Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10978g6.28ON37737719540.0
Kwal_56.224596.28ON38337712681e-174
Ecym_30326.28ON37737911291e-153
TDEL0G044106.28ON38137910921e-148
SAKL0E01518g6.28ON37937910801e-146
Kpol_1037.236.28ON37837810471e-141
Suva_15.1726.28ON39837910321e-138
KLLA0C06204g6.28ON37737910171e-136
NDAI0C026506.28ON38939110131e-136
ZYRO0C07546g6.28ON37737910061e-135
YOL003C (PFA4)6.28ON3783799921e-133
Smik_15.1676.28ON3783799881e-132
CAGL0E02497g6.28ON3763799821e-131
Skud_15.1596.28ON3793809791e-131
NCAS0D021406.28ON3763809771e-130
TPHA0J003906.28ON3803809621e-128
ACL003C6.28ON3753789491e-126
KAFR0A051306.28ON3963978471e-111
KNAG0F029306.28ON3863858321e-108
TBLA0B004806.28ON3774074326e-49
NCAS0E013003.12ON3271622071e-17
KLTH0F19580g3.12ON3421271965e-16
TPHA0P015603.12ON3311691931e-15
CAGL0D02508g3.12ON332701912e-15
Kpol_1014.293.12ON326671902e-15
NDAI0G013403.12ON3351281903e-15
KNAG0K025703.12ON3281291893e-15
Ecym_20143.12ON3391481894e-15
KLLA0E02069g3.12ON325851877e-15
KAFR0A085903.12ON3311281851e-14
Kwal_55.221263.12ON3601711861e-14
TBLA0H001503.12ON3451281832e-14
TBLA0D040408.286ON3291421805e-14
TDEL0A003103.12ON329531797e-14
ZYRO0C03410g3.12ON327781762e-13
Skud_14.153.12ON3361611735e-13
NCAS0C029208.389ON374591735e-13
TPHA0C023608.389ON404591737e-13
Suva_14.153.12ON3302721718e-13
Smik_14.63.12ON3341041719e-13
ZYRO0C04092g8.389ON366591719e-13
YNL326C (PFA3)3.12ON3361281701e-12
SAKL0C13596g3.12ON333701701e-12
NCAS0B035908.286ON329771682e-12
SAKL0H13860g8.389ON3521241682e-12
KLTH0G13112g8.286ON3491231682e-12
TDEL0F051308.389ON359601673e-12
ZYRO0D06600g8.286ON330571663e-12
KLTH0F08668g8.389ON358581664e-12
KNAG0A027108.389ON354641647e-12
ADL197C3.12ON390651648e-12
TDEL0F041308.286ON328571639e-12
KAFR0H019808.389ON361591631e-11
CAGL0B01991g8.286ON3301291621e-11
SAKL0H16434g8.286ON555641641e-11
Skud_12.3218.389ON356591621e-11
Skud_4.3878.286ON3361671602e-11
Smik_4.7375.579ON3782531612e-11
Ecym_41788.389ON368551594e-11
TPHA0C010708.286ON3331631584e-11
Smik_12.3068.389ON359601576e-11
YLR246W (ERF2)8.389ON359591567e-11
KLLA0D18370g8.389ON355661559e-11
NDAI0J010008.286ON339761541e-10
CAGL0G08217g8.389ON326591531e-10
TBLA0H009208.389ON360591541e-10
NDAI0G022508.389ON389591542e-10
Kwal_23.33028.389ON353511532e-10
AGL125C8.389ON367601532e-10
KAFR0B053708.286ON3291681522e-10
Suva_10.3428.389ON356591504e-10
Suva_2.2898.286ON3351621495e-10
YDR126W (SWF1)8.286ON336621487e-10
Smik_4.3728.286ON3351561487e-10
Kpol_1033.168.286ON321571442e-09
Ecym_42828.286ON3401391433e-09
KLLA0F19690g8.286ON324621424e-09
Suva_2.6345.579ON3882411416e-09
Skud_4.7345.579ON3802581417e-09
Kwal_56.236978.286ON338571344e-08
YDR459C (PFA5)5.579ON3742531344e-08
AGR065W8.286ON326441326e-08
KNAG0H031108.286ON331571327e-08
KNAG0C028305.579ON3541051247e-07
TBLA0E028305.579ON386791249e-07
TDEL0A044405.579ON365591203e-06
NCAS0F013905.579ON374511184e-06
Kwal_47.183665.579ON356591175e-06
Ecym_41145.579ON372731176e-06
NDAI0H018905.579ON406641151e-05
KLTH0G04972g5.579ON367481132e-05
ZYRO0D13860g5.579ON3651361122e-05
SAKL0G06160g5.579ON364481123e-05
KLLA0D06149g5.579ON349951113e-05
Kpol_1004.575.579ON362571104e-05
KAFR0I011105.579ON370581095e-05
Smik_4.5155.626ON7641111017e-04
NDAI0H008505.626ON7861061000.001
CAGL0K06347g5.579ON35281970.002
ABR203W5.579ON35949940.004
YDR264C (AKR1)5.626ON76495940.005
Kpol_526.325.626ON77755940.005
Suva_2.4325.626ON76380940.005
NCAS0C052805.626ON75798930.007
Skud_4.5275.626ON76452920.010
TPHA0C003705.626ON759134910.012
KLTH0E02420g5.626ON73459890.018
KNAG0C062305.626ON752103880.031
YOR034C (AKR2)5.626ON74954870.039
KAFR0H005705.626ON75771840.072
KLTH0G04708g5.568ON671225840.072
AER388C5.626ON724131840.087
ZYRO0C11132g5.626ON75948830.11
CAGL0M08712g5.626ON76351820.14
TDEL0A049205.626ON750108820.16
KNAG0B031405.626ON68270810.17
TBLA0J008305.626ON73951790.31
Suva_8.875.626ON73049780.39
Smik_15.2135.626ON74460770.55
SAKL0G07326g5.626ON73751770.63
Ecym_13305.626ON739135712.7
ZYRO0A03058g3.264ON736128713.1
Skud_15.1995.626ON74143713.4
ACL040C7.281ON34259703.7
KLTH0F05896g1.224ON114698686.4
KLLA0E16721g5.626ON752141679.0
TPHA0B041901.113ON16883659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10978g
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   757   0.0  
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   493   e-174
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   439   e-153
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   425   e-148
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   420   e-146
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   407   e-141
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   402   e-138
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   396   e-136
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     394   e-136
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   392   e-135
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   386   e-133
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   385   e-132
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   382   e-131
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   381   e-131
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   380   e-130
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   375   e-128
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   370   e-126
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   330   e-111
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   325   e-108
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   171   6e-49
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    84   1e-17
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    80   5e-16
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    79   1e-15
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    78   2e-15
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    78   2e-15
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      78   3e-15
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    77   3e-15
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    77   4e-15
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    77   7e-15
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    76   1e-14
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    76   1e-14
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    75   2e-14
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    74   5e-14
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    74   7e-14
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    72   2e-13
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    71   5e-13
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     71   5e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    71   7e-13
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    70   8e-13
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    70   9e-13
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    70   9e-13
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    70   1e-12
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    70   1e-12
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      69   2e-12
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    69   2e-12
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    69   2e-12
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    69   3e-12
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    69   3e-12
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    69   4e-12
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    68   7e-12
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    68   8e-12
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    67   9e-12
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    67   1e-11
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    67   1e-11
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    68   1e-11
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    67   1e-11
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    66   2e-11
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    67   2e-11
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    66   4e-11
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    65   4e-11
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    65   6e-11
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    65   7e-11
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    64   9e-11
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    64   1e-10
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    64   1e-10
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    64   1e-10
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     64   2e-10
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    64   2e-10
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    64   2e-10
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    63   2e-10
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    62   4e-10
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    62   5e-10
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    62   7e-10
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    62   7e-10
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    60   2e-09
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    60   3e-09
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    59   4e-09
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    59   6e-09
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    59   7e-09
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    56   4e-08
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    56   4e-08
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    55   6e-08
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    55   7e-08
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    52   7e-07
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    52   9e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    51   3e-06
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    50   4e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    50   5e-06
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    50   6e-06
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    49   1e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    48   2e-05
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    48   2e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    48   3e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    47   3e-05
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    47   4e-05
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    47   5e-05
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    44   7e-04
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    43   0.001
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    42   0.002
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    41   0.004
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    41   0.005
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    41   0.005
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    41   0.005
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    40   0.007
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    40   0.010
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    40   0.012
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    39   0.018
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    39   0.031
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    38   0.039
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    37   0.072
KLTH0G04708g Chr7 (373469..375484) [2016 bp, 671 aa] {ON} simila...    37   0.072
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    37   0.087
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    37   0.11 
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    36   0.14 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    36   0.16 
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    36   0.17 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    35   0.31 
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    35   0.39 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    34   0.55 
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    34   0.63 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    32   2.7  
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    32   3.1  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    32   3.4  
ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON} S...    32   3.7  
KLTH0F05896g Chr6 complement(521903..525343) [3441 bp, 1146 aa] ...    31   6.4  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    30   9.0  
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    30   9.6  

