Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C11044g6.27ON31531516690.0
Kwal_56.224546.27ON31531013170.0
SAKL0E01474g6.27ON31130310511e-144
CAGL0E02519g6.27ON31530610431e-142
NCAS0H015106.27ON31329010281e-140
TDEL0G044206.27ON32229110221e-139
KNAG0M012406.27ON31430310151e-138
NDAI0F017406.27ON3132899981e-136
ZYRO0C07612g6.27ON3192739961e-135
KAFR0G026506.27ON3213059961e-135
Kpol_1032.96.27ON3182909911e-134
KLLA0D01331g6.27ON3082979731e-132
TBLA0E030606.27ON3192969541e-129
Ecym_30316.27ON3282929551e-129
Smik_15.1686.27ON3273099441e-127
YOL002C (IZH2)6.27ON3173059401e-127
ACL002C6.27ON3292709241e-124
Skud_15.1606.27ON3273099211e-124
TPHA0M002906.27ON3273249201e-124
Suva_15.1736.27ON3273099181e-123
SAKL0C09218g3.90ON3142837741e-102
Kwal_56.227043.90ON3202857358e-96
KLTH0C09504g3.90ON3192947304e-95
AFR337W3.90ON3173037262e-94
TDEL0D053403.90ON3162977001e-90
ZYRO0B06556g3.90ON3182767001e-90
KLLA0C12441g3.90ON3152966992e-90
CAGL0G04631g3.90ON3162796922e-89
TPHA0A006403.90ON3273116862e-88
NDAI0A071603.90ON3302966863e-88
Ecym_35883.90ON3052756834e-88
Skud_4.7663.90ON3162836792e-87
Smik_4.7693.90ON3162836758e-87
YDR492W (IZH1)3.90ON3162756681e-85
NCAS0I025703.90ON3143136653e-85
Suva_2.6683.90ON3152826611e-84
TBLA0B022903.90ON3263156533e-83
Kpol_1053.263.90ON3242736463e-82
KAFR0A081303.90ON3192886297e-80
KNAG0K021603.90ON3232855681e-70
TBLA0B082553.90ON2962873981e-45
NDAI0G043003.90ON3182833294e-35
NCAS0C049203.90ON3262803207e-34
CAGL0I07491g3.90ON3012912452e-23
Suva_15.643.90ON3123162252e-20
Skud_15.533.90ON3122882032e-17
YOL101C (IZH4)3.90ON3123101962e-16
Smik_15.563.90ON3122951944e-16
KLLA0F15510g5.197ON6222761823e-14
KLTH0B03498g5.197ON5462521743e-13
KAFR0J006705.197ON5092401726e-13
KNAG0B051005.197ON5383241673e-12
Kpol_2002.945.197ON5772381655e-12
TPHA0E031205.197ON5692481647e-12
TBLA0C060505.197ON4372331611e-11
Ecym_71095.197ON5682371566e-11
AAL153C5.197ON4193121541e-10
TDEL0E043205.197ON4502381531e-10
Kwal_33.151225.197ON5662871504e-10
NDAI0I023305.197ON5782381496e-10
NCAS0D026005.197ON5432401461e-09
YLR023C (IZH3)5.197ON5432391451e-09
Smik_12.865.197ON5422351433e-09
Skud_12.915.197ON5422411424e-09
ZYRO0B10538g5.197ON5312341381e-08
Suva_10.1045.197ON5412431371e-08
CAGL0D03322g5.197ON5452421292e-07
SAKL0G12980g5.197ON5632571238e-07
KNAG0K006703.90ON3212131077e-05
Smik_14.363.62ON52491880.019
Skud_14.423.62ON52491880.021
YNL295W3.62ON52491830.069
Suva_14.443.62ON52569800.17
NDAI0K013702.446ON68094770.41
KLTH0C03806g8.843ON52557685.4
Kpol_401.147.198ON131391669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C11044g
         (315 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   647   0.0  
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   511   0.0  
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   409   e-144
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   406   e-142
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   400   e-140
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   398   e-139
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   395   e-138
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      389   e-136
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   388   e-135
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   388   e-135
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   386   e-134
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   379   e-132
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   372   e-129
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   372   e-129
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   368   e-127
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   366   e-127
ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   360   e-124
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   359   e-124
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   358   e-124
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   358   e-123
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   302   e-102
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   287   8e-96
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   285   4e-95
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   284   2e-94
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   274   1e-90
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   274   1e-90
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   273   2e-90
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   271   2e-89
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   268   2e-88
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   268   3e-88
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   267   4e-88
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   266   2e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   264   8e-87
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   261   1e-85
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   260   3e-85
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   259   1e-84
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   256   3e-83
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   253   3e-82
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   246   7e-80
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   223   1e-70
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             157   1e-45
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    131   4e-35
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   127   7e-34
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    99   2e-23
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    91   2e-20
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    83   2e-17
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    80   2e-16
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    79   4e-16
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    75   3e-14
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    72   3e-13
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    71   6e-13
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    69   3e-12
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    68   5e-12
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    68   7e-12
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    67   1e-11
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    65   6e-11
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    64   1e-10
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    64   1e-10
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    62   4e-10
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     62   6e-10
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    61   1e-09
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    60   1e-09
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    60   3e-09
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    59   4e-09
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    58   1e-08
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    57   1e-08
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    54   2e-07
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    52   8e-07
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    46   7e-05
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    39   0.019
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    39   0.021
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    37   0.069
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    35   0.17 
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              34   0.41 
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...    31   5.4  
Kpol_401.14 s401 complement(36313..40254) [3942 bp, 1313 aa] {ON...    30   9.8  

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/315 (100%), Positives = 315/315 (100%)

Query: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG 60
           MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG
Sbjct: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG 60

Query: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI 120
           YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI
Sbjct: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI 120

Query: 121 DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL 180
           DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL
Sbjct: 121 DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL 180

Query: 181 YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE 240
           YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE
Sbjct: 181 YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE 240

Query: 241 TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR 300
           TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR
Sbjct: 241 TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR 300

Query: 301 ALLGAYKLFHHVKVV 315
           ALLGAYKLFHHVKVV
Sbjct: 301 ALLGAYKLFHHVKVV 315

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/310 (77%), Positives = 273/310 (88%)

Query: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGG 60
           M + GLT+RK V +E    M EE ++LL  S +++RT+RRLY WDEIPEWQ+DNEHI+ G
Sbjct: 1   MVEAGLTKRKAVGIEPEGVMTEETTTLLNGSRIEERTRRRLYKWDEIPEWQKDNEHILNG 60

Query: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMI 120
           YILETKS   CLKSLLYLHNESVNIYTHL+PGWCFLL+ +FNQ+ IE++ETTR+IDY+MI
Sbjct: 61  YILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMIDYIMI 120

Query: 121 DLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDL 180
           DLFFLGGFTCLMMSS FHCFKCHSLPVA+LGNKLDYLGIVALVVTS+VSILFYGFHD +L
Sbjct: 121 DLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGFHDNNL 180

Query: 181 YFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKE 240
           YF++FSGLT+ FGLAC  VSLS+KFRSR+WRPYRA+LFVAFGLSAL PVIAG  HYG K 
Sbjct: 181 YFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICHYGFKV 240

Query: 241 TWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLR 300
           TWTRIQL+WV L GVFYILGA+LYG+RFPER+APG FDIWG SHQLFH+LVV+AA CHLR
Sbjct: 241 TWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAASCHLR 300

Query: 301 ALLGAYKLFH 310
           ALLGAYK  H
Sbjct: 301 ALLGAYKWVH 310

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  409 bits (1051), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 185/303 (61%), Positives = 242/303 (79%), Gaps = 3/303 (0%)

Query: 8   QRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKS 67
            R+ ++++  + + EE  S      + ++  RRLY+W+EIP+WQ+DNEHI  GY+ ET S
Sbjct: 6   NRRRLQIKRANIVKEETMS---TGTINKKRVRRLYSWEEIPDWQKDNEHIRHGYVRETNS 62

Query: 68  TWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGG 127
              C  SL Y+HNESVNIYTHLLPG CF  V +F++V I+ F+TT  +DY+M+DLFFLG 
Sbjct: 63  FLGCFDSLFYMHNESVNIYTHLLPGLCFFFVVLFDKVAIKVFDTTTFLDYIMVDLFFLGA 122

Query: 128 FTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSG 187
           FTCL++SS FHC K HSL +AILGNKLDYLGIVAL+V+S++SI++YGF D   +F+ FS 
Sbjct: 123 FTCLILSSTFHCLKTHSLRIAILGNKLDYLGIVALIVSSMISIMYYGFFDSGKFFYGFST 182

Query: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQL 247
           LT+ FG+ACA  SLS+ FRSREWRPYRA+LFVAFGLSA+LP+ +G   YG KETW ++Q+
Sbjct: 183 LTLVFGIACAIASLSDTFRSREWRPYRAALFVAFGLSAVLPIFSGVAVYGFKETWVKVQV 242

Query: 248 EWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYK 307
           +WVLLGGVFYI+GA+LY +R PER++PG FDIWGHSHQ+FHILVV+AALCHL+A+L +Y+
Sbjct: 243 KWVLLGGVFYIIGALLYALRLPERISPGKFDIWGHSHQIFHILVVIAALCHLKAVLNSYE 302

Query: 308 LFH 310
           L H
Sbjct: 303 LVH 305

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  406 bits (1043), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/306 (62%), Positives = 235/306 (76%), Gaps = 9/306 (2%)

Query: 15  ELHHRMV------EENSSLLKDSNLKQRTK---RRLYTWDEIPEWQRDNEHIVGGYILET 65
           ++H R V      EE   +  D  +K R K   R+LYTW+EIPEWQ+DNEHI  GY+ ET
Sbjct: 3   DVHQRKVATMVTTEEQPLIGTDGQIKLRKKTVVRKLYTWEEIPEWQKDNEHIHTGYVRET 62

Query: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125
            S  EC++SL YLHNE+VNIY+HL+P   F     FN+ V+  + TT LIDY++ID+FFL
Sbjct: 63  SSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIFFL 122

Query: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185
           G F+CL++SS FHC K HSL VA+ GNKLDYLGIV L+V S+VSIL+YGFH    +F +F
Sbjct: 123 GAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFGIF 182

Query: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245
           S +TM FG ACA VSL + FRSREWRPYRA+LFV FGLSA+LP++AG   YG  ETWTRI
Sbjct: 183 SLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWTRI 242

Query: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305
           QL+WV+L GVFYI GA LYGIRFPE+M+PG FD+WGHSHQ+FHILVVVAALCHL+ALLG+
Sbjct: 243 QLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALLGS 302

Query: 306 YKLFHH 311
           Y L H+
Sbjct: 303 YSLVHY 308

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 184/290 (63%), Positives = 231/290 (79%), Gaps = 1/290 (0%)

Query: 21  VEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHN 80
           +++++  +K +  K  T R+LYTWDEIPEWQ+DNEHI+ GY+ ET S   C  SL Y+HN
Sbjct: 22  IDDDNVSIKHTK-KTTTIRKLYTWDEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHN 80

Query: 81  ESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCF 140
           E+ N+Y+HL+PG  F L  +F++  I  FETT   DY++I+LFFLG FTCL++SS FHCF
Sbjct: 81  ETGNVYSHLVPGVVFFLTMLFDKYAIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCF 140

Query: 141 KCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVS 200
           K HSL +A  GNKLDYLGIV L+VTS++SILFYGF+D   +F+ FS LT++FG ACA VS
Sbjct: 141 KSHSLKIATFGNKLDYLGIVVLIVTSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVS 200

Query: 201 LSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILG 260
           L +KFRSREWRPYRA LFVAFGLSA+LP++ G ++YG  ETWTRIQL+WV+L GVFYI G
Sbjct: 201 LKDKFRSREWRPYRAGLFVAFGLSAVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFG 260

Query: 261 AVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           A LYGIRFPE+   G FDIWGHSHQ+FH+LVVVAA CHL+ALLG+Y+L H
Sbjct: 261 AFLYGIRFPEKYVNGTFDIWGHSHQIFHLLVVVAAFCHLKALLGSYELVH 310

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 187/291 (64%), Positives = 225/291 (77%), Gaps = 2/291 (0%)

Query: 22  EENSSLLKDSNLKQ--RTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLH 79
           EE S  +K     +  + KR+LYTWDEIP WQRDNEHI+ GY+ ET+S ++C  SL YLH
Sbjct: 24  EETSGPVKGQKTDKMSKKKRKLYTWDEIPHWQRDNEHILSGYVGETRSMFQCFLSLFYLH 83

