGPPS-VKKRKKTKGLQKSFR 734
              + GP +  KKR  T+G   SF+
Sbjct: 720 FNDSEGPRAPKKKRPTTRGKNVSFK 744

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/747 (44%), Positives = 451/747 (60%), Gaps = 47/747 (6%)

Query: 12  VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDENNDIIE 71
           +L++V+  IRA+S++  QDV FYKNLD      + + S +L  + N+I+LS+DE+++  E
Sbjct: 49  LLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEIILSIDEHHESFE 108

Query: 72  QGSEGLESAWSNVGEVMDLLFEKSEHAL----AAGEKRDNGELSKTVQYLDDSPSLHDGA 127
              E +   W++ G +MD L E S+H+L     A   + NG     +QYL D    +   
Sbjct: 109 LKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNG---ADLQYLGDFSEKNLSP 165

Query: 128 PKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQPYEY 187
            K++ KPQL FK PIDNSESHPF        +AL+ L +SLRL  E ++ P+HYP PYEY
Sbjct: 166 AKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEEDDNTPSHYPHPYEY 225

Query: 188 EIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHHDYR 247
           EIDHQEY  ++LQI + +PS  W+++E  W+D                 IA+DLEHHDYR
Sbjct: 226 EIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNVQEIAVDLEHHDYR 285

Query: 248 TYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQRDLG 307
           +YYGI CLMQISTREKD+L+DT+ LR+ L ILNEVFTDP I KV HGAFMDIIWLQRDLG
Sbjct: 286 SYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHGAFMDIIWLQRDLG 345

Query: 308 LYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYARAD 367
           LY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR+RPL K + AYARAD
Sbjct: 346 LYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMIAYARAD 405

Query: 368 THFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIEREDPW 427
           THFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++ +RP+I +S V+SPIE+E PW
Sbjct: 406 THFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPSSEVYSPIEKEAPW 465

Query: 428 RTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPALIMA 487
           R LM+QYNI   K  LV+ LY+WRD++ARRDDESPR+V+PNQLL +L    P     +++
Sbjct: 466 RVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAALVAYTPIDVIGVIS 525

Query: 488 TSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSE--DIEKNS 545
            +  +TEH+RQNA               + + +  +S  T   S   ++S E   I +  
Sbjct: 526 LTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKE--DSPVTFSESMTNEVSLEAITIPQIR 583

Query: 546 RMFEKFLEDFSYEKAADCGISLGS--SLFQKKFVPCEEY-VSYQESRASLVDHNSLENRR 602
            + E+F    S    ++C    G+  S+   + +P EE  ++Y+        +N L NR 
Sbjct: 584 DIMERF-SVLSNSNVSNCRAKNGATPSILLGRILPLEENDIAYK--------NNGLPNR- 633

Query: 603 HQVSKKYEAERDIARPQVHIRAASSHAVCDKEAGAED------------NESAEEENKAR 650
                K+E  R  AR Q    A S+   C  E                 N     ++ A 
Sbjct: 634 ----VKFEDIR--ARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVPKHSAT 687

Query: 651 KEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPSNNVRR--PKKRFD 708
            E  D+++VLK++     +   A D  T   + +D      +L + S+  RR   K+R D
Sbjct: 688 IENPDDIVVLKKKNIHRTQSMNAKD--TMGEKAIDYSKIPNVLSSKSDQNRRQQKKRRSD 745

Query: 709 PYATLAAGPPSV-KKRKKTKGLQKSFR 734
           P    + GP +  KKR  T+G   SF+
Sbjct: 746 PLFNDSDGPRAAKKKRPATRGRNVSFK 772

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/717 (45%), Positives = 443/717 (61%), Gaps = 62/717 (8%)

Query: 7   SEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDEN 66
           +E+  +L +V+ TIRASSA+ AQDV F+++L   I  S++  S R++ LIN +L S+D+N
Sbjct: 4   AEEDQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQN 63

Query: 67  NDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-----AAGEKRDNGELSKTVQYLDDSP 121
           ++ + +G E L   W +   +MD LFE S+ +      A G ++D  +L    ++LD+S 
Sbjct: 64  SEPLVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKL----KFLDNSS 119