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/377 (97%), Positives = 366/377 (97%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N           IHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTV 180
           PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTV
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTV 180

Query: 181 SLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240
           SLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK
Sbjct: 181 SLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240

Query: 241 LLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYDIK 300
           LLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYDIK
Sbjct: 241 LLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYDIK 300

Query: 301 ASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEWHN 360
           ASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEWHN
Sbjct: 301 ASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEWHN 360

Query: 361 DWGENLSDFGVDVDAET 377
           DWGENLSDFGVDVDAET
Sbjct: 361 DWGENLSDFGVDVDAET 377

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  493 bits (1268), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 227/377 (60%), Positives = 283/377 (75%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LKWPWLGIA+PS LIA+IGY SHYFIL NF S  QQ+WF+  L++IW+SYA AIF 
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            HQWKN C+KC  YKPERTHHCKTC QCVL MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTV 180
           PHFVRFL WV++TTSYLG +L +R F HW  R+TR +V   EL F+F+N PLNAF+ LT+
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTI 180

Query: 181 SLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240
            LL+ RC KNQFL GMTQIE WE +RIEN F N RL+PQL++NL E++ +D  +   A+K
Sbjct: 181 ILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIYGDDILNSPNAKK 240

Query: 241 LLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYDIK 300
           L++++ L+LE+I+NFPYD++I+ N + ++G + +  LP   P   G +F  NDLS YD  
Sbjct: 241 LINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYDTC 300

Query: 301 ASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEWHN 360
            +IEDKLLSLPWPPDGGRQ+    + ++S +E  SS GE  LR R  D RI++ RTEW+N
Sbjct: 301 HTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEWYN 360

Query: 361 DWGENLSDFGVDVDAET 377
           DWGENLSDFGVDV++ET
Sbjct: 361 DWGENLSDFGVDVESET 377

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  439 bits (1129), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/379 (53%), Positives = 278/379 (73%), Gaps = 6/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LKWPWLGIA+P FLIA+IGYS+  F+LQ F S  QQ+WF+FSLT+IW+SY  AI+ 
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            H+WKNYCKKC N+KPERTHHCKTC QCVL MDHHCP+TMNCVG+NNF
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRN-TRKFVHTSELCFLFVNAPLNAFILLT 179
           PHF+RFL W++ TT+YL +   +R +  W  R+ T + V   E+ FL +  P NAF+LLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237
           +S+L  RC+KNQ LNGMTQIE+WE DRIE++F+N RLVPQL+ NL+EL+P ++ D  +G 
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYP-NSLDGHKGE 239

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
             ++L+++++  ED++NFPYD D   N+ + MGP+ +W  P G+P   G  F  N+LS Y
Sbjct: 240 IDRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAY 299

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           +  +++ DKLLSLPWPPDG  +++  S++    +E+ +  GE  +R RS + R+++ RTE
Sbjct: 300 EHGSTLTDKLLSLPWPPDG--ERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTE 357

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W+NDWGENL+ FGVDVDA+
Sbjct: 358 WYNDWGENLAHFGVDVDAD 376