Query: 80  NESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHC 139
           NESVNIYTHLLPG  FL V  F++  + +FETT LIDYVMIDLF L  FTCL +SS+FHC
Sbjct: 84  NESVNIYTHLLPGIAFLFVLCFDKFAVTQFETTTLIDYVMIDLFSLVSFTCLTLSSIFHC 143

Query: 140 FKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATV 199
            K HS  VA  GNKLDYLGIV LVVTS+VSI++YGF +    F+LFS +T  FG ACA V
Sbjct: 144 LKNHSRSVATFGNKLDYLGIVVLVVTSMVSIMYYGFFETPALFYLFSFITCTFGAACAVV 203

Query: 200 SLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYIL 259
           SL   FR+REWRPYRA++FVAFGLSA+LP++ G  +YG  E + RIQ++WVLLGG+FYI 
Sbjct: 204 SLKEGFRTREWRPYRAAMFVAFGLSAVLPIVTGIFYYGFSEIYLRIQVKWVLLGGIFYIT 263

Query: 260 GAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           GAVLYG+RFPE+ APG +DIWGHSHQLFH+LVVVAALCHL  L+ +Y L H
Sbjct: 264 GAVLYGVRFPEKYAPGKYDIWGHSHQLFHVLVVVAALCHLYGLIKSYNLVH 314

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  395 bits (1015), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 237/303 (78%), Gaps = 3/303 (0%)

Query: 8   QRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKS 67
           QR+ V +     + E++   +K +   ++  +R+YTW+EIPEWQ+DNEHI+ GY+ ET S
Sbjct: 6   QRQTVTIT-EPVVYEDDGGEMKTAT--KKITKRIYTWNEIPEWQKDNEHIIDGYVRETNS 62

Query: 68  TWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGG 127
             +C+ SL YLHNESVN+Y+HL+P  CF  V   N+  ++ FETT L+DY+ IDLFFLG 
Sbjct: 63  FLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLNKYCVKSFETTSLVDYLFIDLFFLGA 122

Query: 128 FTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSG 187
           FTCL++SS FHCFK HSL VA  GNKLDYLGIV L+VTS++SIL+YGF+D  + F+ FS 
Sbjct: 123 FTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVLIVTSMISILYYGFYDSSVMFYFFSF 182

Query: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQL 247
           +T++FG AC  VSL + FRSREWRPYRA LFVAFGLSA+LP+++G   YG++E + RIQ+
Sbjct: 183 VTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFGLSAILPILSGMFAYGIEEAFHRIQI 242

Query: 248 EWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYK 307
           +W++L GVFYILGA LYGIRFPE+ +PG +DIWGHSHQ+FHILVVVAALCHL+ L+ +Y+
Sbjct: 243 KWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGHSHQVFHILVVVAALCHLKGLMVSYE 302

Query: 308 LFH 310
           L H
Sbjct: 303 LVH 305

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  389 bits (998), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 180/289 (62%), Positives = 225/289 (77%), Gaps = 2/289 (0%)

Query: 24  NSSLLKDS--NLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNE 81
           N++   DS   +K++   +LY WDEIPEWQ+DNEHI+ GY+ ET S   CL SL Y+HNE
Sbjct: 22  NNTDNGDSIEQVKRKVVYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNE 81

Query: 82  SVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK 141
           S N+Y+HLLPG  F    V N+  I  + TT ++DY+MIDLFF G F CL++SS+FHCFK
Sbjct: 82  SGNVYSHLLPGVFFFFTMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFK 141

Query: 142 CHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSL 201
            HSL VA LGNKLDYLGIV L+VTS++SI+++GF D  L+F+ FS LT  FG ACATVSL
Sbjct: 142 SHSLKVATLGNKLDYLGIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSL 201

Query: 202 SNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGA 261
            + FRSREWRPYRA LFVAFGLSA+LP++AG  +YG++ET+ RIQL+W++L G FYI GA
Sbjct: 202 KDHFRSREWRPYRAGLFVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGA 261

Query: 262 VLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            LYG+RFPE+  PG FDIWGHSHQ+FHILVVVAA CHLR LL +Y++ H
Sbjct: 262 FLYGVRFPEKYVPGSFDIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVH 310

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 216/273 (79%)

Query: 38  KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLL 97
           K+ LYTW+EIP+WQ+DNEHIVGGY+ ET S  ECL+SLLYLHNES+NIYTH LPG CFL 
Sbjct: 39  KKLLYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLA 98

Query: 98  VAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYL 157
             +F++  I+ F+TT  IDY+ ID FF G F+CL++SS FHCFK HS  V++ GNKLDYL
Sbjct: 99  TCIFDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYL 158

Query: 158 GIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASL 217
           GIV L+V S++SIL+Y FHD +  F+ F+ +   FG++C   S  + FRSREWRPYRA L
Sbjct: 159 GIVILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGL 218

Query: 218 FVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCF 277
           FVAFGLSALLP++ G + YG  ETWTRIQ++WV+L G+FYI GA LY IRFPER+APG F
Sbjct: 219 FVAFGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAF 278

Query: 278 DIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           D  GHSHQ+FH+LVV+AALCHL AL+ +Y+L H
Sbjct: 279 DFVGHSHQIFHVLVVIAALCHLVALMNSYELVH 311

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 233/305 (76%), Gaps = 5/305 (1%)

Query: 7   TQRKPVEVELHHRMVEENSSLLKDSNLKQRTKR-RLYTWDEIPEWQRDNEHIVGGYILET 65
           + RK         +VE+N    K   ++   K  +LY W+EIP+WQ+DNEHI+ GY+ ET
Sbjct: 9   STRKVTIDTAFQDVVEQN----KGETIRSLEKIIQLYNWNEIPDWQKDNEHIISGYVKET 64

Query: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125
            S + C++SL YLHNESVN+Y+HL+P  CFL+ ++ N+ ++ KF TT ++DY+ IDLFFL
Sbjct: 65  NSFFSCIESLFYLHNESVNVYSHLIPAVCFLMTSLLNKTIVPKFRTTTVLDYLYIDLFFL 124

Query: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185
           G FTCL++SS FHCFK HSL +A  GNKLDYLGIV L+ TS++S+L+YGF+D    F++F
Sbjct: 125 GAFTCLILSSTFHCFKSHSLRIATFGNKLDYLGIVVLISTSMISLLYYGFYDTPSLFYVF 184

Query: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245
           + +T++FGLACATVSL +KFRSRE R YRA+LFV FGLSA+LPVI G  HYG   TW RI
Sbjct: 185 AFITLSFGLACATVSLKDKFRSRECRAYRATLFVCFGLSAVLPVICGLYHYGFYNTWHRI 244

Query: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305
           QL+WVLL GVFYI GA LYGIRFPE+  PG +DIWGHSHQLFHILVV+AALCH +AL+ +
Sbjct: 245 QLKWVLLEGVFYIFGAFLYGIRFPEKYTPGKYDIWGHSHQLFHILVVIAALCHFKALMCS 304

Query: 306 YKLFH 310
           Y+  H
Sbjct: 305 YEHVH 309

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  386 bits (991), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 176/290 (60%), Positives = 229/290 (78%), Gaps = 2/290 (0%)

Query: 21  VEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHN 80
           VE++ +    S +K+  +  L TW+ +P+WQ+DNEHI+ GY+ ET S   CL SLL++HN
Sbjct: 23  VEKDGAKSSYSYIKRGVQ--LVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHN 80

Query: 81  ESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCF 140
           ESVNI++HL+P +CF+   +F++ V+E++ TT L DY+M+DLF  G FTCLMMSS FHC 
Sbjct: 81  ESVNIFSHLVPAFCFMTTIIFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCL 140

Query: 141 KCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVS 200
           K HS  V+  GNKLDYLGIV L+V+S+ SIL+YGF+D    ++ FS +T  FGL+CA VS
Sbjct: 141 KAHSPYVSSFGNKLDYLGIVVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVS 200

Query: 201 LSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILG 260
           L  +FR+REWRPYRA++FVAFGLSALLP+ AG L+YG++ET  R+QL+WV+L GVFYI G
Sbjct: 201 LGERFRAREWRPYRAAMFVAFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFG 260

Query: 261 AVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           A+LYG+RFPER+ PG FDIWGHSHQLFHILVVVAALCHLR LLG+Y + H
Sbjct: 261 ALLYGVRFPERLKPGMFDIWGHSHQLFHILVVVAALCHLRGLLGSYTIVH 310

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  379 bits (973), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/297 (60%), Positives = 226/297 (76%), Gaps = 5/297 (1%)

Query: 20  MVEENSSLLKDSNLKQRT----KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSL 75
           +V E ++L++++   ++T    +RR+Y+WDEIP+WQ+DNEHI+ GY+ ET+S  E   SL
Sbjct: 8   VVTEETALIEETPGTKKTVRVYERRVYSWDEIPDWQKDNEHILHGYVRETQSWKELFHSL 67

Query: 76  LYLHNESVNIYTHLLPGWCFLLVAVF-NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMS 134
            YLHNESVNIYTHL+P      + +F    VI ++ TT  IDY MI+LFF G  TCL MS
Sbjct: 68  FYLHNESVNIYTHLIPAVALFFIMLFATHHVINEYPTTSAIDYFMINLFFFGCATCLTMS 127

Query: 135 SVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGL 194
           S+FH  KCHSLP+A  GNKLDYLGIV L+ TS++SILFYGFHD  L F+ F+GLT  FGL
Sbjct: 128 SMFHTIKCHSLPIATFGNKLDYLGIVVLISTSMISILFYGFHDSSLLFYPFAGLTSLFGL 187

Query: 195 ACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGG 254
            C  +SL +KFRSREWRPYRA++FV FGLSA+ P++AG + YG  ETW R+QL WV+  G
Sbjct: 188 ICGYMSLKDKFRSREWRPYRATMFVLFGLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEG 247

Query: 255 VFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHH 311
           V YI GA LYG+RFPER+APG FDIWGHSHQLFH+LVVVAALCHL+AL+ +Y L H 
Sbjct: 248 VLYIFGAFLYGVRFPERLAPGKFDIWGHSHQLFHVLVVVAALCHLKALVVSYGLVHQ 304

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  372 bits (954), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 219/296 (73%), Gaps = 5/296 (1%)

Query: 21  VEENSSLLKDSNLKQ-----RTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSL 75
            EE   LL   N +Q      + +RLYTWDEIP WQ DNE+I  GY+ ET S  E   SL
Sbjct: 14  TEEGVELLYGDNQQQLNTSGSSGKRLYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSL 73

Query: 76  LYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSS 135
            Y+HNESVNIYTHL+P +CFL + +FN   ++   TT   DYV IDLFF+G FTCL +SS
Sbjct: 74  FYIHNESVNIYTHLIPAFCFLSMLLFNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSS 133

Query: 136 VFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLA 195
            FHCFK HSL +++ GNKLDYLGIV L+ TS++S+L++G+HD    F++FSG+T+ FG+A
Sbjct: 134 TFHCFKSHSLKISVFGNKLDYLGIVILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIA 193

Query: 196 CATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGV 255
           C   SL +KFR+REWRPYRA+LFV FGLS +LP+IAG + YG++E + R+QL+W++  GV
Sbjct: 194 CGIASLKDKFRTREWRPYRAALFVLFGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGV 253

Query: 256 FYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHH 311
            YI GA LYG RFPE+  PG  DIWG SHQ+FH+LVV+AALCHLR L+G+Y+L H 
Sbjct: 254 LYIFGAFLYGARFPEKFMPGKVDIWGQSHQIFHVLVVIAALCHLRGLIGSYELVHQ 309

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 170/292 (58%), Positives = 220/292 (75%), Gaps = 4/292 (1%)

Query: 23  ENSSLLKDSN----LKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL 78
           E S + +D N    +  +   +L++W EIPEWQRDNEHI+GGY+ ET S  E L SLLYL
Sbjct: 26  ETSVIFEDLNQATTIPLKPASKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYL 85

Query: 79  HNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFH 138
           HNESVNIYTHL+PG CF  V   N+ VI +F+TT   DY +ID FF+G F CL+MS  +H
Sbjct: 86  HNESVNIYTHLIPGVCFFCVLFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYH 145

Query: 139 CFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACAT 198
           C K HS PV+I+GN+LDY+GIV L+ TS+ S+L+YGF++    F+ FSG+T+  G  C  
Sbjct: 146 CLKSHSYPVSIVGNQLDYIGIVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTV 205