Query: 122 SLHDGAP-KKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAH 180
           S +D  P K+I KPQL FK P++N+E  PF         ALR L   +      + VP H
Sbjct: 120 S-NDSIPSKRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDI--VPGNDAVPEH 176

Query: 181 YPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAID 240
           Y QPYEYEI+HQEY ESV+  SEP+PS PW+ TEA WVDN +              IA+D
Sbjct: 177 YAQPYEYEIEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVD 236

Query: 241 LEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDII 300
           LEHHDYR+YYGI CLMQISTRE+D+LIDTIALRDDL ILNEVF +PKI KV HGAFMDII
Sbjct: 237 LEHHDYRSYYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDII 296

Query: 301 WLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKAL 360
           WLQRDLGLY+VSLFDT+HASR +G P+HSLAYLLE++A+FKTSKKYQL+DWR+RPL KA+
Sbjct: 297 WLQRDLGLYVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAM 356

Query: 361 KAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSP 420
            AYARADTHFLLNIYD +RN+LIEQNKL+ VL +SRNVAKRRFE++ FRP   +  V+ P
Sbjct: 357 NAYARADTHFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCP 416

Query: 421 IEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPT 480
           I++ DPW+ LMFQY+I  ++  LV++LY+WRD +ARRDDESPRYV+PNQLLV LA  APT
Sbjct: 417 IDKPDPWKVLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPT 476

Query: 481 TPALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSANTVQNSSPTKMSSED 540
            P  +++ ++ VT+H+R N+                     L  A+ ++N+    ++S D
Sbjct: 477 EPINVISVNSIVTDHVRSNS---------------------LVLAHLIKNT----LASSD 511

Query: 541 IEKNSRMFE---------KFLEDFSYEKAADC--GISLGSSLFQKKFVPCEEYVSYQESR 589
            E +   FE           L     +K A C  G+S   ++ Q ++        + +  
Sbjct: 512 KESDKGTFEADNNSTDAASLLTVPQIQKLAACFAGVSRAFTILQNEYKDGRSSSIFTDIL 571

Query: 590 ASLVDH-NSLENRRHQVSKKYEAERDIARPQV--HIRAASSHAVCDKEAGAEDN------ 640
            S  D  N + N    ++KK   +R     Q       A+S+ +   E   E N      
Sbjct: 572 TSEDDAVNYVGNNMDHITKKELGKRAAKALQSMEQFDEATSYYMPIPEIAKESNTMEEIR 631

Query: 641 ----ESAEEENKARKEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKIL 693
               E  +E     KE+MDE+I LK+ K    +  + +  +   I  +D    +K+L
Sbjct: 632 PPAPEEVKESPSPPKEDMDEIITLKKIKKQKSQSPKELGISEREIPAVDYTKTKKVL 688

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/774 (43%), Positives = 476/774 (61%), Gaps = 43/774 (5%)

Query: 2   AQAHGSEDGSVLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILL 61
           A    S    +L QV+ T+RAS A+ AQDV FY+++D + A ++   +++L  +IN +LL
Sbjct: 18  ANEKQSPKDQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLL 77

Query: 62  SVDENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHAL-AAGEKRDNGELSKTVQYLDDS 120
           +VDEN++ ++   E LE  W +   +MD L EKS+ ++      ++    +  +QYLD+ 
Sbjct: 78  AVDENSETLDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEY 137

Query: 121 PSLHDGAPKK--ILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVP 178
               D + K+  I KPQL F  P+DN+E+HPF        +AL+SLDES++L    E+VP
Sbjct: 138 SGRDDTSSKRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVP 197

Query: 179 AHYPQPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIA 238
            HY QPYEYEID+Q YN+ +LQ+S+P+PS PW ET A WVD  +               A
Sbjct: 198 EHYAQPYEYEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFA 257

Query: 239 IDLEHHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMD 298
           +DLEHHDYRTYYGI CLMQISTR +D+++DT+ LR  L  LNE FT+P+ITKVLHGAFMD
Sbjct: 258 VDLEHHDYRTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMD 317