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  425 bits (1092), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 264/379 (69%), Gaps = 4/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LKWPWLGIA+P  L+++IGY  H+FIL NF S  +QLWF+ +L LIW+SY +AI+ 
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            ++WKNYCKKC NYKPER HHCKTC QCVL MDHHCPWTMNCVGHNNF
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WV++ T++L   L  R    W  RN   ++ H SEL FL +  PL+AF+LLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFP--EDTFDEGA 237
           +++L+ RC+ NQ  NGM+QIE+WE +R++ LF ++RLVP LI+   ++FP   +  +E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A +L  +K+L LED++NFPYD+D   N +  +G    W  P GRP+ +G  FV N++S+Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
             +AS ED LLSLPWPPDGGR ++     ++S++E+ +  GE  +R R  D+   + R +
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAG-PGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQ 359

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W NDWGENL DFGVDVD E
Sbjct: 360 WQNDWGENLEDFGVDVDTE 378

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  420 bits (1080), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 207/379 (54%), Positives = 268/379 (70%), Gaps = 3/379 (0%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M V+LKWPWLGIA+P FLI++IGY +HYFIL NF  T +QLWFEFSL +IW+SY  AI+ 
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N             +W+N+C KC+NYKPER HHCK C QCVLSMDHHCPWTMNCVGH NF
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRK-FVHTSELCFLFVNAPLNAFILLT 179
            HF+RFL WV+ TTS+L   L +R    W  R+    FVH SEL FL +  P++AF+LLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDE-GAA 238
           +SLL+ RC KNQ L GMTQIESWE DRIEN+F + +L+P++++NLKE+ P    ++    
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298
           +KLLS  +L L++I+NFPYD++   N  +S+G +YSW LP G  +  G  F  N+LS Y+
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 299 IKASIEDKLLSLPWPPDGGRQK-SQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
            +  IEDKLLSLPWPPDGGR K     A+  + +E+ +  GE  +R R  D R ++PR +
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W+NDWGENL+DFGVD+D E
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  407 bits (1047), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 189/378 (50%), Positives = 260/378 (68%), Gaps = 2/378 (0%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LK+PW+GIA+P FLI++I Y++HYFIL NF S  +Q+WFE S+T+IW+SY  AI+ 
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            +QWKNYCKKC+ YKPERTHHCKTC+QCVL MDHHCPWTMNCVG+ NF
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WV++TT+YL   L  R    W SRN   ++ + SE+ FL +  P++ F+LLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE-DTFDEGAA 238
           +SLL  RC  NQ L+G TQIE+WE +R+E+LF+  RL PQLI NL E  PE  T D  A 
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298
            + + SK++  + +++FPYD+ ++ N+ + +G   +W    G P  +G  F  N+ S ++
Sbjct: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300

Query: 299 IKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEW 358
             + +ED++LSLPWPPDGG+          +++ET +  GE  +R RS  S++   RT+W
Sbjct: 301 EDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQW 360

Query: 359 HNDWGENLSDFGVDVDAE 376
           +NDWGENL DFGVD+D E
Sbjct: 361 YNDWGENLEDFGVDIDVE 378

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  402 bits (1032), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/379 (49%), Positives = 257/379 (67%), Gaps = 4/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M V+LKWPWLGIA+P+FLI++IGY +HYFIL NF S  +Q+ FE SL++IWVSY  AI+ 
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            + W NYCKKC NYKPER+HHCK C QCVL MDHHCPWTMNCVG  N+
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RF+ WV+ TT +L  +  +R    W  R+   ++   SEL FL +  PLN F+LLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237
           + +L  RC+ NQ +NG +QIESW+ DR+E+LF ++RL+ +LI+N   ++PE      E  
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A+KLL+  ++  E+++NFPY++D+  N    +GP++ W  PCG P  +G  F  ND+S Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           ++ +S+ED +LSLPWPPDGG+ K+  S      +ET + GGE  +R+R      S  R +
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTA-SNHSNLAIETCNEGGEQVVRSRIAQHGRSATREK 379

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W+NDWGE+L DFGVDVD E
Sbjct: 380 WYNDWGESLDDFGVDVDME 398

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  396 bits (1017), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 197/379 (51%), Positives = 256/379 (67%), Gaps = 5/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M ++LK  WLG+A+P+FL+A IGY SHYFIL NF S  +Q++++   T+IWVSY  AI+ 
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N             +W NYCKKC  YKPER HHCKTC QCVL+MDHHCPWT+NCVGH+NF
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVH--TSELCFLFVNAPLNAFILL 178
           PHF+RFL WV+ +T+YL  LL  R +  W+ R+T  F H  TSE+ F+ +  P++AF+LL
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHT-AFHHRSTSEIIFICIMTPMDAFVLL 179

Query: 179 TVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPED-TFDEGA 237
           TVS L+ RC+ NQ L+GMTQIESWE DRI++L +  RL+ Q+ID L E  PE     +  
Sbjct: 180 TVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHE 239

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
             KLLS + +  ED  NFPYDV+   N+ ++MGP Y W  P  +P   GT F  N+L  Y
Sbjct: 240 INKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFY 299

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           D  +SIED L+SLPWPPDG    S R+    S++ET  SGGE  +R++S D R  + R  
Sbjct: 300 DPNSSIEDMLMSLPWPPDGLTHHS-RALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNS 358

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W+NDWGE+LSDFGVD + E
Sbjct: 359 WYNDWGEDLSDFGVDTELE 377

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  394 bits (1013), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/391 (48%), Positives = 264/391 (67%), Gaps = 17/391 (4%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M ++LK+PWLG+A+PSF+I++IGY+SHYFIL NF S  +Q+WF+FSL++IWVSY  AIF 
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NXXXXXX----XXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVG 116
           N                 +W  +CKKC+NYKPER+HHCKTC QCVL MDHHCPWTMNCVG
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 HNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAF 175
           + NFPHF+RFL W+++TT +L + L +R    W  R+   ++   +E+ FL +  P++AF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 176 ILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPED---T 232
           ILLT+SLL  RC  NQ + GMTQIE WE +R+ENLF+N++L+P +I  L E++P +    
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 233 FDEGAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTN 292
            D  A   L   K++  E+I+NFPYD+DI  NM + MG  ++W    G P   G +F  N
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 293 DLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNR-SFDSRI 351
           ++S Y+  +S+ED LLSLPWPPD GR      ++  +++E+    GE  +RNR S D+ I
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGR---NFISNKDTSVESLVYDGEQVVRNRASNDTNI 357