Query: 199 VSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYI 258
           V+L ++FRSR WRPYRAS+FVAFGLS++LP++A  L+YG +ETW  +QL W++L GV YI
Sbjct: 206 VTLDSRFRSRLWRPYRASIFVAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYI 265

Query: 259 LGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            GA +YGIRFPE MAPG FDIWGHSHQLFH+LVV+AALCH +A+  +Y+L H
Sbjct: 266 FGAFIYGIRFPESMAPGSFDIWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 176/309 (56%), Positives = 226/309 (73%)

Query: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61
           +   L +R     EL  R   + S+   +    ++  +RLY+WDEIPEWQRDN+ I+ GY
Sbjct: 10  QMSTLLERTKSVQELKKRAAGKTSANPAEVAEAKKVLKRLYSWDEIPEWQRDNDFILHGY 69

Query: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121
           + ET S  E  KSL YLHNESVNIY+HL+P   F  V + ++  I+ FETT   D+V+ID
Sbjct: 70  VRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFTVLLLDKSTIKVFETTTWKDHVVID 129

Query: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181
           LF+ G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+VSILFYG+++    
Sbjct: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILFYGYYEKFSL 189

Query: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241
           F LF+ +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E 
Sbjct: 190 FCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYSFSEI 249

Query: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301
           WT+IQL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+LCHLR 
Sbjct: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASLCHLRG 309

Query: 302 LLGAYKLFH 310
           LL +Y+L H
Sbjct: 310 LLNSYELVH 318

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  366 bits (940), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 224/305 (73%)

Query: 6   LTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILET 65
           L +R     EL  R   + S+   +    ++  RRLY+WDEIPEWQRDN+ I+ GY+ ET
Sbjct: 4   LLERTKSVQELKKRAAGKTSANPAEVAKAKKVLRRLYSWDEIPEWQRDNDFILHGYVKET 63

Query: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125
            S  E  KSL YLHNESVNIY+HL+P   F  V + ++  I+ F TT  +D+++IDLF+ 
Sbjct: 64  SSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLLLDKSTIKVFATTTWLDHMVIDLFYS 123

Query: 126 GGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLF 185
           G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+VSIL+YG+ +    F LF
Sbjct: 124 GAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMVSILYYGYFEKFSLFCLF 183

Query: 186 SGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRI 245
           + +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E WT+I
Sbjct: 184 ALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIIPIFSGLYCYSFSEIWTQI 243

Query: 246 QLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305
           QL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+AALCHLR LL +
Sbjct: 244 QLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIWGHSHQLFHFLVVIAALCHLRGLLNS 303

Query: 306 YKLFH 310
           Y+L H
Sbjct: 304 YELVH 308

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  360 bits (924), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/270 (60%), Positives = 208/270 (77%)

Query: 41  LYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAV 100
           L +WD++P+WQ+DNEHI+ GY+ ET S  +  +SL YLHNESVNIY+HL+PG CFL +A+
Sbjct: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111

Query: 101 FNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIV 160
           FN+ V+  + TT   DY+MID+F LG   CL +S V+HC K HSL V++ GNKLDY+GIV
Sbjct: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171

Query: 161 ALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVA 220
           AL+  S++S ++YGF+D    F LFS +T++  LACA VSLS  FRSREWR YRA++F A
Sbjct: 172 ALISCSMISQMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTA 231

Query: 221 FGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIW 280
           FGLS LLPVI    +YG  E ++RIQL+W+ L GV YI GAVLYG+RFPE++ PG FDIW
Sbjct: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291

Query: 281 GHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           GHSHQLFH+LVV+AALCHLRALL  YK  H
Sbjct: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVH 321

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  359 bits (921), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 169/309 (54%), Positives = 224/309 (72%)

Query: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61
           +   L +R     EL  R   +  +   +    ++  +RLY+WDEIPEWQRDN++I+ GY
Sbjct: 10  QMSTLLERTKSVQELKKRAAGKTPANPAEVAEAKKVLKRLYSWDEIPEWQRDNDYILHGY 69

Query: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121
           + ET S  E  KSL Y+HNESVNIY+HL+P   F  V + ++  I+ FETT   D+++ID
Sbjct: 70  VRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFTVLLLDKSTIKVFETTTWKDHMIID 129

Query: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181
           LF+ G F CL++SS FHC K HSL +A LGNKLDYLGI  L+VTS+ SIL+YG+++    
Sbjct: 130 LFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGICILIVTSMTSILYYGYYEKFSL 189

Query: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241
           F LF+ +T++FG+AC+ V+L +KFR REWRPYRA LFV FGLS+++P+ +G   Y   E 
Sbjct: 190 FCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYCYTFSEI 249

Query: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301
           WT+IQL WVLLGGV YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+ CHLR 
Sbjct: 250 WTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKFDIWGHSHQLFHFLVVIASFCHLRG 309

Query: 302 LLGAYKLFH 310
           LL +Y+L H
Sbjct: 310 LLNSYELVH 318

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 225/324 (69%), Gaps = 12/324 (3%)

Query: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTK---------RRLYT---WDEIP 48
           M      Q++  E  +    V E    + +  +K   K         R+L T   WD++P
Sbjct: 1   MTSSSRLQKRNGETIVSSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLP 60

Query: 49  EWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEK 108
           +WQ+DNEHI  GY+ ET S   C +SL +LHNESVNIY+H++PG C L + + +  +I+K
Sbjct: 61  DWQKDNEHIHEGYVKETNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKK 120

Query: 109 FETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIV 168
           F TT  +DY MIDLF  G F+CL++SS FH  K HSL VAI GNKLDYLGIV L+VTS++
Sbjct: 121 FPTTTFVDYFMIDLFLAGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMI 180

Query: 169 SILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLP 228
           SIL+YGF+D   +F LFS +T+ FG+AC TVSL+NKFRSREWRPYRA+LFV FGLSA+ P
Sbjct: 181 SILYYGFYDTPYFFHLFSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFP 240

Query: 229 VIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFH 288
           V+ G  +YGL++T+ RIQL+W++  G FYI GA LY +R+PER+ PG FD+WGHSHQ+FH
Sbjct: 241 VLTGIWYYGLEDTFKRIQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFH 300

Query: 289 ILVVVAALCHLRALLGAYKLFHHV 312
           + VV+AA  H   LL AY+  H +
Sbjct: 301 VFVVIAAYSHFHGLLSAYEYAHEM 324

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  358 bits (918), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 172/309 (55%), Positives = 227/309 (73%)

Query: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61
           E   L +R     EL  R     ++   +    ++  +R+Y+WDEIPEWQRDN++I+ GY
Sbjct: 10  EMSTLLERTNSVQELKKRAAGNTAANPAEVAKAKKVLKRVYSWDEIPEWQRDNDYILHGY 69

Query: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMID 121
           + ET S  +  KSL Y+HNESVNIY+HL+P   FL V + ++  I  FETT  +D++MID
Sbjct: 70  VKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLDKTTITVFETTTWLDHMMID 129

Query: 122 LFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLY 181
           LFF G F CL++SS FHCFK HSL +A LGNKLDYLGI  L+VTS+VSIL+YG++D    
Sbjct: 130 LFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICILIVTSMVSILYYGYYDKFPA 189

Query: 182 FWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKET 241
           F LF+ +T++FG+AC+ VSL +KFR REWRPYRA LFV FGLS+++P+ +G  +Y   E 
Sbjct: 190 FCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFGLSSIVPIFSGLYYYSFSEI 249

Query: 242 WTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301
           W +IQL WVLLGG  YI+GAVLYG+RFPE++ PG FDIWGHSHQLFH LVV+A+LCH+R 
Sbjct: 250 WNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGHSHQLFHFLVVIASLCHMRG 309

Query: 302 LLGAYKLFH 310
           +L +Y+L H
Sbjct: 310 VLNSYELVH 318

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  302 bits (774), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 205/283 (72%), Gaps = 2/283 (0%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHL 89
           +S    + ++RL T++E+P+WQ+DNE I+ GY+ ET+S  EC KSLLY HNE+VNIYTHL
Sbjct: 20  ESIATAKGRKRLCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHL 79

Query: 90  LPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPV 147
           +PG  +LL+ +F  + ++I KF ++ + DY++I+ F LG F CLM SS FHC K HS   
Sbjct: 80  VPGVTYLLMLMFLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEH 139

Query: 148 AILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRS 207
           + + +K+DY+GI+ L+  S+VSIL+YGFHD+  +F +F+ +T+  G  CA   L+++F S
Sbjct: 140 SDIWSKVDYMGIIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNS 199

Query: 208 REWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIR 267
           + +R +RAS FV+FG S L+P+I G + +G+ E+  R+QL++V L  VFYI GAV YG R
Sbjct: 200 KNFRVFRASFFVSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFR 259

Query: 268 FPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            PE   PG FD+ GHSHQ+FH++VV+ +LCHLRA++G+Y   H
Sbjct: 260 IPENFGPGKFDLVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMH 302

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  287 bits (735), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 133/285 (46%), Positives = 196/285 (68%), Gaps = 3/285 (1%)

Query: 29  KDSNLKQRTKRR-LYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYT 87
           K+S   ++TK+  L  ++E+PEWQRDNE I+ GY+ ET+S  +CL+SL Y HNE++NIYT
Sbjct: 22  KNSKSAEQTKKSALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYT 81

Query: 88  HLLPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSL 145
           HL+P   +L++ +F  +  +I  F +T + DY+MI+ + LG F CL+ S+ FHC K HS 
Sbjct: 82  HLIPSGTYLVLLMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSE 141

Query: 146 PVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKF 205
             + + +K+DY+GI+ L+  S VS+L+YGFHDY  +F +F+   +  G  CA   L+++F
Sbjct: 142 AQSNIWSKVDYMGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRF 201

Query: 206 RSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYG 265
            ++ WR  RA  FV FG S ++P+I G + +G+ E+  R+QL +VLL   FYI GA++YG
Sbjct: 202 NAKNWRACRAGFFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYG 261

Query: 266 IRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            R PE + PG FD  GHSHQ+FHILVV+ +LCH RAL+G+Y   H
Sbjct: 262 FRIPETLIPGKFDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMH 306

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  285 bits (730), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 192/294 (65%), Gaps = 2/294 (0%)

Query: 19  RMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL 78
           +    N      S      K  L  ++E+P+WQRDN+ I+ GY+ ET S  +C +SL Y 
Sbjct: 12  QQCAPNKGKAGTSGATAPGKNGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYF 71

Query: 79  HNESVNIYTHLLPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSV 136
           HNE+VNIYTHL+P   +L++ +F  +  +I +F TT + DY+MI+ F LG F CLM S+ 
Sbjct: 72  HNETVNIYTHLIPSGTYLVMLMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTC 131

Query: 137 FHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLAC 196
           FHC K HS   + + +K+DY+GI+ L+  S VS+L+YGF+DY  +F +F+   +  G  C
Sbjct: 132 FHCLKQHSEAQSNIWSKVDYMGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCC 191

Query: 197 ATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVF 256
           A   L+++F ++ WR  RA  FV FG S ++P++ G + +G+ E+  R+QL +VLL  +F
Sbjct: 192 AAFVLNDRFNAKNWRACRAGFFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALF 251

Query: 257 YILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           YI GAV+YG R PE + PG FD  GHSHQ+FHILVV+ +LCH RALLG+Y   H
Sbjct: 252 YISGAVIYGFRIPETLLPGKFDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMH 305

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  284 bits (726), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 141/303 (46%), Positives = 205/303 (67%), Gaps = 4/303 (1%)

Query: 6   LTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILET 65
           +++ + ++ +    M +E +    +  LK+R  R+LYT+DE+P WQ+DNE I+ GY+ ET
Sbjct: 1   MSEERGMKEQTISEMAQEMAHTTSE-GLKKRI-RKLYTFDELPAWQKDNELILSGYVRET 58

Query: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFL-LVAVFNQVVIEKF-ETTRLIDYVMIDLF 123
            S  ECL+++ Y +NES+NIYTHL+PG  +L L  +F  +V+ +        ++ M+  +
Sbjct: 59  NSVKECLRAMTYFNNESINIYTHLIPGVAYLVLFLIFADLVLAQLLPGLDAGEHRMLRFY 118