Query: 299 IIWLQRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPK 358
           IIWLQRDLGLYIVSLFDT+HASR LG PK+SLAYLLE++++FKTSKKYQ++DWR+RPL K
Sbjct: 318 IIWLQRDLGLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSK 377

Query: 359 ALKAYARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVF 418
           A+ +YAR+DTHFLLNI+D MRN L++  KL+ VL +SRNVAKRRFE+  +RP I +S V+
Sbjct: 378 AMNSYARSDTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVY 437

Query: 419 SPIEREDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNA 478
           SPIE+ DPW+TLM+QYNIP +K LL++ LY+WRD +ARRDDESPRY++PNQLLVSL   A
Sbjct: 438 SPIEKIDPWKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYA 497

Query: 479 PTTPALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNE-------FGQLLNSANTVQNS 531
           P  PA +++ S  VT+H+R N+               +          Q  N   T   +
Sbjct: 498 PVEPAGVVSVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTT 557

Query: 532 SPTKMSSE-DIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKK--FVPCEEYVSYQ-E 587
           +   +S +  I + + +  +FL  +S     + G++  +   +KK  F+ C +++S+  E
Sbjct: 558 TNVDLSEQLSIHQLNTLKSQFLSLYSKVNHIE-GVTNNARNAEKKNSFLLCTDHMSFNDE 616

Query: 588 SRASLVDHNSLENRRHQVSK----KYEAERDIARPQVHIRAASSHAVCDKEAGAEDNESA 643
              + + ++   +++ +++     K E   D A  Q+  +   S  + + E    ++E  
Sbjct: 617 DGKNFIKYSVSPDKKDKITTEELLKREEMFDQAMEQLQ-QVEYSIPIPENEIVVVESEQQ 675

Query: 644 EEENKA------------RKEEMDEVIVLKQ-RKTLADKEQR--AVDKATPSIEPLDLQS 688
           E    A            +KE++DE+IVLK+  +    K +R  + D     IE +D   
Sbjct: 676 EPSIPAANAEITTAVASRKKEDLDEIIVLKKTNRNKGKKRERKHSDDDDEGEIEVIDYSK 735

Query: 689 ARKILE-------APSNNVRRPKKRFDPYATLAAGPPSVKKRKK-TKGLQKSFR 734
             K+L+          NN    +KRFDPY     GP + KKRK  T+G   SF+
Sbjct: 736 MEKVLDNSNTKRNQNKNNNGNKRKRFDPYNVNNEGPRAPKKRKAMTRGKNVSFK 789

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/752 (41%), Positives = 454/752 (60%), Gaps = 32/752 (4%)

Query: 7   SEDGS--VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64
           SED    +L  ++  +RAS+A+ AQDV FYK+LD  ++ S+N  +   L + N +LLS+D
Sbjct: 27  SEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSID 86

Query: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDN--GELSKTVQYLDDSPS 122
           EN   +E+G + +   W+    +MD L EKS+H + A  K +N  G+ ++T  +LD++  
Sbjct: 87  ENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETT-FLDNNSR 145

Query: 123 LHDGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYP 182
            +    K+I KPQLLF +P+DN++S PF        +AL+ L +SL L  E   VP HY 
Sbjct: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205

Query: 183 QPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLE 242
           QPYEYEID+QEYNE V++I +P P  PW+ T A W+D  +              IA+DLE
Sbjct: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265

Query: 243 HHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWL 302
           HHD R+YYGITCLMQISTRE+D+++DTI+LRDDL +LNE+FT+P ITKV HGA MDIIWL
Sbjct: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325

Query: 303 QRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKA 362
           QRDLGLYIVSLFDT+HAS+ LG  +HSLAYLLE YA FKTSKKYQL+DWR RPL   + A
Sbjct: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385

Query: 363 YARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIE 422
           YAR+DTHFLLNI+D +RN+LI+QNKL+ VLH+SRNVAKRRFE+  FRP +   ++++ IE
Sbjct: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445