Query: 352 S-----VPRTEWHNDWGENLSDFGVDVDAET 377
           S     + R EW+NDWGE+L DFGVD++AE 
Sbjct: 358 STINKDISREEWNNDWGESLVDFGVDIEAEV 388

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  392 bits (1006), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/379 (50%), Positives = 257/379 (67%), Gaps = 5/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LKWP+LGIA+P FLI++IGY++HYFIL NF ST +Q+WFEFSLT+IW SY  AI+ 
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
                        + WK+YCKKC NYKPER HHCKTC QCVL+MDHHCPWT NCVG+ NF
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WV+ TT YL   L  RA+   ++ N+  ++ + SEL FL +  P++ FILLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD--EGA 237
           +S+L  RC+ NQ   G TQIE+WE +R+E L++++RL+P L+ N  EL+PE      E  
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A +L + +++ L+ ++NFPYD+D   N    +G    W  P G+P+ +G  F  ND+S++
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           + + ++ D LL+LPWPPDGG+ K   S D  + +ET    GE  +R R  D R    RT+
Sbjct: 301 E-ETNLTDMLLALPWPPDGGKDKVI-SIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQ 358

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W N WGENL DFGVDVDAE
Sbjct: 359 WQNTWGENLEDFGVDVDAE 377

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/379 (48%), Positives = 256/379 (67%), Gaps = 4/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+L+WPWLGIA+P+FLI++IGY +HYFIL NF S  +Q+ FEF L++IW+SY  AI  
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N              W+N+CKKC +YKPER+HHCKTC QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRK-FVHTSELCFLFVNAPLNAFILLT 179
           PHF+RFL W+++TTS L  +  +R +  W  R+    F   SEL FL +++PLN+F+LLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGA 237
           +++L  RC+ NQ LNG +QIESW+ DR+E+LF + RL  +LIDN   ++PE     ++  
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A++ L+ K+   ++++NFPYD D+  N    +GPI+ W  P G P  +G  F  N +S Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           +  +S+ED +LSLPWPPDGG+  +  +   +ST+E  +  GE  +R R   +     R +
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHG-SSTIEMRNESGEQLIRTRLPQNGRHASREK 359

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W+NDWGE+L DFGVDVD E
Sbjct: 360 WYNDWGESLDDFGVDVDME 378

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  385 bits (988), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 185/379 (48%), Positives = 251/379 (66%), Gaps = 4/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M V+L+WPWLGIA+P+ LI++IGY +HYFIL NF    +Q+ FEFSL++IW SY  AI+ 
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N              W N+CKKC NYKPER+HHCKTC QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL W+++TTS L  +  +R    W  RN   ++   SEL FL + +PLN F+LLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGA 237
           +++L  RC+ NQ +NG +QIESW+ DR+E+LF + RL+ +LI N   ++PE      E  
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A+ LL  ++   E ++NFPY+ D+  N    +GP++ W  P G P   G  F  ND+S+Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           ++ + +ED +LSLPWPPDGG + +  S    ST+ET + GGE  +R+R   +  S  R +
Sbjct: 301 EVDSPLEDIILSLPWPPDGG-ETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREK 359

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W NDWGE+L DFGVDVD E
Sbjct: 360 WFNDWGESLDDFGVDVDME 378

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  382 bits (982), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 188/379 (49%), Positives = 250/379 (65%), Gaps = 6/379 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LKWPWLGIA+PSFLIA IGY +HYFIL NF S  +QLW++F  T+IW+SY  AI+ 
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
                        ++WK YCKKC  YKPER+HHCKTC QCVL MDHHCPWTMNCVG+NNF
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WV++ T+ L + LT R    W  R++  ++ + SEL FL +  PLNAFILLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFP--EDTFDEGA 237
           +S+L+ RC+ NQ  NG +QIESWE DR+E L    +L+P LI+N+  +FP   +   E  
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A+ LL+ K+L L++++NFPYD+    N    +G    W  P   P+D+G  F  N+ S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           +   S+ D +L LPWPPD  +  +  S    S ++  S  GE  +R R+ + ++S  R+E
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEH-TSNVQIISEEGEQVIRIRTPEKKLS--RSE 357

Query: 358 WHNDWGENLSDFGVDVDAE 376
           W NDWGE+L DFGVDVD E
Sbjct: 358 WLNDWGESLEDFGVDVDVE 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  381 bits (979), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 183/380 (48%), Positives = 256/380 (67%), Gaps = 5/380 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M V+LKWPWLGIA+P+FLI++IGY +HYFIL NF S  +QL FE SL++IWVSY  AI+ 
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N              W N+CKKC +YKPER+HHCK C QCVL MDHHCPWTMNCVG  N+
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WV++TTS L  +  +R    W  R+   ++   SEL FL + +PL+ F+LLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE--DTFDEGA 237
           +++L  RC+ NQ +NG +QIESW+ DR+E+L  + +L+P+LIDN   ++PE   +  E  
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 238 AQKLLSSK-QLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSD 296
           A KLL+ + +   +++++FPY+ +   N    +GPI  W  P G P  +G  F  ND+S 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 297 YDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRT 356
           Y++ + +ED +LSLPWPPDG + K+  + +  ST+ET++ GGE  +R+R+        R 
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHN-NSTIETYNEGGEQIVRSRNAQHGSDAIRE 359

Query: 357 EWHNDWGENLSDFGVDVDAE 376
           +W+NDWGE+L DFGVDVD E
Sbjct: 360 KWYNDWGESLDDFGVDVDME 379

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  380 bits (977), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/380 (47%), Positives = 252/380 (66%), Gaps = 8/380 (2%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LK+PW+G+ +P  L ++IGYS+H F+L NF S   QLWF+ SLT++W+SYA AIF 
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N             +W ++CKKC  +KPER HHCKTC QCVL MDHHCPWTMNCVG  NF
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL WVV+TT +L   L +R    W  ++   ++   +E+ FL +  P++ F+L+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGA-- 237
           V+LL  RC+ NQ + G TQIESWE +R+ENL++ ++L+PQL+ NL E++P +   E    
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 238 AQKLLS-SKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSD 296
           A+KL    +++  E+I+ FPYD+DI  N  + +G    W    G P  +G  F  N+L+ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 297 YDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRT 356
           Y+  A+IED LLSLPWPPDGGR   Q+     + +E+ +  GE  +R R+F++  S  +T
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQQK---GTNVESITENGEQVIRQRNFENDNSYRKT 357