Query: 124 FLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFW 183
            LG FTCL  SS FHC K HS P + L +K+DYLGI+A +  S +S+L+YG+H Y  +F 
Sbjct: 119 LLGAFTCLACSSCFHCLKQHSEPHSRLWSKVDYLGILAQITCSTISLLYYGYHSYPSHFV 178

Query: 184 LFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWT 243
            FS LT+A   ACA + L++ F +  +RP RA LF+AFGLS ++PV+AG+  +G  E   
Sbjct: 179 FFSTLTVALCSACAVLVLNDSFNTVAFRPLRAFLFMAFGLSGVIPVLAGSYQFGFAEWAA 238

Query: 244 RIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALL 303
           RIQL++VL   VFYI GA++YG R PER APG FD+ GHSHQ+FH+LVV+  LCH RA+ 
Sbjct: 239 RIQLKYVLYEAVFYITGALVYGFRIPERFAPGKFDMVGHSHQIFHLLVVLGTLCHFRAVT 298

Query: 304 GAY 306
           G+Y
Sbjct: 299 GSY 301

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 127/297 (42%), Positives = 197/297 (66%), Gaps = 7/297 (2%)

Query: 21  VEENSSLLKDSNLKQRTK-----RRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSL 75
           + +  + ++++   + +K     ++LY ++E+PEWQ+DN+ I+ GY+ ETKS   CL SL
Sbjct: 7   IRQRKTTVQETQKARDSKDGIMGKKLYHFNELPEWQQDNDKILTGYVRETKSVLRCLDSL 66

Query: 76  LYLHNESVNIYTHLLPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMM 133
            Y +NESVNIYTHLL    + ++ +F  + ++I  F +T + DY++I+ + LG F CLM 
Sbjct: 67  SYWNNESVNIYTHLLSAVAYFVLLLFFTDILLIPSFPSTTMTDYIIINFYLLGAFVCLMC 126

Query: 134 SSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFG 193
           SS FHCFK HS   +   +K+DY+GI+ L+  S++S+L+YG+ D+  YF LFS +T+   
Sbjct: 127 SSCFHCFKQHSNSQSDAWSKVDYMGIIGLISCSVISLLYYGYFDHVFYFKLFSVITVVLA 186

Query: 194 LACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLG 253
           +AC+   LS++F + + RP RAS F+ F  S+++P+  G   +G  E + R+QL +V   
Sbjct: 187 MACSVCVLSDRFNTSDMRPLRASFFITFAFSSVIPIATGMFKFGWTEVFHRVQLRFVGWE 246

Query: 254 GVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
             FY+ GA+LYG R PE +APG FD  G SHQLFH+LVV+ + CHLRA++G+Y   H
Sbjct: 247 AFFYLSGALLYGYRIPETIAPGKFDFIGSSHQLFHVLVVLGSFCHLRAVMGSYMFMH 303

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  274 bits (700), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 128/276 (46%), Positives = 192/276 (69%), Gaps = 3/276 (1%)

Query: 38  KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPG--WCF 95
           ++ LY + E+PEWQ+DN+ I+ GYI ETKS  +C++SL   +NE+VNIYTHL+    +  
Sbjct: 29  EKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFL 88

Query: 96  LLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLD 155
           L++ + + V++  F T+   DY +I+ + LG F CLM SS FH FK HS P +   +K+D
Sbjct: 89  LMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVD 148

Query: 156 YLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRA 215
           Y+GI+ L+  S++S+++YGF D+  YF LF+ LT+    AC    LS+KF  +++RP RA
Sbjct: 149 YMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRA 208

Query: 216 SLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPG 275
             F+AFGLS + PV AG + +G++    R+QL+++ L  +FYI GA++YG R PE M PG
Sbjct: 209 GFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPG 268

Query: 276 CFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHH 311
            FD WGHSHQ+FH+LVV+A+  HL+A++G+Y +F H
Sbjct: 269 RFDFWGHSHQIFHVLVVIASFLHLKAVMGSY-IFKH 303

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  273 bits (699), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 194/296 (65%), Gaps = 3/296 (1%)

Query: 17  HHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLL 76
           H R + E    L    +   T +RLY + E+PEWQ+DN+ I+ GYI ETKS  EC+KSL 
Sbjct: 9   HRRSISEKLEQLTPVAISS-TIKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLF 67

Query: 77  YLHNESVNIYTHLLPGWCFL--LVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMS 134
             HNES+NIY+HL+P   +L  LV + +  ++ +F  + ++  VMI  F LG   CL  S
Sbjct: 68  LFHNESINIYSHLVPTITYLVLLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCS 127

Query: 135 SVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGL 194
           S FHC K HS     + +K+DY+GI+ ++  SI+S+L+YGFHD+  +F  F+  T+  G 
Sbjct: 128 SFFHCLKQHSESHCHIWSKVDYMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGT 187

Query: 195 ACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGG 254
            C   +L +KF S+ +RP+RA  +V FGLS ++P++ G   +G  E   R+QL++VLL  
Sbjct: 188 ICTVFALHDKFNSKTFRPFRAMFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEA 247

Query: 255 VFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           +FYI GAV+YG RFPE +APG FD  GHSHQ+FHI+VV+ ++CH RA+LG+Y   H
Sbjct: 248 MFYIAGAVIYGFRFPEVLAPGKFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMH 303

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  271 bits (692), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 126/279 (45%), Positives = 196/279 (70%), Gaps = 2/279 (0%)

Query: 34  KQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGW 93
           ++++++ L+ ++E+PEWQ+DN+ I+ GY+ ET S   CL+SLLYL+NESVNIYTHL+P  
Sbjct: 31  EEKSEKLLWHFNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAV 90

Query: 94  CFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILG 151
            ++ ++++  N  +I  + +T  +DYV+I++FFLG F CL+ SS FHC K HS     + 
Sbjct: 91  FYISLSLYLANVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVW 150

Query: 152 NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWR 211
           +KLDYLGI+ L+  S V +++YG+ D+   F +F+G+T+   + C+   L++KF + E+R
Sbjct: 151 SKLDYLGIICLISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYR 210

Query: 212 PYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
           P RAS F  FG S ++P+ AG L +G +    RI L ++ L  +FYI GA++YG RFPE 
Sbjct: 211 PIRASFFTLFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPET 270

Query: 272 MAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           +APG FD +G SHQ+FHI+VV+ ++CHL A++ +Y L H
Sbjct: 271 IAPGKFDFFGSSHQIFHIMVVLGSICHLFAMVESYHLIH 309

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  268 bits (686), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 199/311 (63%), Gaps = 8/311 (2%)

Query: 2   EQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGY 61
           EQ     R+   V       +  + LL+ + + +   ++LY++ E+PEWQ+DNE I+ GY
Sbjct: 12  EQSSKLSRRRFSVS------KNGTVLLESTEIVETYSKKLYSFHELPEWQKDNELIIQGY 65

Query: 62  ILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVF--NQVVIEKFETTRLIDYVM 119
           + ET S ++C  SL Y HNES+NIYTHL+PG  + ++ +F  + +V+  F +T ++DY++
Sbjct: 66  VRETNSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIV 125

Query: 120 IDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYD 179
           ID + LG F CL+ SS FHC K HS   +   +K+DY+GI+ L+  S++S+L+YG+ D+ 
Sbjct: 126 IDFYLLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHF 185

Query: 180 LYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLK 239
           +YF +F+ +T+     C    L  +F ++ +RP RA  FV F  SA++P+  G + +   
Sbjct: 186 IYFKVFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYV 245

Query: 240 ETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHL 299
           E   RIQL +V     FY++GA+LYG R PE  APG FD+ G SHQ+FH++VV+ +L HL
Sbjct: 246 EVINRIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHL 305

Query: 300 RALLGAYKLFH 310
           +A++G+Y+  H
Sbjct: 306 KAVIGSYEFMH 316

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  268 bits (686), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 196/296 (66%), Gaps = 4/296 (1%)

Query: 21  VEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHN 80
           +E+N +  K    +++ K  L  +DE+PEWQ+DN+ I+ GY+ ET S   C +SL YL+N
Sbjct: 33  LEDNDTSQKPKTNRRKRKIHLSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSLFYLNN 92

Query: 81  ESVNIYTHLLPGWCFLLVAV----FNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSV 136
           E++NIYTHL+P   +L+V++     N + I KF TT +IDY++I++F LG FTCL++SS 
Sbjct: 93  ETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCLLLSSC 152

Query: 137 FHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLAC 196
           FHC K HS     L +KLDY+GI+ L+  SI+ IL++G+ D   YF  F+ LT +F + C
Sbjct: 153 FHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFSFAIVC 212

Query: 197 ATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVF 256
           + + L+ KF    +RP RA LF+ F  + L+P+I G   +G K    RI L +VLL  +F
Sbjct: 213 SIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVLLEAIF 272

Query: 257 YILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHHV 312
           YI+G +LYG R PE   PG FD++G SHQ+FHI VV+ ++CH  A++ +Y L HH+
Sbjct: 273 YIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMHHL 328

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  267 bits (683), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 129/275 (46%), Positives = 186/275 (67%), Gaps = 2/275 (0%)

Query: 34  KQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGW 93
           K+   RRLY++DE+PEWQ+DNE I  GY+ ET S  ECLKS+ Y +NESVNIYTHL+P  
Sbjct: 15  KKNFNRRLYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSV 74

Query: 94  CFLLVAVFNQVVIEK--FETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILG 151
            + ++ +    ++    F  T + +Y+MID +  G F CLM S+ FHC K HS     + 
Sbjct: 75  TYFILLLLFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIW 134

Query: 152 NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWR 211
           +K+DY+GI+  + +SIVSIL+YGF+D+  +    S LT+  G+ C T  L+++F + ++R
Sbjct: 135 SKVDYIGIIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYR 194

Query: 212 PYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
             RA  F  FG S ++PV+ G   +GL E   RIQL++VL G +FYI GA++YG R PE 
Sbjct: 195 LLRAIFFTVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEA 254

Query: 272 MAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAY 306
           +APG FD  GHSHQ+FH+LVV+ ++CH RA++G+Y
Sbjct: 255 LAPGKFDFIGHSHQIFHLLVVLGSICHFRAVIGSY 289

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  266 bits (679), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 185/283 (65%), Gaps = 2/283 (0%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHL 89
            S      ++ L+ +DE+PEWQ+DN+ I+ GY+ ET S  +CL+SL Y +NE+VNIYTHL
Sbjct: 29  QSKTASEKEKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHL 88

Query: 90  LPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPV 147
           +P   + L A+   N  +I  F +T   DY +I++F +G F+CLM SS FHC K HS   
Sbjct: 89  VPAIIYFLFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQ 148

Query: 148 AILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRS 207
           +   +KLDYLGI++L+  S++ I+++G+ D+  YF LF+ +T+     C    L  KF +
Sbjct: 149 SNFWSKLDYLGIISLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNT 208

Query: 208 REWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIR 267
             +RP+RA  F+ FG S LLP+  G   +G++    RI++ +V    +FYI GAV+YG R
Sbjct: 209 STFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFR 268

Query: 268 FPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            PE +APG FD  G SHQ+FHI+VV+ +LCHL+A++ +YKL H
Sbjct: 269 IPETIAPGKFDFLGSSHQIFHIMVVLGSLCHLKAIIDSYKLMH 311

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  264 bits (675), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 125/283 (44%), Positives = 185/283 (65%), Gaps = 2/283 (0%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHL 89
            S      K+ L+ +DE+PEWQ+DN+ I+ GY+ ET S  +CL SL Y +NE+VNIYTHL
Sbjct: 29  SSTTVSEKKKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHL 88

Query: 90  LPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPV 147
           +P   + + A+   N  +I  F +T   DY +I++F +G F+CLM SS FHC K HS   
Sbjct: 89  VPAVIYFVFAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQ 148

Query: 148 AILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRS 207
           +   +KLDYLGI++L+  S++ I+++G+ D+  YF LF+ +T+     C    L  KF +
Sbjct: 149 SNFWSKLDYLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNT 208

Query: 208 REWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIR 267
             +RP+RA  F+ FG S LLP+  G   +G++    RI++ +V    +FYI GAV+YG R
Sbjct: 209 STFRPFRAMFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFR 268

Query: 268 FPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            PE +APG FD  G SHQ+FHI+VV+ ++CHL+A++G+YKL H
Sbjct: 269 IPETLAPGKFDFLGSSHQIFHIMVVLGSICHLKAIIGSYKLMH 311

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  261 bits (668), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 185/275 (67%), Gaps = 2/275 (0%)