Query: 423 REDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTP 482
           +E PW++L+ QYNI   K +LV++L+EWRDM+ARRDDESPRY++P Q+L+SL    PT  
Sbjct: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505

Query: 483 ALIMATSTFVTEHIRQNAXXXXXXXXXXXXXXXN-----EFGQLLNSANTVQNSSPTKMS 537
           + +++ S  VTEH+R N+               +     +     N + T  N + + +S
Sbjct: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALESTKSIPNSSDSSSTFNMSRTDTNVA-SLIS 564

Query: 538 SEDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNS 597
             +I      F    + ++  K    GI + S LF        +   Y + + +      
Sbjct: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624

Query: 598 LENRRHQVSKKYEA----ERDIARPQVH----IRAASSHAVCDKEAGAEDNESAEEENKA 649
           +  R  ++S+  +        I +P V     I   + + +   E  +   ++ +E N  
Sbjct: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEIN-- 682

Query: 650 RKEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPS---NNVRRPKKR 706
             E+ +E+IVLK+      K ++  DK +  +  +D   A+KI +      N   + +K 
Sbjct: 683 --EDNEEIIVLKKVNRKYQKGKKDADKDSTVV--VDYSKAKKIFQKKDETINGNSKKRKS 738

Query: 707 FDPY---ATLAAGPPSVKKRK-KTKGLQKSFR 734
           FDPY         P ++KKR+  T+G   S++
Sbjct: 739 FDPYNNDGDTDKVPRALKKRQTNTRGKNISYK 770

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/765 (43%), Positives = 449/765 (58%), Gaps = 71/765 (9%)

Query: 7   SEDGSVL-NQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVDE 65
           SE+  VL ++++  +RA+S++ +QDV FYKNL+   +  + + S +L  ++N+I+LS+DE
Sbjct: 3   SENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSIDE 62

Query: 66  NNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDNGELSKT-VQYLDDSPSLH 124
           +++  E   + +   W + G +MD L E S+H+L       N ++S   +QYL D     
Sbjct: 63  HHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSGKD 122

Query: 125 DGAPKKILKPQLLFKRPIDNSESHPFXXXXXXXXHALRSLDESLRLTAEQEDVPAHYPQP 184
             + K++ KPQL FK+ IDNSESHPF        +AL+ L ESLRL   +E+ P+HY  P
Sbjct: 123 SLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYLHP 182

Query: 185 YEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDXXXXXXXXXXXXXXIAIDLEHH 244
           Y YEIDHQEY+  VLQI + +PS  WD++E  W+D                 IA+DLEHH
Sbjct: 183 YAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLEHH 242

Query: 245 DYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWLQR 304
           DYR+YYGI CLMQ+STRE+D+L+DTI LRD L ILNEVFTDP I KV HGAFMDIIWLQR
Sbjct: 243 DYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWLQR 302

Query: 305 DLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKAYA 364
           DLGLY+V LFDTYHAS+ +G P+HSLAYLLE +A+FKTSKKYQL+DWR RPL K + AYA
Sbjct: 303 DLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTAYA 362

Query: 365 RADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIERE 424
           RADTHFLLNIYD +RN LIE NKL+ VL++SRNVAKRRFE++  RP+  +S V+SPIE+E
Sbjct: 363 RADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIEKE 422

Query: 425 DPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTPAL 484
           +PWR LM+QYNI   K  LV+ LY WRD +ARRDDESPR+V+PNQLL +L   AP     
Sbjct: 423 NPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDVIG 482

Query: 485 IMATSTFVTEHIRQNAXXXXXXXXXXXXXXXNEFGQLLNSAN-----TVQNSSPTKMSSE 539
           +++ +  VTEH+RQNA               N  G + ++       T   S P  +S E
Sbjct: 483 VVSLTNGVTEHVRQNA-------KVLANLIENALGNIKDTNKKTTSITSSESKPDGISLE 535

Query: 540 DIEKNSRMFEKFLEDFSY----------EKAAD---------------CGISLGSSLFQK 574
            I          +E FS            K  D               CGIS G     K
Sbjct: 536 VI--TISQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYG-----K 588