Query: 357 EWHNDWGENLSDFGVDVDAE 376
            W+NDWGENL DFGVDVD E
Sbjct: 358 -WNNDWGENLEDFGVDVDVE 376

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 185/380 (48%), Positives = 251/380 (66%), Gaps = 3/380 (0%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+ KWPW+GIA+P  LI++IGY SHY+IL+   S  +Q +FEFSLT+IWVSY  AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            H+W+N+CKKC+NYKPER+HHCKTC QCVL MDHHCPWTMNC+G NNF
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILLT 179
           PHF+RFL W++ TT +L     +R    W +RN   ++   SE+  LFV  PLN FILLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPE--DTFDEGA 237
           ++LL  RC+ NQ +NG TQIE WE DR+EN F+ ++L+PQLI NL EL+PE      +  
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDY 297
           A++L+  K +  + I+NFPYD+ I +N+ + +G    W  P G P   G  F  N+++ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 298 DIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTE 357
           D  +S+    L+LPWPPD GR  + ++ +  S +E  ++ GE  +RNR+      + R E
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 358 WHNDWGENLSDFGVDVDAET 377
           W N+WGENL DFGVDV+ E 
Sbjct: 361 WFNEWGENLEDFGVDVEMEN 380

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  370 bits (949), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/378 (48%), Positives = 241/378 (63%), Gaps = 5/378 (1%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M V +KWPWLG+A+P FLI++ GY +H+F+L NF S  + LWF+ SL++IW+SY  AI+K
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120
           N            ++W+NYC KC+ YKPERTHHCK C QCVL MDHHCPWTMNC+G    
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASR-NTRKFVHTSELCFLFVNAPLNAFILLT 179
                   W++ TT  L     +R    W +R  T   V   EL FL +  PL+AFILLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPED-TFDEGAA 238
           +SLL  RCVKNQ +NG TQIE+WE DRIENLF+++RL+PQL+ NLKE++P      E   
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298
           ++ LSS     +++INFPYD++   N+ + MG   +W  P G P+ +G  F  N++SDYD
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 299 IKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEW 358
              SI+DKLL+LPWPPD  R      +   S +E  + GGE  +R R     +  PR EW
Sbjct: 301 EATSIQDKLLALPWPPDDTRHGIAFPS--VSHVEKDTQGGEQVVRRRHVPIAVP-PRNEW 357

Query: 359 HNDWGENLSDFGVDVDAE 376
           +NDWGE+L  FGVDV+ E
Sbjct: 358 YNDWGESLEHFGVDVEVE 375

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  330 bits (847), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 176/397 (44%), Positives = 244/397 (61%), Gaps = 22/397 (5%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           M ++LKWPWLGIA+P+FLI++IGYS+HYFIL +  S   QLWF+FSL++IW+SY  AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NXXX-XXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNN 119
           +            I   + YCKKCD YKP R HHCKTC +C+L MDHHCPWTMNCVG  N
Sbjct: 61  DPGSPSIADKNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKN 120

Query: 120 FPHFVRFLTWVVLTTSYLGLLLTQRAFDHWAS-RNTRKFVHTSELCFLFVNAPLNAFILL 178
           +PHF+RFL WV++TT++L   L +R    W +  ++   V   E+  L +  P++AFILL
Sbjct: 121 YPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDAFILL 180

Query: 179 TVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNER-----LVPQLIDNLKELF----P 229
           T++LL+ RC  NQ  +GM+QIE WE +R+E+ F++ +      +  LI+N+  +F    P
Sbjct: 181 TITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFSIESP 240

Query: 230 EDTFDE-GAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTR 288
           ED  +E     +    ++L    IINFPYD+DIL N    +GP +SW  P G P  +G  
Sbjct: 241 EDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEGDGMH 300

Query: 289 FVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIAST-LETFSSGGEATLRNRSF 347
           F  N+++  +  +++ D LLSLPWPPD    K  +S D  +  +ET   GGE  LRNR+ 
Sbjct: 301 FELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLRNRTV 359

Query: 348 DSRISVP--------RTEWHNDWGENLSDFGVDVDAE 376
                +P        R  W N+WGENL  FGVD++ E
Sbjct: 360 SPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  325 bits (832), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 172/385 (44%), Positives = 229/385 (59%), Gaps = 16/385 (4%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60
           MPV+LK PW GIA+P  LI +IGY +H+FIL+N  S  +Q+ F+F LT+IW+SY  AI+ 
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NXXX--XXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHN 118
           N                   YC KC+ +KPER+HHCKTC+QCVL MDHHCPWTMNC+G  
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 NFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTR-----KFVHTSELCFLFVNAPLN 173
           NFP F+RFL WV++TTS L   L  R    W +RN           T EL  L V  P++
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 174 AFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF 233
            F+L T++ L  RCV NQ + GMTQIESWE +R++N+F++++L+P +I+ + E FP +  
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 234 DEG--AAQKLLSSKQ---LELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTR 288
            E    A+KLL   +   L+   ++NFPYDVD+L N+  S+G       P    +  G  
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 289 FVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQ-RSADIASTLETFSSGGEATLRNRSF 347
           F  ND+S Y+   SI D LL L WPPDGGR+    +  D A  ++     GE  +R R  
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKR-- 358

Query: 348 DSRISVPRTEWHNDWGENLSDFGVD 372
           +S I   RT W N WGE L  FGVD
Sbjct: 359 NSPIE-SRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  171 bits (432), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 193/407 (47%), Gaps = 64/407 (15%)

Query: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIF- 59
           M +E   PW G+A+PS +I  +   S++ ILQ+  +T Q +W+  +  +I  SY  AI  
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 60  ----------KNXXXXXXXXXXXIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCP 109
                     ++           I       K      P R HHCKTC  CV+ MDHHCP
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLP-RAHHCKTCNTCVVMMDHHCP 119