Query: 38  KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLL 97
           ++ L+ +DE+PEWQ+DN+ I+ GY+ ET S  +CL SL Y +NE+VNIYTHL+P   + +
Sbjct: 37  QKLLHNFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFV 96

Query: 98  VAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLD 155
            A+   N  +I  F +T   DY +I++F +G F+CLM SS FHC K HS   +   +KLD
Sbjct: 97  FAITLTNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLD 156

Query: 156 YLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRA 215
           YLGI++L+  S++ I+++G+ D+  YF LF+ +T+     C    L +KF +  +RP+RA
Sbjct: 157 YLGIISLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRA 216

Query: 216 SLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPG 275
             F+ FG S LLP+  G   +G++    RI++ +V    +FYI GAV+YG R PE +APG
Sbjct: 217 MFFILFGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPG 276

Query: 276 CFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            FD +G SHQ+FHI+VV+ ++CHL+A++ +YKL H
Sbjct: 277 KFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMH 311

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  260 bits (665), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 201/313 (64%), Gaps = 6/313 (1%)

Query: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDSNLKQRT-KRRLYTWDEIPEWQRDNEHIVG 59
           M +   T+RKP +V+    +   +S+   D +  +R  KRRL+ ++E+PEWQRDN+ I+ 
Sbjct: 1   MSRVTTTRRKPTKVQ---AVAVGSSNKHADGDKTKRNWKRRLFNFNELPEWQRDNDKILT 57

Query: 60  GYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAV--FNQVVIEKFETTRLIDY 117
           GY+ ETKS  +CL+SLLY +NE++NIYTHL+P   +L ++V   N VV+  F TT ++DY
Sbjct: 58  GYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISVTLINYVVVPHFPTTSIMDY 117

Query: 118 VMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHD 177
            +I++F +G F CL++SS FHC K HS     L +KLDY+GI+ L+  S++ ++++G+ D
Sbjct: 118 FVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMGIIILISCSLIPMIYFGYFD 177

Query: 178 YDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYG 237
           +  Y   F  LT +F   C+   L+ KF    +RP+RA +F+ F  S  +P++ G   +G
Sbjct: 178 HLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVFMLFSFSGFIPILTGFYLFG 237

Query: 238 LKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALC 297
               + R+ L++V    +FYI GA LYG R PE   PG FD  G SHQ+FHILVV+ ++C
Sbjct: 238 FHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFDFLGSSHQIFHILVVLGSIC 297

Query: 298 HLRALLGAYKLFH 310
           H RA++ +Y L H
Sbjct: 298 HFRAVIKSYILMH 310

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  259 bits (661), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 123/282 (43%), Positives = 186/282 (65%), Gaps = 2/282 (0%)

Query: 31  SNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLL 90
           S +  R ++ L+ + E+P+WQRDN+ I+ GY+ ET S  +CL SL Y +NE+VNIYTHL+
Sbjct: 29  SKVTLRKEKLLHDFHELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLV 88

Query: 91  PGWCFLL--VAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVA 148
           P   + +  V + N  +I  F +T   DY +I++F +G F CLM SS FHC K HS   +
Sbjct: 89  PAIVYFVFGVTLTNYFLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQS 148

Query: 149 ILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSR 208
              +KLDYLGI++L+  S++ I+++G+ D+  YF LF+ +T+     C    L +KF + 
Sbjct: 149 DFWSKLDYLGIISLISCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTS 208

Query: 209 EWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRF 268
            +RP+RA  F+ FG S LLP+  G   +GL+    RI++ +V    +FYI GA++YG R 
Sbjct: 209 TFRPFRAMFFILFGFSGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRI 268

Query: 269 PERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           PE +APG FD +G SHQ+FHI+VV+ ++CHL+A++ +YKL H
Sbjct: 269 PETLAPGKFDFFGSSHQIFHIMVVLGSVCHLKAIIDSYKLMH 310

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  256 bits (653), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 132/315 (41%), Positives = 193/315 (61%), Gaps = 5/315 (1%)

Query: 1   MEQGGLTQRKPVEVELHHRMVEENSSLLKDS-NLKQR-TKRRLYTWDEIPEWQRDNEHIV 58
           M+Q             HHR    +S L + + ++KQ+ T   LYT++E+P WQ+DNE I+
Sbjct: 1   MQQSTGANAHSSSPLTHHRSKSISSILSQAAEDVKQKITDTLLYTYEELPSWQQDNEMIL 60

Query: 59  GGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVF---NQVVIEKFETTRLI 115
            GYI ET S   CL+SL + HNE++NIY+H +    +LL+ VF   N + +  F TT L 
Sbjct: 61  TGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLVFFFTNLIYLPSFPTTTLH 120

Query: 116 DYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIVALVVTSIVSILFYGF 175
           DY+++D++ LG  TCL +SS FHC K HS   + + +K+DY+GI+ L+  S +S+L++G+
Sbjct: 121 DYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYIGIICLITCSTISLLYFGY 180

Query: 176 HDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALH 235
            D+  YF  F+  T    + C       KF +R+W+  RA  F+AF  S L+P+I G   
Sbjct: 181 RDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALFFIAFAGSGLIPLITGINI 240

Query: 236 YGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAA 295
           +G  E W R+QL  + L  + Y++GA+LYG R PE  APG FD  G+SHQ FHI VV+ +
Sbjct: 241 FGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKFDNIGNSHQWFHIFVVLGS 300

Query: 296 LCHLRALLGAYKLFH 310
           L HLRAL+G+Y   H
Sbjct: 301 LLHLRALVGSYYFMH 315

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  253 bits (646), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 117/273 (42%), Positives = 184/273 (67%), Gaps = 2/273 (0%)

Query: 40  RLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVA 99
           +L  + E+P+WQ+DNE I+ GY+ ET S  +CL+SL   +NES+NIY+HL+    + +V 
Sbjct: 40  KLCHFHELPDWQKDNEFILTGYVRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVL 99

Query: 100 VF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYL 157
           +F  + + I  F +T  +DY++IDL+ LG FTCL+ SS+FHC K HS   + + +K+DY+
Sbjct: 100 LFYTDILCIPSFPSTTFVDYMVIDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYI 159

Query: 158 GIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASL 217
           GI+ L+  S++S+L+YG+ D+ +YF +F+ +T+     C    L  +F S+ +RP RA  
Sbjct: 160 GIICLITCSLISLLYYGYMDHFIYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGF 219

Query: 218 FVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCF 277
           F+ F +SA++P+ AG   +G  E   RIQL +V     FY++GA+LYG R PE + PG F
Sbjct: 220 FILFSMSAVIPIGAGFSKFGFTEVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNF 279

Query: 278 DIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           D+ G SHQ+FHI+V++ ++ HL+A+LG+Y   H
Sbjct: 280 DLVGSSHQIFHIMVILGSVFHLKAVLGSYTFMH 312

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  246 bits (629), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 120/288 (41%), Positives = 185/288 (64%), Gaps = 7/288 (2%)

Query: 29  KDSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTH 88
            DS++K   KR LY + E+P WQ+DN+ I+GGY+ ET S  +C++SL YL+NES+NIY+H
Sbjct: 28  SDSSIKIE-KRILYHFHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSH 86

Query: 89  LLPGWCFLLVAVFNQVVIEKF------ETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKC 142
           L+P   +L +AV   + I++F       TT   D++ I++F +G F CL+ S  FH  K 
Sbjct: 87  LIPSLIYLTIAVMLLIEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQ 146

Query: 143 HSLPVAILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLS 202
           HS       +++DY+GI+ L+  S++ +L+YGF D+ + F+ F  LT+AF   C+ + +S
Sbjct: 147 HSELQCNFWSRIDYMGIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMS 206

Query: 203 NKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAV 262
             F   ++R  RA +F AFG S L+P+I G   +GL   + RI L+++    VFY++GA 
Sbjct: 207 ETFNLSKYRLLRACVFAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGAT 266

Query: 263 LYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           LYG R PE + PG FD++G SHQLFH  VV+ ++ H +A++ +Y L H
Sbjct: 267 LYGFRIPESILPGKFDLFGSSHQLFHCFVVIGSVLHFKAVIESYILMH 314

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  223 bits (568), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 180/285 (63%), Gaps = 3/285 (1%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHL 89
            S      + RL  ++E+P WQ+DN+ I  GY+ ET S   CL SLLY +NESVN+Y+HL
Sbjct: 36  SSGAPSGQRGRLCRYEELPAWQQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHL 95

Query: 90  LPGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPV 147
           +P   ++  A    +Q  + +F TT   DY++I+ F +G   CL+ SS+FHC K HS   
Sbjct: 96  VPAVLYIAGATLALSQWGVPRFPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERH 155

Query: 148 AILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNK-FR 206
               +++DY+GI+ L+  S + ++++G+ DY  +  LF+ +T+A G+AC+ V L NK F 
Sbjct: 156 CEAWSRMDYMGIILLIACSTIPMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFN 215

Query: 207 SREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGI 266
           S  ++  RA+ F+AF  + L+P+  G + +G+     RI L++V    VFYI GA+LYG 
Sbjct: 216 SSSFKLVRAAFFIAFAFNGLIPMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGF 275

Query: 267 RFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFHH 311
           R PE   PG  D+WG+SHQ+FH++VV  +LCHL+A+L +Y L H 
Sbjct: 276 RVPEIWIPGKVDLWGNSHQMFHVMVVFGSLCHLKAVLESYSLMHR 320

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 148/287 (51%), Gaps = 28/287 (9%)

Query: 40  RLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVA 99
           +L  ++++P+WQ+DN  IV  Y+ ET S ++ L S+   H+ES+NI+THL+P    LL A
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPA---LLYA 63

Query: 100 VFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGI 159
            F    I   E    + Y ++  + +    C ++SS+FH FKC S+       KLDY+GI
Sbjct: 64  KFTYNAITTLEQ---VSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 160 VALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREW--------- 210
             L+  +IVS+   GF++        + +T    L    + L+ K   ++          
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 211 ------------RPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYI 258
                       +  RA LF + GLS L+PVI G   YG K  + +I +  V+   + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 259 LGAVLYGIRFPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGA 305
           +G ++Y  + PE+  PG FD+ G SHQLFHI +V   +CH  A+  A
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAIQTA 286

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  131 bits (329), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 150/283 (53%), Gaps = 7/283 (2%)

Query: 33  LKQRTKRRLYTWDEIPEWQR--DNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLL 90
           + + + R  Y   E+PEWQR  ++  ++ G++ ET S  +CL S +Y HN S+NI  + +
Sbjct: 25  ISKLSTRNHYKLKELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGI 84

Query: 91  PGWCFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVA 148
               + ++  F  +  +I  F +T + DY++++L+ L      M+ ++F+  K HS   A
Sbjct: 85  AATVYFMLLFFFTDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQA 144

Query: 149 ILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSR 208
            L  KL+ +G++  + +S+V++L+Y + DY  YF  F+ +T+   +   T S+ +   ++
Sbjct: 145 FLWYKLNNIGLINHIASSVVTLLYYHYFDYVFYFKFFTIVTLLL-ITLFTCSIISDSFNK 203

Query: 209 EWRPYRASLFVAF-GLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIR 267
             R  +  L +A+  L  L+P +   L +GL +   RI L  ++L    Y  G  +   +
Sbjct: 204 MTRIRKNFLLLAYIILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQ 263

Query: 268 FPERMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            PER     FD  G+S  ++ + ++V +  H + L+ +Y L H
Sbjct: 264 LPERFF-NSFDFLGNSENVYQLSIIVCSFIHFKILMNSYCLMH 305

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  127 bits (320), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 141/280 (50%), Gaps = 7/280 (2%)

Query: 36  RTKRRLYTWDEIPEWQRD--NEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGW 93
           R  + L    E+P+WQ+   N  I+ GY+ ET S  +CL ++ Y +N++VNI  + +   
Sbjct: 36  RRPKVLPILKELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFST 95

Query: 94  CFLLVAVF--NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILG 151
            +  + +F  +  +I     T + DY+M++ +  G F    ++S+F+  + HSL    L 
Sbjct: 96  VYFTLLLFFTDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLW 155

Query: 152 NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWR 211
            KL +L  +  + TSI++ L+Y F D   YF   +  T+      A  +LS +F  R+ R
Sbjct: 156 FKLSHLAFINYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNR 214

Query: 212 PYRASLFVAFGLSAL-LPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPE 270
             R  + + F +S L LP  +    +       R++ + +LL    Y+    L  ++ PE
Sbjct: 215 SQRNMVSITFIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPE 274