Query: 575 KFVPCEEYVSYQESRASLVDH--NSLENRRHQVSKKYEAERDIARPQVHIRAASSHAVCD 632
           K  P +  V   ++RA   +     LEN        +E E+ +  P          A  +
Sbjct: 589 KGTPNKVKVEDIKARAQKFNSALAGLENIM------FELEKPVTVP----------ASVE 632

Query: 633 KEAGAEDNESAEEENKARKEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKI 692
           K    E   + E  +KA  E  D++IVLK++K    +  +  D      E +D      +
Sbjct: 633 KGEAVEIESAPELPSKA--ESFDDIIVLKKKKMHKKQPAKGKDMTVK--EAVDYSKMPSV 688

Query: 693 LEA-PSNNVRRP-KKRFDPYATLAAGPPSVKKRKKT-KGLQKSFR 734
           L + P  N ++  K+RFDP +  + GP + KK++   +G   SF+
Sbjct: 689 LSSKPGQNRKQQRKRRFDPSSNDSEGPRAAKKKRPAPRGKNMSFK 733

>TDEL0C00180 Chr3 complement(21059..22825) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 164 LDESLRLTAEQE--DVPAHYPQPY----EYEIDHQEYNESVLQISEPVPSLP 209
           +D S+ + A  +   VP H P+      EYEI    +NES  Q S P+PS+P
Sbjct: 184 VDNSVTINASLDHCTVPGHKPENLLGKDEYEIGMGIHNESGTQKSSPLPSIP 235

>TPHA0N00830 Chr14 (185748..187424) [1677 bp, 558 aa] {ON} Anc_5.227
           YLR004C
          Length = 558

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 588 SRASLVDHNSLENRRHQVSKKY-EAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEE 646
           S  SL  HN  E    QVS K+ + E D+A     ++      +    AG+++ ++A+ E
Sbjct: 32  SSDSLAKHN-FEVSTTQVSSKFSDTEVDVA-----LKFLQDAGIKGNSAGSDEKDAADLE 85

Query: 647 NKARKEEMDEVIVLKQRKTLADKEQRAVD 675
           +++  +  +  +VLK  K L+ K  R +D
Sbjct: 86  DQSEIDLTEGHVVLKGSKDLSKKTMRKLD 114

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 7/74 (9%)

Query: 387 KLSQVLHDSRNVAKRRFEFTTFRPKIVTS------HVFSPIEREDPWRTLMFQYNIPQSK 440
           +LS  +    N    ++EF TF   ++         +FS +  E+   + + QY +P+SK
Sbjct: 513 QLSNFMKRVFNEPTEKYEFKTFDEVMLAPLALFAPRIFSYLRNEESKNSTL-QYQLPESK 571

Query: 441 SLLVRRLYEWRDMV 454
            L    L +WR M 
Sbjct: 572 DLFTHELNDWRSMT 585

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 24/126 (19%)

Query: 549 EKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSLENRRHQVSKK 608
           EK LE   Y K  D  +   SS   + FV C + ++  ++   L DH +++    +++ K
Sbjct: 202 EKLLE---YCKIHDVQVVAYSSFGPQSFVDCGQEMA--KNTPPLFDHPTIK----KIADK 252

Query: 609 YEAERDIARPQVHIRAASSHAVCDKEAGAEDNESAEEENKARKEEMDEVIVLKQRKTLAD 668
           YEA   +   QV +R A+   V            A     ++KE + E + + Q+ TLA+
Sbjct: 253 YEA---VTTSQVLLRWATQRGV------------AIIPKSSKKERLLENLTIDQKVTLAE 297

Query: 669 KEQRAV 674
           ++ R +
Sbjct: 298 EDLREI 303

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,714,821
Number of extensions: 3313970
Number of successful extensions: 16775
Number of sequences better than 10.0: 129
Number of HSP's gapped: 17277
Number of HSP's successfully gapped: 133
Length of query: 735
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 618
Effective length of database: 40,065,477
Effective search space: 24760464786
Effective search space used: 24760464786
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)