Query: 110 WTMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTS---ELCFL 166
           WTMNCVG+ N+PHF+RFL WV+++T+ L   L ++A+  +  RN+   ++ +   ++  L
Sbjct: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIIL 179

Query: 167 FVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKE 226
            +  P   F+ LTV LL+ + ++NQ  NGMTQIE W+ + IEN +F  +     +     
Sbjct: 180 TLLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLL 239

Query: 227 LFPEDTFDEGAA-------QKLLSSKQ------LELEDIINFPYDVDILENMKSSMGPI- 272
               + +++  +       QKL+SS Q           IINFPYD+ +  N+ ++MG + 
Sbjct: 240 ENLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299

Query: 273 -----YSWCLPCGRPRDEGTRFVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADI 327
                  W  P     ++   F   D  D +   +I+D LL LPWP +     + +    
Sbjct: 300 PLSWFNPWYTPLTASYNKINEFAIWD--DNETHDNIKDMLLCLPWPLNYSNNSTFQD--- 354

Query: 328 ASTLETFSSGGEATLRNRSFDSRISVPRTEWHNDWGENLSDFGVDVD 374
                     GE  +++               ND+GE L DFGVD D
Sbjct: 355 ----------GELVVKS---------------NDYGETLQDFGVDYD 376

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 79/162 (48%), Gaps = 13/162 (8%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC TC +C+L MDHHCPW   C+G  N  +FV+FL +     S + L
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIYCT-AYSIVVL 159

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVK-NQFLNGMTQ 198
             T     +W S       +  EL  L +       I++TVSL+ F      Q L   T 
Sbjct: 160 FFTSCELHYWFSGKQ----YEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQTT 215

Query: 199 IESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240
           IE +   R       E+   +L+  L++   ++ FD G+ ++
Sbjct: 216 IEMYGMKR-------EKRDLELLRGLEDAEVDNIFDLGSRRR 250

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           +C+ C  +KP+R HHC  CK+C L MDHHCPW  +CVG+ N  +FV+FL +  +  S L 
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTV-FSILI 163

Query: 139 LLLTQRAFDHW--ASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGM 196
            LL+      W    R  ++ +    L    ++  ++  +L   S  V+   KNQ     
Sbjct: 164 FLLSGTELLLWFKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQ----- 218

Query: 197 TQIESWE 203
           T IE +E
Sbjct: 219 TTIEMYE 225

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 25/169 (14%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C+ +KP+R+HHC TC +CVL MDHHCPW   C+G  N   F++FL +   T +Y+  
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYNT-TYAYVIA 168

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKN----QFLNG 195
           +LT +   +W    +    + +E   +++   L  +IL  V  L   C         +N 
Sbjct: 169 ILTSKQMYNWFDDGS----YENEFVNMYL---LFLWILALVVSLALSCFAGFSVYMVMNN 221

Query: 196 MTQIESWE----KDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQK 240
            T IE +     +D +E    N   VP +         E+ FD G+ ++
Sbjct: 222 KTTIEMYAMRKYRDDLELYNRNPNRVPSV---------ENIFDLGSKKE 261

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 1/70 (1%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           CK C ++KP+R HHC TC  CVL MDHHCPW   CVG+ N   F++FL +  +  S L L
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV-YSILVL 164

Query: 140 LLTQRAFDHW 149
           +L+      W
Sbjct: 165 ILSSMEIYTW 174

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C+ +KP+R HHC  C +C+L MDHHCPW   CVG  N  +FV+FL   + TT Y  L
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFL---IYTTVYAIL 162

Query: 140 LLTQRAF 146
           ++T  +F
Sbjct: 163 VMTYTSF 169

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 66/128 (51%), Gaps = 3/128 (2%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC TC +C+L MDHHCPW   C+G  N   F++FL +  +  +++ L
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI-YAFVAL 167

Query: 140 LLTQRAFDHWASRNT--RKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMT 197
            L    F +W        +++  + L    +   ++  +L   S  +++ +KN+    M 
Sbjct: 168 GLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTIEMY 227

Query: 198 QIESWEKD 205
            I  + +D
Sbjct: 228 GIRRYNRD 235

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   CVG  N   F++FL +   TT+Y   
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLY---TTAYAIF 159

Query: 140 LLTQRAFDHWASRNTRKF---VHTSELCFLFVNAPLNAFILLTV--SLLVFRCVKNQFLN 194
           +L+  +   +      KF   + +  L FL++ + L  FI +T+  +  V + +KNQ   
Sbjct: 160 VLSMTSVQLYRWFYNDKFQEELISGYLLFLWIFS-LVVFIAMTLFSAFSVSQVLKNQTTI 218

Query: 195 GMTQIESWE 203
            M  ++ W 
Sbjct: 219 EMYGVQRWR 227

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 75/148 (50%), Gaps = 6/148 (4%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           YC  C  +KP+R+HHC +C +C L  DHHCPW  +C+G NN   FV+FL +  L +  + 
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 139 LLLTQRAFDHWASRN-TRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMT 197
           +  T +    + ++N T +++  + L    ++   +  +       ++   KNQ  N + 
Sbjct: 169 IAATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQTTNELN 228

Query: 198 QIESWEKDRIENLFFNERL--VPQLIDN 223
             +   +D +E   FNE L   PQ + N
Sbjct: 229 ASKYLNRD-LE--IFNESLGHSPQSVGN 253

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 50/85 (58%), Gaps = 5/85 (5%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           +C+ C+ +KP+R HHC  C +C L MDHHCPW  +CVG  N   FV+FL +  + + Y+ 
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYV- 162

Query: 139 LLLTQRAFDHWASRNTRKFVHTSEL 163
           LL+T      W     R+  + SEL
Sbjct: 163 LLMTSAQLYSWF----RQMKYKSEL 183

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 66/128 (51%), Gaps = 6/128 (4%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   C+G  N  +F++FL +   + S + L
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYCT-SYSIIVL 164

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKN-QFLNGMTQ 198
            +T     HW    + ++       F  +   L A I++ +SL++F      Q L   T 
Sbjct: 165 FVTSIQIYHWFRSTSYEYEFID---FKLLTVWLLA-IVIFISLVLFTGFSVFQLLGNQTT 220