Query: 271 RMAPGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           R +   FD  G+S  ++HI +++ +L H + LL +Y   H
Sbjct: 275 RFSEN-FDFIGNSENIYHICIILGSLLHFKMLLNSYFFMH 313

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 99.0 bits (245), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 144/291 (49%), Gaps = 18/291 (6%)

Query: 34  KQRTKRRLYTWDEIPEWQR--DNEHIVGGYILETKSTW-ECLKSLLYLHNESVNIYTHLL 90
           K+  + ++ T +++P W R   N  I  GY   T +T+  CL+ L+  +N+S++IY +L+
Sbjct: 3   KKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLV 62

Query: 91  PGWCFLLVAVFNQVV--IEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVA 148
            G    ++ +F   V  I    +T + DY++I+LF +   T     ++    K HS    
Sbjct: 63  CGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQG 122

Query: 149 ILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSR 208
            L N+   L +V L+  SIV++L+Y F D+   F LF   T       + V ++++++  
Sbjct: 123 KLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK-- 180

Query: 209 EWRPYRASLFVAFG-LSALLPVIAGALHYGLKETWTRIQLEWVLLG--GVFYILGAVLYG 265
             R  + S  V FG LS  LP+    + +GL +++ + ++ + +L    V Y L A+L  
Sbjct: 181 --RVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQL 238

Query: 266 IRFPERMAPG------CFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
            R PE             D  G+S Q+  ++ + A + H   ++ AY++ H
Sbjct: 239 TRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVH 289

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 153/316 (48%), Gaps = 23/316 (7%)

Query: 1   MEQGGLTQRKPVEVEL-HHRMVEENSSLLKDSNLKQRTKRRLYTWDEIPEWQRDNEHIVG 59
           M      ++ PVE +    +  +   ++  +++++ +  ++ + + ++ +WQ+  ++   
Sbjct: 1   MASLTTVEQSPVEPKTATEKYSDATGAVTSNADVETKETKKGFPFHDLAKWQKQYKN--- 57

Query: 60  GYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVM 119
                  S  E L +L+YL   S++ +  L+    F L+ +F         TT + DY++
Sbjct: 58  -----KSSRSESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFPT-------TTTMTDYIV 104

Query: 120 IDLFFLGGFTCLMMSSVFHCFKCHSLPVAI-LGNKLDYLGIVALVVTSIVSILFYGFHDY 178
            + + L  F   M+  ++H  K  SL   I +  K  YL  + L+++S ++IL+Y F+DY
Sbjct: 105 FNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLISSQITILYYLFYDY 164

Query: 179 DLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSAL-LPVIAGALHY- 236
             +F +F+ L    GLA   V L++K  S + R  +   F++  +    LP++   + + 
Sbjct: 165 VFFFKIFTLLMTFIGLAAYFVILTDKLNSYK-RFNKTVFFISVSVVCCSLPLLTAIITFD 223

Query: 237 GLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMA--PGCFDIWGHSHQLFHILVVVA 294
           GL+    RI+L  +    V  ++ +++Y  RFPE +       + W HS   FH+L+   
Sbjct: 224 GLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEGWNHSEYFFHLLISGT 283

Query: 295 ALCHLRALLGAYKLFH 310
           A  H   L+ +Y L H
Sbjct: 284 AFYHFFILIQSYILMH 299

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 139/288 (48%), Gaps = 24/288 (8%)

Query: 30  DSNLKQRTK--RRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYT 87
           +SN+   TK  ++ + + ++ +WQ+   +          S  E L +L+YL   S++ + 
Sbjct: 29  NSNVDAETKEIKKGFPFHDLAKWQQQYRN--------KSSRNESLVALIYLLG-SMSSFC 79

Query: 88  HLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPV 147
            L+    F L+ +F         TT + DY++ + + L  F   M+  V+H  K  SL  
Sbjct: 80  LLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQ 132

Query: 148 AILG-NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFR 206
            +    K  YL  + L+++S ++IL+Y F+DY  +F +F+ L    GL      L++K  
Sbjct: 133 HLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLN 192

Query: 207 SREWRPYRASLFVAFGLSAL-LPVIAGALHY-GLKETWTRIQLEWVLLGGVFYILGAVLY 264
           S + R  +   F++  +    LP++   + + GL+    RI+++ +    V  +  +++Y
Sbjct: 193 SSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALVAASIIY 251

Query: 265 GIRFPERM--APGCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
             RFPE +       + W HS  LFH+++   A  H   L+ +Y L H
Sbjct: 252 VTRFPESLFRRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMH 299

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/310 (25%), Positives = 145/310 (46%), Gaps = 25/310 (8%)

Query: 8   QRKPVEVELHHRMVEENSSLLKDSNLKQRTK--RRLYTWDEIPEWQRDNEHIVGGYILET 65
           ++ PV+ E      E N +   DSN    TK  ++ + + ++ + Q+  ++         
Sbjct: 8   EQSPVKCETTTEK-ESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKN--------K 58

Query: 66  KSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFL 125
            S  E L +L+YL    ++ +  L+    F L+ +F         TT + DY++ + + L
Sbjct: 59  SSRNESLVALIYLLGSMLS-FCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLL 110

Query: 126 GGFTCLMMSSVFHCFKCHSLPVAILG-NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWL 184
             F   M+  ++H  K  SL   +    K  YL  + L+++S ++IL+Y F+DY  +F +
Sbjct: 111 NVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKI 170

Query: 185 FSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSAL-LPVIAGALHY-GLKETW 242
           F+ L    GL      L++K  S + R  +   F++  +    LP++   + + GL+   
Sbjct: 171 FTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSLPLLTAIITFDGLENLK 229

Query: 243 TRIQLEWVLLGGVFYILGAVLYGIRFPERM--APGCFDIWGHSHQLFHILVVVAALCHLR 300
            RI++  +    V  +  +++Y  RFPE +       + W HS  LFH+L+   A  H  
Sbjct: 230 ERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFF 289

Query: 301 ALLGAYKLFH 310
            L+ +Y L H
Sbjct: 290 ILIQSYILMH 299

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 79.3 bits (194), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 141/295 (47%), Gaps = 24/295 (8%)

Query: 23  ENSSLLKDSNLKQRTK--RRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHN 80
            NS+   +S +  +TK  ++ + + ++ +WQ   ++          S  E + +L+YL  
Sbjct: 22  NNSTAEINSTVGAKTKETKKGFPFHDLAKWQEQYKN--------KSSRNESVVALIYLLG 73

Query: 81  ESVNIYTHLLPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCF 140
             ++ +  L+    F L+ +F         TT + DY++ + + L  F   M+  ++H  
Sbjct: 74  SMLS-FCLLIFFTDFYLIPLFPT-------TTTMTDYIVFNFYLLNVFVFCMVHFIYHFI 125

Query: 141 KCHSLPVAILG-NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATV 199
           K  SL   +    K  YL  + L+++S ++IL+Y F+DY  +F +F+ L    GL     
Sbjct: 126 KNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFF 185

Query: 200 SLSNKFRSREWRPYRASLFVAFG-LSALLPVIAGALHY-GLKETWTRIQLEWVLLGGVFY 257
            L++K  S + R  +   F++   +   LP++   + + GL+    RI++  +    V  
Sbjct: 186 ILTDKLISSK-RFNKTVFFISVSVICCSLPLLTAIITFDGLENLKERIKVNAITWELVAL 244

Query: 258 ILGAVLYGIRFPERMAPGCF--DIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
           +  +++Y  RFPE    G    + W HS  LFH+++  AA  H   L+ +Y L H
Sbjct: 245 VAASIIYVTRFPELFLRGKKKEEGWNHSEYLFHLIISGAAFYHFFILIQSYILMH 299

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 122/276 (44%), Gaps = 21/276 (7%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL--HNESVNIYTHLLPGWCFLLVAVFNQ 103
           E+P   R+N +I+ GY          L  + +   HNE++NI++HL  G  +L   +F Q
Sbjct: 303 ELPFPWRENRYIIHGYRFYDSHVKSVLSVVNWYGWHNETLNIWSHLF-GAVYLAYLLFIQ 361

Query: 104 VVIEKF---ETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK-CHSLPVAILGNKLDYLGI 159
           +   K    +   L   ++I +F + G  CL+ SSV+H       LP+      +DY GI
Sbjct: 362 LPTTKVFMSQDVPLFGKLIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTGI 421

Query: 160 VALVVTSIVSILFYGFHD-----YDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYR 214
             L+  SI+S  F   ++           ++  L++  G+  + ++ S +F   E RP+R
Sbjct: 422 TVLITASILSTEFVSVYNLATQSLSTSMTVYMSLSLCLGIFGSFMNWSPRFDRPESRPFR 481

Query: 215 ASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAP 274
            + +V      ++  +   +  G+  +    +  W     ++Y++G V YG   PER   
Sbjct: 482 IAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVWN-RSLIWYLIGVVFYGSFIPER--- 537

Query: 275 GCFDIWGHSHQLFHILVVVAALCHLRALLGAYKLFH 310
                W    +L + +   A LC    +L  +K  H
Sbjct: 538 -----WRTDVELDYTIPTDAELCSNLDILTKHKHVH 568

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 109/252 (43%), Gaps = 21/252 (8%)

Query: 35  QRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTH 88
           Q  ++R   + E+P   R+N  I+ GY      +    KSLL +      HNE+VNI+TH
Sbjct: 208 QLGQQRHLHYYELPFPWRENRFIIHGYRFYNSYS----KSLLSIFNWYGWHNETVNIWTH 263

Query: 89  LLPG--WCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK--CHS 144
           L     + FL+   F+Q  + + E        M  +F   G  C + S V+H F   CH 
Sbjct: 264 LCGALYFAFLIFKGFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICH- 322

Query: 145 LPVAILGNKLDYLGIVALVVTSIVSILF---YGFHDYDLYFWL--FSGLTMAFGLACATV 199
           L        +DY GI  LV  SI++  F    G  D    + L  F+G + A G     +
Sbjct: 323 LKQRSNCACVDYTGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFM 382

Query: 200 SLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYIL 259
           + S KF   E RP R + ++          +   L     ++   I+  + +    +YI+
Sbjct: 383 NWSPKFDRPESRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVF-MKSLAWYII 441

Query: 260 GAVLYGIRFPER 271
           G V YG   PER
Sbjct: 442 GVVFYGTFIPER 453

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 110/240 (45%), Gaps = 26/240 (10%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLV---AVFN 102
           ++P   R+N +I+  Y     S  + L S+  LHNE+ NI++HLL    FL V    + N
Sbjct: 197 QLPFPYRENRYIINNYRF-YDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 103 QVVIEKF---ETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNK---LDY 156
            +++       T +L  Y    LF      C++ S+ +H F   S+    L  K   +DY
Sbjct: 256 SIIVSSSMVPTTAKLFLY----LFVFASLKCMLSSTFYHTFNGTSM--LKLRRKFMCVDY 309

Query: 157 LGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS 216
            GI  L+ +SI+SI F   +DY      +   +   G+    ++ S  F S E RP R  
Sbjct: 310 SGISILITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIK 369

Query: 217 LFV---AFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGG--VFYILGAVLYGIRFPER 271
            F+   + G  ALL ++     +  K  +  I +   L     V+Y++G V YG   PER
Sbjct: 370 FFILLSSCGAFALLHLV-----FLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPER 424

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 132/324 (40%), Gaps = 54/324 (16%)

Query: 35  QRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL--HNESVNIYTHLLPG 92
           Q  + +L  + E+P   R+N +I+  Y     +    L ++ +   HNE+ NI++H L  
Sbjct: 210 QEGREKLLHYYELPFPWRENRYIIHNYRFYDSNVKSLLSAINWYGWHNETSNIWSHFLGF 269

Query: 93  WCFLLVAV--FNQVVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFKCHS-LPV 147
           +  + +AV  F Q V+  F++ R+      ++ +F      CL+ S+ +H F   + L +
Sbjct: 270 FYVVYLAVYEFPQSVV--FQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKM 327

Query: 148 AILGNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRS 207
                 +DY GI  L+  SI++  F   +D+     L+  +++  G+    ++ S +F +
Sbjct: 328 RRRFACVDYSGISILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDT 387

Query: 208 REWRPYRASLFVAFGLSALLPVIAG------ALHYGLKETWTRIQLEWVLLGGVFY---- 257
            E RP R   F+      +L  I        A    L    T   + W L+G VFY    
Sbjct: 388 PEARPLRIRFFMLLAAMGVLSFINASYLESWAYAVDLLSPITNKSIVWYLVGVVFYGSFI 447

Query: 258 ---ILGAVLYGIRFPE-------------------RMAPGC--------FDIW-----GH 282
                  V+   R P                    R  P C        F  W     G 
Sbjct: 448 PERFRTDVVVDDRIPTTFQLGTDLDIITKDKEIHFRHKPTCCHHPRKGIFSCWWVDYVGC 507

Query: 283 SHQLFHILVVVAALCHLRALLGAY 306
           SH  +HI VV+  + H +A++  +
Sbjct: 508 SHTFWHIFVVLGVVGHYKAIIDMF 531

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 106/238 (44%), Gaps = 20/238 (8%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLY--LHNESVNIYTHLLPGWCFLLVAVF-- 101
           ++P   R+N +I+ GY    K++   L    +   HNE+ NI++HLL    F  + +F  
Sbjct: 255 QLPFPWRENRYIINGYRFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 102 -NQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK--CHSLPVAILGNKLDYLG 158
               +++  E      Y++  LF L G  C++ S  +H F   C S+ +      +DY G
Sbjct: 315 PKSFIVQSPEVPPSAKYIVY-LFLLAGIKCMLASVFWHTFNGTC-SIKLRPKYCCVDYSG 372

Query: 159 IVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLF 218
           I  L+  SI++  F   +D+     ++  L++ FG     ++ S KF S E RP R   F
Sbjct: 373 ITILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFF 432

Query: 219 VAFGLSALLPVIAGALHYGLKETWTRIQLEWVL-----LGGVFYILGAVLYGIRFPER 271
           +      LL  + G   + +          W+         V+Y++G   YG   PER
Sbjct: 433 I------LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSIVWYLIGVFFYGSFIPER 484

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 114/248 (45%), Gaps = 23/248 (9%)

Query: 38  KRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLY---LHNESVNIYTHLLPGW- 93
           K R   + E+P   R+N++I+ GY    K  ++ + S+     +HNE+ NI+TH+L  + 
Sbjct: 240 KERHLHYYELPFPWRENKYIIHGYRFHDK-FYQLILSVFNWYGVHNETTNIWTHMLAAFY 298

Query: 94  -CFLLVAVFNQ--VVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK-CHSLPVAI 149
             +LL   F +  +V++         Y+ I +F   G  C+  S  +H F    S+ +  
Sbjct: 299 LIYLLTVDFQKTFIVLDTEHVPATTKYI-IYMFLGAGIKCMFASVFWHTFNGTTSIRLRP 357

Query: 150 LGNKLDYLGIVALVVTSIVSILFYGFHDYDL---YFWLFSGLTMAFGLACATVSLSNKFR 206
               +DY GI  L+  SI+S  +   +DY     ++ + SG+   FGL    ++ S KF 
Sbjct: 358 KFCCVDYTGITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLY---LNWSPKFD 414

Query: 207 SREWRPYRASLFVAFGLSALLPVIAGALHYGLKET---WTRIQLEWVLLGGVFYILGAVL 263
           S E RP R   FV       L  +      GL      ++ +  + V    ++YI+G   
Sbjct: 415 SPEARPLRIKFFVLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFF 470

Query: 264 YGIRFPER 271
           YG   PER
Sbjct: 471 YGSFIPER 478

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 106/233 (45%), Gaps = 10/233 (4%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL---HNESVNIYTHLLPGWCFLLVAVFN 102
           ++P   R+N +I+ GY     S  +CL S++     HNE++NI++HL      L +AVF 
Sbjct: 118 QLPFPWRENRYIIKGYRFY-DSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 103 QVVIEKFETTRL--IDYVMIDLFFLGGFTCLMMSSVFHCFK-CHSLPVAILGNKLDYLGI 159
               E +++  +     +++ +F + G  C++ S  +H F    S  +      +DY GI
Sbjct: 177 YPNTEVYQSELIPTTAKMLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCCVDYTGI 236

Query: 160 VALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFV 219
             L+  SI++  +       ++ +++  L++A G     ++ S KF   E RP R   FV
Sbjct: 237 TILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRIKFFV 296

Query: 220 AFGLSALLPVIAGALHYGLKET-WTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
                  L  +       L+   W    +  +    ++Y++G   YG   PE+
Sbjct: 297 TLSAMGCLSFVHLIFTTSLRHACWLLAPI--ISKSTIWYVIGVFFYGSFIPEK 347

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 114/237 (48%), Gaps = 17/237 (7%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL---HNESVNIYTHLLPGWCFLLVAVFN 102
           E+P+  R+N +I+ G+     S  + L S+L +   HNE++NI++H+      L + +  
Sbjct: 244 ELPQPWRENPYIIYGHRF-YHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 103 QVVIEKFETTRL--IDYVMIDLFFLGGFTCLMMSSVFHCFK--CHSLPVAILGNKLDYLG 158
               + F +T++  +    I +F L G  C++ S ++H F   CH LP+    + +DY G
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCH-LPLRSRFSCVDYTG 361

Query: 159 IVALVVTSIVSI-LFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASL 217
           I  L+  S+++   F  +       +L+ G+++  G+  A  + S +F   + R +R + 
Sbjct: 362 ITILITASVMTTEAFTLYRLAPKAMYLYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAF 421

Query: 218 FVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGG---VFYILGAVLYGIRFPER 271
           +V      L+  +    H  +   W+  +L    L     V+Y++G V Y    PER
Sbjct: 422 YVILAGLGLISFV----HLTVHSDWSSSRLMITPLINKSIVWYLIGVVFYATLVPER 474

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 131/312 (41%), Gaps = 56/312 (17%)

Query: 39  RRLYTWDEIPEWQRDNEHIVGG---YILETKSTWECLKSLLYLHNESVNIYTHLLPGW-- 93
           R L+ W E+P   R+N +I+ G   Y    KS    L +  + HNE++NI++HL+     
Sbjct: 103 RHLHYW-ELPYAWRENRYIIYGHRFYHSHRKSLLSVLNAYGW-HNETINIWSHLVGAAVL 160

Query: 94  CFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK--CHSLPVAILG 151
            +LL   + +  + +      +    I  F   G  C+  S  +H F   CH L +    
Sbjct: 161 AYLLCWGWPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCH-LKLRSRF 219

Query: 152 NKLDYLGIVALVVTSIVS---ILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSR 208
             +DY GI  LV  S+V+   +  YG     +Y ++ +  ++  G A   ++ S  F   
Sbjct: 220 VCVDYTGITLLVTASVVTTVAVTLYGLSRPLMYAYMVA--SIGLGTAAGVMNWSPHFDRP 277

Query: 209 EWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLL--GGVFYILGAVLYGI 266
           E RP R +++V  GL+AL   +   +H  ++  W    L   L+    V+Y +G V Y  
Sbjct: 278 EARPLRIAVYV--GLAAL--GLVSFVHVWMQVRWASAHLMAPLVYKSLVWYGIGVVFYAT 333

Query: 267 RFPERM--------------APGC---------------------FDIWGHSHQLFHILV 291
             PER                  C                      D + HSH L+H+ V
Sbjct: 334 LVPERWRSDVTLDCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHVFV 393

Query: 292 VVAALCHLRALL 303
           V+  + H RA+L
Sbjct: 394 VLGVVGHYRAVL 405

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 101/238 (42%), Gaps = 20/238 (8%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N  I+ GY           KSLL +      HNE+ NI+THL      L +A
Sbjct: 136 QLPFPWRENRFIIHGYRFYDSH----YKSLLSIVNWYGWHNETANIWTHLGGALYVLWLA 191

Query: 100 VFN--QVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK---CHSLPVAILGNKL 154
           V++  +  + + E   ++   ++ +F      C++ S   H F    C +L        +
Sbjct: 192 VYDFPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFAC--V 249

Query: 155 DYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYR 214
           DY GI  L+  SI++  F   ++Y      +  ++   G+    ++ S KF   E RP R
Sbjct: 250 DYSGITMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLR 309

Query: 215 ASLFVAFGLSALLPVIAGALHYGLK-ETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
              F+       L  +   L  G K  +W    +    L  V+Y+LG   YG   PER
Sbjct: 310 IKFFILLAAMGGLSFMQLGLLGGWKYASWLMAPVTHKSL--VWYLLGVAFYGSFVPER 365

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 124/287 (43%), Gaps = 40/287 (13%)

Query: 13  EVELHHRMVEEN----SSLLK----DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILE 64
           +V+L  +++ E+    ++L+K    D+  K    R L+ + E+P   R+N  I+ GY   
Sbjct: 199 QVDLKGQVLPEDPDAVAALIKFHNYDTAFKLGQHRHLHYY-ELPFPWRENRFIIHGYRFY 257

Query: 65  TKSTWECLKSLLYL------HNESVNIYTHLLPGW--CFLLVAVFNQVVIEKFETTRLID 116
                   KSLL +      HNE+VNI+THL       +LL   F+Q  + + E      
Sbjct: 258 NSYK----KSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRGFSQTAVYQSELVPTAA 313

Query: 117 YVMIDLFFLGGFTCLMMSSVFHCFK--CHSLPVAILGNKLDYLGIVALVVTSIVSILFYG 174
             M  +F L G  C + S V+H F   CH L        +DY GI  LV  SI++  F  
Sbjct: 314 KCMAFVFLLSGLECFLFSVVWHTFNGICH-LQQRSNCACVDYTGITILVTASILTTEFVT 372

Query: 175 FH-----DYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS---LFVAFGLSAL 226
                   +      F+  +   G+    ++ S KF   E RP R +   L  +FG  + 
Sbjct: 373 LSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPLRIAFYLLLASFGFFSY 432

Query: 227 LPVIAGALHYGLKETWTRIQLEWVLLGG--VFYILGAVLYGIRFPER 271
           L   +   H  +  +    +L   +L     +Y++G V YG   PER
Sbjct: 433 L--HSRIFHTSISSS----ELIKPVLSKSLAWYLIGVVFYGTFIPER 473

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 108/238 (45%), Gaps = 20/238 (8%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+  Y           KSLL +      HNES NI+THLL     + ++
Sbjct: 254 QLPFPWRENRYIIYNYRFYDSHK----KSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLS 309

Query: 100 VFNQVVIEKFETTRL--IDYVMIDLFFLGGFTCLMMSSVFHCFKCHS-LPVAILGNKLDY 156
           +++    E F++ ++     +++ LF      CL+ S  +H F   S L +      +DY
Sbjct: 310 IYDFPNSEIFQSEKVPTTAKLIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDY 369

Query: 157 LGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS 216
            GI  L+  SI++  F   +       ++  ++++ G+    ++ S KF   E RP R  
Sbjct: 370 SGITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIK 429

Query: 217 LFVAFGLSALLPVIAGALHYGLK-ETW--TRIQLEWVLLGGVFYILGAVLYGIRFPER 271
            F+      +L  +       L+  TW  T +  + +    V+Y++G V YG   PER
Sbjct: 430 FFILLASMGVLSFLHLTYLTNLQYATWLLTPVTNKSI----VWYLVGVVFYGSFIPER 483

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 103/240 (42%), Gaps = 24/240 (10%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+  Y           KSLL +      HNE+ NI+THL+ G   + +A
Sbjct: 220 QLPFPWRENRYIIYNYRFYDSHK----KSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMA 275

Query: 100 VFNQVVIEKFETTRL--IDYVMIDLFFLGGFTCLMMSSVFHCFK-CHSLPVAILGNKLDY 156
           V++    E F + ++     +++ LF      CL  S  +H F    +L +      +DY
Sbjct: 276 VYDFPRSEIFLSDKIPTTAKLIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDY 335

Query: 157 LGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS 216
            GI  L+  SI++  F   +       ++  ++++ G+    ++ S KF   E RP R  
Sbjct: 336 SGISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIK 395

Query: 217 LFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLL-----GGVFYILGAVLYGIRFPER 271
            FV      +L      LH      W      W+L        V+Y +G V YG   PER
Sbjct: 396 FFVLLASMGVL----SFLHLTFLTDWKYAT--WLLAPVTNKSIVWYCIGVVFYGSFIPER 449

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 109/239 (45%), Gaps = 22/239 (9%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+ GY      +    KSLL +      HNE+ NI++HLL     + +A
Sbjct: 220 QLPFPWRENRYIIHGYRFYNTHS----KSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLA 275