Query: 199 IESWEKDR 206
           IE +   R
Sbjct: 221 IELYAYRR 228

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 81/171 (47%), Gaps = 32/171 (18%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY-- 136
           +C+ C  +KP+R HHC  C +C L MDHHCPW  +CVG+ N  +F+ FL +   TT+Y  
Sbjct: 132 FCRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY---TTAYSI 188

Query: 137 LGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAF----ILLTVSLLVFR------ 186
           L   LT      W     R   +  EL    +N PL       +++T+S+L F       
Sbjct: 189 LVFFLTGADLLMWF----RSQGYNQEL----INLPLLIVWILSLVITISMLAFTSYTIYL 240

Query: 187 CVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGA 237
             KNQ     T IE +E       + N+R +   +  L     ++ FD G+
Sbjct: 241 VAKNQ-----TTIEMYEWTN----YRNQRNIMDEVRGLDTFEDKNVFDLGS 282

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 67/128 (52%), Gaps = 6/128 (4%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C +C+L MDHHCPW   C+G  N  +F+ FL +  L  +++ L
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYNSLYATFVCL 165

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVK-NQFLNGMTQ 198
           + ++  ++ ++       +    L  LF+ +     ++ +VS+ +F      Q L   T 
Sbjct: 166 ISSKELWNWFSQEKYVTELINIHLLLLFIVS-----LITSVSMTLFTAYSIYQVLINRTT 220

Query: 199 IESWEKDR 206
           IE +   R
Sbjct: 221 IELYAYRR 228

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 66/142 (46%), Gaps = 16/142 (11%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           CK C   KP R+ HC  C QC+L  DHHC W  NC+G  NF +F  FL    L  SY  +
Sbjct: 137 CKTCKVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASM 196

Query: 140 LLTQRAFD-HWASRNTRKFVHTSEL---CFLFVNAPLNAFILLTVSLLVFRCVKNQFLNG 195
            L +   +   A  N  + V T ++   CFLF+    +   LL V             +G
Sbjct: 197 RLLEITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVK------------DG 244

Query: 196 MTQIESWEKDRIENLFFNERLV 217
           MT  E  +   I+ L  +++LV
Sbjct: 245 MTTNEKDKWYTIQCLMEDKKLV 266

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVL 132
           C+ C  +KP+R HHC  C +C+L MDHHCPW  +CVG  N  +F++FL +  L
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATL 160

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 46/78 (58%), Gaps = 3/78 (3%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC  C +C+L MDHHCPW   C+G NN   F+++L +   T S +  
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYAT-TYSIVIF 165

Query: 140 LLTQRAFDHWASRNTRKF 157
           L +     HW   NT+++
Sbjct: 166 LFSSIQLLHWF--NTKQY 181

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 73/161 (45%), Gaps = 11/161 (6%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C  C+L MDHHCPW   C G  N   F++FL +   TT Y  L
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMY---TTFYAFL 162

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVK-NQFLNGMTQ 198
           +L    ++     N+  F  + EL  L +       I + +S+L F      Q  N  T 
Sbjct: 163 VLIDTCYELGTWFNSGSF--SRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQTT 220

Query: 199 IESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQ 239
           IE     R       E L      N +   PE+ FD G++ 
Sbjct: 221 IELHSMRRYRRDL--EILNDSYGTNTQ---PENIFDLGSSM 256

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YCK C  ++P R+ HC  C+ CVL  DHHC W  NCVG  N+ +F+ FLT   LT+ +L
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFL 241

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 39/59 (66%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC+ C  ++P R+ HC  C  CV+S+DHHC W  NCVG  N+ +F+ FLT  ++T  +L
Sbjct: 195 YCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFL 253

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 114/272 (41%), Gaps = 50/272 (18%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C  C+L MDHHCPW   C G  N   F++FL +   TT Y  L
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY---TTFYAFL 162

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVK-NQFLNGMTQ 198
           +L    ++     ++  F +   + F  +   L A I + +S+L F      Q  N  T 
Sbjct: 163 VLIYSCYELGTWFHSGSF-NQELIDFHLLGVALLA-IAIFISVLAFTAFSIYQVCNNQTT 220

Query: 199 IESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKLLSSKQLELEDIINFPYD 258
           IE           +  R   + ++ + + +  DT               +LE+I +    
Sbjct: 221 IE----------LYGMRRYRRDLEIINDTYGADT---------------QLENIFDLGSS 255

Query: 259 VDILENMKSSMGPIY-SWCLPCGRPRDEGTRFVTNDLSDY-DIKASIEDKLLSLPWPPDG 316
           +    N +  MG  +  W LP    + + ++   ++   Y DI+   +D+LLS      G
Sbjct: 256 I---ANWQDLMGMSWLEWLLPIETYKYKRSKHTKDEKGLYFDIRPEAQDRLLS----SRG 308

Query: 317 GRQKSQRSADIASTLETFSSGGEATLRNRSFD 348
              +  R      +LET          NRSF+
Sbjct: 309 LEDRLMRRVTPRPSLET----------NRSFE 330

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 14/104 (13%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C  CVL MDHHCPW   C G  N   F++FL +   TT Y  L
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFL 162

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLL 183
           +L    ++     N+  F           N  L  F LL V+LL
Sbjct: 163 VLIYTCYELGTWFNSGSF-----------NRELIDFQLLGVALL 195

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R  HC TC+ C+L+ DHHC W  NC+G  N+ +F+ FL   +L++ +L
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFL 238

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R HHC +C  C+L MDHHCPW   C G  N   F++FL +  L  ++L L
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMYTTL-YAFLVL 164

Query: 140 LLTQRAFDHWASRNT--RKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMT 197
           + T      W +  +  R+ +    L    +   +   +L      +++  KNQ    + 
Sbjct: 165 IYTCYELGTWFNSGSFNRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKNQTTIEVH 224

Query: 198 QIESWEKD 205
            +  + +D
Sbjct: 225 GMRRYRRD 232

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C  +KP+R+HHC +C +C L MDHHCPW  +C+G  N   F++FL +   TT Y   
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLY---TTWYAVF 161