Query: 100 VFNQVVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFKCHS-LPVAILGNKLDY 156
           +++    E +  +++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 276 IYDFPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 335

Query: 157 LGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS 216
            GI  L+  SI++  F   +      + +  +++A G+    ++ S +F   E RP R  
Sbjct: 336 SGITILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIR 395

Query: 217 LFVAFG----LSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
            F+       LS L  +    LHY     ++ +  + V    V+Y++G V YG   PER
Sbjct: 396 FFILLATMGVLSFLHLIFLTDLHYA-ATLFSPVTYKSV----VWYLVGVVFYGSFIPER 449

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 103/235 (43%), Gaps = 14/235 (5%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+ GY      +    KSLL +      HNE+ NI++HLL     + +A
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHS----KSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLA 274

Query: 100 VFNQVVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFKCHS-LPVAILGNKLDY 156
           +++    E ++  ++      ++ +F      C++ S  +H F   S L +      +DY
Sbjct: 275 IYDFPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDY 334

Query: 157 LGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRAS 216
            GI  L+  SI++  F   +        + G+++A G+    ++ S +F   E RP R  
Sbjct: 335 SGITILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIR 394

Query: 217 LFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
            F+      +L  +       L+    R+         V+Y++G   YG   PER
Sbjct: 395 FFILLATMGVLSFLHLIFLTDLRYA-ARLFSPVTYKSVVWYLVGVAFYGSFIPER 448

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 106/241 (43%), Gaps = 26/241 (10%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+ GY      +    KSLL +      HNE+ NI++HLL     + +A
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTHS----KSLLSIINWYGWHNETSNIWSHLLGAMYIIYLA 274

Query: 100 VFNQVVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNK---L 154
           +++    E +    +      ++ +F      C++ S  +H F   S     L +K   +
Sbjct: 275 IYDFPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSF--LRLRSKFACV 332

Query: 155 DYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYR 214
           DY GI  L+  SI++  F   +        + G+++A G+    ++ S +F   E RP R
Sbjct: 333 DYSGITILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLR 392

Query: 215 ASLFVAFG----LSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPE 270
              F+       LS L  +    ++Y      +R+         V+Y++G V YG   PE
Sbjct: 393 IRFFILLATMGVLSFLHLIFLTDIYYA-----SRLFGPVTYKSVVWYLVGVVFYGSFIPE 447

Query: 271 R 271
           R
Sbjct: 448 R 448

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 108/234 (46%), Gaps = 12/234 (5%)

Query: 46  EIPEWQRDNEHIVGGYIL--ETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQ 103
           ++P   R+N++I+ GY      K ++  + +    HNE+ NI+THLL G   + +A ++ 
Sbjct: 209 QLPFPYRENKYIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHF 268

Query: 104 VVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFK-CHSLPVAILGNKLDYLGIV 160
                + + R+      ++ +F      C+  S  +H F   H L +      +DY GI 
Sbjct: 269 PHSNIWLSDRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGIT 328

Query: 161 ALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFV- 219
            L+  SI+++ F   +DY +    +   ++A G+   +++ S KF   E RP R   F+ 
Sbjct: 329 ILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFIL 388

Query: 220 --AFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPER 271
               G S+ + ++         +  T +  + V    V+Y++G   YG   PER
Sbjct: 389 LATVGCSSFIRLVFLTNWRYAADLLTPLTNKSV----VWYLIGVFFYGSFIPER 438

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 104/243 (42%), Gaps = 30/243 (12%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPGWCFLLVA 99
           ++P   R+N +I+ GY           KSLL +      HNE+ NI+THLL     + +A
Sbjct: 219 QLPFPWRENRYIIHGYRFYNTH----YKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLA 274

Query: 100 VFNQVVIEKFETTRLIDYV--MIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNK---- 153
           V++    E ++   +      ++  F      C++ S  +H F   S     LG +    
Sbjct: 275 VYDFPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSF----LGLRSKFA 330

Query: 154 -LDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRP 212
            +DY GI  L+  SI++  F   +        +  +++A G+    ++ S +F   E RP
Sbjct: 331 CVDYSGITILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARP 390

Query: 213 YRASLFVAFG----LSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRF 268
            R   F+       LS L  +    LHY +   W    +       V+Y++G V YG   
Sbjct: 391 LRIRFFILLATMGVLSFLHLIFLTDLHYAI---WLFSPV--TNKSVVWYLVGVVFYGSFI 445

Query: 269 PER 271
           PER
Sbjct: 446 PER 448

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 98/242 (40%), Gaps = 28/242 (11%)

Query: 46  EIPEWQRDNEHIVGGYILETKSTWECLKSLLYL------HNESVNIYTHLLPG------- 92
           E+P   R+N  I+ GY           KSLL +      HNE+ NI+THLL G       
Sbjct: 218 ELPFPWRENRCIINGYRFYNSHK----KSLLSIVNWYGWHNETSNIWTHLLGGLYILYLM 273

Query: 93  -WCFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHS-LPVAIL 150
            + F    VF    + K    +LI YV    F +    CL  S  +H F   S L +   
Sbjct: 274 FYQFPSSEVFMSEQVPK--AAKLITYV----FLIAAAKCLFSSVFWHTFNGTSLLRLRCK 327

Query: 151 GNKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREW 210
              +DY GI  L+  SI++  F   +        +  L+ A G+    ++ S KF   E 
Sbjct: 328 FACVDYSGISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEA 387

Query: 211 RPYRASLFVAFGLSALLPVIAGALHYGLK-ETWTRIQLEWVLLGGVFYILGAVLYGIRFP 269
           RP R   F+      +L  +       L   TW    +       V+Y++G V YG   P
Sbjct: 388 RPLRIKFFILLASMGILSFLHLTFITSLSHSTWLLSPI--TKKSVVWYLVGVVFYGSFIP 445

Query: 270 ER 271
           ER
Sbjct: 446 ER 447

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 106/257 (41%), Gaps = 19/257 (7%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYL--HNESVNIYT 87
           D   K    R L+ + E+P   R+N  I+ GY      T   L  L +   HNE+ NI+T
Sbjct: 221 DVAFKTGLSRHLHYY-ELPFPWRENRFIIHGYRFYHSHTKSLLSILNWYGWHNETTNIWT 279

Query: 88  HLLPGW--CFLLVAVFNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFK--CH 143
           HL       +L    F Q  +            M+ LF   GF CL+ S  +H F   C 
Sbjct: 280 HLFGSLYIAYLAFYEFPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTC- 338

Query: 144 SLPVAILGNKLDYLGIVALVVTSIVSILF---YGFHD---YDLYFWLFSGLTMAFGLACA 197
            L +      +DY GI  L+  SI++  F   YG  D     + F L   + ++  L C 
Sbjct: 339 KLHLRSKFACMDYTGITVLITASIMTAEFVSLYGNGDNPNSPVTFSLIFYMAVSSVLCCF 398

Query: 198 TV--SLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGV 255
            V  + S +F   E RP R + ++       L  +   L      +   I+   VL   V
Sbjct: 399 GVFMNWSPRFDRPESRPLRIAFYLLLAGMGFLAFLHLTLITNFAHSSWLIRP--VLDKSV 456

Query: 256 -FYILGAVLYGIRFPER 271
            +Y++G + YG   PER
Sbjct: 457 CWYLIGVIFYGSFIPER 473

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 100/213 (46%), Gaps = 15/213 (7%)

Query: 95  FLLVAVFNQV-VIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLP--VAILG 151
           F+L+  F  V ++ +  +T + DYV++++F         +++ F C  CH +       G
Sbjct: 107 FVLLVFFTDVYLVPRHVSTTMTDYVLLNVF---------LATAFQCAACHMVQCFTTTAG 157

Query: 152 NKLDYLGIVALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRS---R 208
           + L  + ++     S V++L+Y ++D   YF L +  T  + L  A V++++   +   R
Sbjct: 158 SVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTASNSPKR 217

Query: 209 EWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRF 268
           +W   R  L V   +   +P++ G L +G  +   R+    +L     Y++  V YG   
Sbjct: 218 QWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVFYGGTE 277

Query: 269 PERMAPGCFDIWGHSHQLFHILVVVAALCHLRA 301
            + +    F +  H+  L H+ +++ A   +RA
Sbjct: 278 KDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRA 310

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 15/91 (16%)

Query: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFET--------- 111
           Y+ ++KST +  +  L +      I  H+ P +  +L  + N     KFE          
Sbjct: 376 YVSKSKSTKKLFRRSLKM-----KIMDHIYPVYTTILSTLTNSKDSSKFENKIKGYIEKI 430

Query: 112 -TRLIDYVMIDLFFLGGFTCLMMSSVFHCFK 141
             RL D V    FF  G  C+++ S  H FK
Sbjct: 431 IARLSDEVPSTYFFQDGVDCIILPSPIHNFK 461

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 15/91 (16%)

Query: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFET--------- 111
           Y+ ++ +T + L+  L        I  H+ P +  +L  + N    +KFET         
Sbjct: 376 YVSKSNNTKKLLRRSL-----KNKIMDHIYPVYTTILSTLANSKDSKKFETKIKGYIEKI 430

Query: 112 -TRLIDYVMIDLFFLGGFTCLMMSSVFHCFK 141
            TRL D +    FF  G  C++  S  H FK
Sbjct: 431 ITRLSDEIPSTYFFQDGVDCIIQPSPVHNFK 461

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 15/91 (16%)

Query: 61  YILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAVFNQVVIEKFETT-------- 112
           Y+ ++K T +  +  L +      I  H+ P +  +L  + N    +KFE          
Sbjct: 376 YVSKSKGTKKLFRRSLKM-----KIMDHIYPVYTTILSTLTNSRDSKKFENKIKAYIEKI 430

Query: 113 --RLIDYVMIDLFFLGGFTCLMMSSVFHCFK 141
             RL D V    FF  G  C++  S  H FK
Sbjct: 431 IVRLSDEVPSTYFFQDGVDCIIQPSPIHNFK 461

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 10/69 (14%)

Query: 83  VNIYTHLLPGWCFLLVAVFNQVVIEKFET----------TRLIDYVMIDLFFLGGFTCLM 132
           + I  H+ P +  +L ++ +   ++KFE           TRL D +    FF  G  C++
Sbjct: 394 MKIMDHIYPVYTTILSSLTHSKDLKKFENKIKESIEKIITRLSDEIPSTYFFQDGVDCII 453

Query: 133 MSSVFHCFK 141
             S  H FK
Sbjct: 454 QPSPIHNFK 462

>NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}
          Length = 680

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 5/94 (5%)

Query: 30  DSNLKQRTKRRLYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHL 89
           D+N+   T   +   +++ + +  ++ I    IL   S    L  LLY   E  N    +
Sbjct: 174 DNNMSMNTSDGINNKEDLLQSKNCSKFIPATIILPGSSN---LNPLLYFTIEFDNTVATI 230

Query: 90  LPGWCFLLVAVFNQVVIEKFETTRLIDYVMIDLF 123
            P +  +L  VFN+  I  F+TTR + ++ ID+F
Sbjct: 231 EPEYGTMLKPVFNK--ISTFDTTRKLPFLKIDVF 262

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTR 244
           +++  G++       NK  +   + YRA+L+V  GL+++   ++GA  Y +++ WTR
Sbjct: 455 MSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGA--YAIEDWWTR 509

>Kpol_401.14 s401 complement(36313..40254) [3942 bp, 1313 aa] {ON}
           complement(36313..40254) [3942 nt, 1314 aa]
          Length = 1313

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 42/91 (46%), Gaps = 12/91 (13%)

Query: 180 LYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLK 239
           L F +F+GL + F L C  +  SN+F             + F L +  P +A A+++G+ 
Sbjct: 630 LGFPMFAGLMLDFSLFCPLLGSSNQF------------IILFELCSEFPPLAFAIYWGIG 677

Query: 240 ETWTRIQLEWVLLGGVFYILGAVLYGIRFPE 270
             +     +++ +     I   VL+ IR P+
Sbjct: 678 TIYMYWFAKYIGMIRQHIIRPGVLFFIRSPD 708

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.143    0.467 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,553,636
Number of extensions: 1360476
Number of successful extensions: 4684
Number of sequences better than 10.0: 86
Number of HSP's gapped: 4743
Number of HSP's successfully gapped: 87
Length of query: 315
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 206
Effective length of database: 40,982,805
Effective search space: 8442457830
Effective search space used: 8442457830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 66 (30.0 bits)