Query: 140 LLTQRAFDHW 149
           +        W
Sbjct: 162 VFMTTGLQLW 171

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (55%), Gaps = 2/77 (2%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLT--WVVLTTSYL 137
           C+ C +YKP R+ HC  C +CVL  DHHC W  NCVG  N+ +F  FL      LT +++
Sbjct: 137 CRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFI 196

Query: 138 GLLLTQRAFDHWASRNT 154
            LL      + +  +NT
Sbjct: 197 RLLTIFYTTNVYLPKNT 213

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           YC  C  ++P R  HC TC+ C+++ DHHC W  NC+G  N+ +F  FL   V+ T+++ 
Sbjct: 171 YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFI- 229

Query: 139 LLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLV----FRCVKNQFLN 194
                    + A R +R  VH  +       AP+   +L+   L+V       V + FL 
Sbjct: 230 -------IANCAIRVSRS-VHAKD-------APVAILLLIYCGLVVCYPFILLVYHIFLT 274

Query: 195 GMTQ 198
           G  Q
Sbjct: 275 GSQQ 278

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 55/123 (44%), Gaps = 18/123 (14%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY--L 137
           C+ C   K  RT HC  C QCV   DHHC W  NC+G  N+ +F  FL   V  T+Y  L
Sbjct: 133 CRTCKLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFL 192

Query: 138 GLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMT 197
            LL  QR            FVH+ +L  L +       IL   S   F  V+    +GMT
Sbjct: 193 RLLFLQR------------FVHSRQLLILSILLGCFGVILAVFSYFQFVLVR----DGMT 236

Query: 198 QIE 200
             E
Sbjct: 237 TNE 239

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 35/60 (58%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
            YC  C  ++P R  HC TC  CV++ DHHC W  NCVG  N+ +F+ FL   VL   +L
Sbjct: 179 RYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFL 238

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 35/57 (61%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           C+ C   KP R+ HC  C QCVL++DHHC W  NCVG  N+ +F  FL    L+ SY
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSY 191

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTS 135
            YC  C  ++P R  HC TC+ CVL+ DHHC W  NC+G  N+ +F+ FL    L T+
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           H    YC  C  ++P R  HC+ C+ CV + DHHC W  NCVG  N+ +F+ FLT    T
Sbjct: 180 HVEVKYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCAT 239

Query: 134 TSYL 137
            + L
Sbjct: 240 CTVL 243

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 38/65 (58%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
            YC KC  +KP+R HHC  C +C L  DHHC W   C+G+NN   F+ FL +  +   ++
Sbjct: 169 RYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWI 228

Query: 138 GLLLT 142
            ++ T
Sbjct: 229 CIITT 233

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           C+ C   KP R+ HC  C++CVL  DHHC W  NC+G  N+  F  FL   V++ SY
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSY 194

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC+ C  ++P R  HC  C+ CV++ DHHC W  NCVG  N+ +FV FL    L + +L
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFL 235

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 58/129 (44%), Gaps = 13/129 (10%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C   KP R+ HC  C  C+   DHHC W  NCVG  N+ +F  FL   +L  SY  +
Sbjct: 136 CRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFI 195

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAF--ILLTVSLLVFRCVKNQFLNGMT 197
            L    F+  A   T     T E   L ++    +F  IL      VF  V     +GMT
Sbjct: 196 RLIFIQFNKSAYNTTP----TGEKSLLILSILCGSFTVILAVYCYFVFELVN----SGMT 247

Query: 198 QIESWEKDR 206
              + EKD+
Sbjct: 248 ---TNEKDK 253

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 36/64 (56%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C   KP R+ HC  C +C+L +DHHC W  NC+G  N+ +F  FL   V   SY  L
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFL 191

Query: 140 LLTQ 143
            LT 
Sbjct: 192 RLTS 195

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC+ C  ++P RT HC TC  CV+  DHHC W  NCVG  N+  F+ FL   + ++ +L
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFL 232

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 74/167 (44%), Gaps = 12/167 (7%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C  C   KP R+ HC  C +C+L  DHHC W  NC+G  N+  F  FL   +++ SY  L
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFL 195

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQI 199
            L   +    ++   R  +  S LC  F    +   I   + L + R        GMT  
Sbjct: 196 RLCSISLKS-STALPRAVLTLSILCGCFT---IICAIFTYLQLAIVR-------EGMTTN 244

Query: 200 ESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKLLSSKQ 246
           E  +   I+      +LV  L D+ +  F + T ++G A + L  +Q
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLT-EKGDAAEPLQDQQ 290

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 102/253 (40%), Gaps = 47/253 (18%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           +C  C + K ER+HH      C+   DH+C W    +G +N+  FV+F      T  +  
Sbjct: 130 WCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF------TGYFSS 183

Query: 139 LLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQ 198
           LLL          RN  +  H         N+PLNA + LT++  +F         G   
Sbjct: 184 LLLIMWVSICVFIRNITQHHHNH-------NSPLNANVFLTLAFAIF---------GWLF 227

Query: 199 IESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGAAQKLLSSKQLELEDIINFP 256
             S     I  +  N+  +  ++D+ ++ F           A KL    + E  +  +F 
Sbjct: 228 TTSMLASNIFYMCQNKTYLEAIMDSKRKNFGTRKIFCYYSEANKLRFVVEFERTEFHSFW 287

Query: 257 YDVDILENMKSSMGP-IYSWCLPCGRP-------RDEGTRFVTND--------------L 294
               I  N+K  MGP +  W +P G+P        D+G  F + +              L
Sbjct: 288 SKKTIFANIKDFMGPNMLMWLIPFGKPLSFSCKSNDKGRPFRSGERTTLAEILGPYEEFL 347

Query: 295 SDYDIKASIEDKL 307
           SDY I+A IEDK+
Sbjct: 348 SDYTIQA-IEDKI 359

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           YC  C  ++P R  HC TC  C+++ DHHC W  NCVG  N+ +F+ F+   VLT
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLT 242

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 69/163 (42%), Gaps = 10/163 (6%)

Query: 73  IHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVL 132
           I+   N C  C+  KP R+ HC  C  C+L  DHHC W  NC+G  N+ +F  FL    +
Sbjct: 132 IYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTI 191

Query: 133 TTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQF 192
           + SY  L L        +  +  K  +   LC L  +  +       +  + F     Q 
Sbjct: 192 SLSYAFLRLLHITL---SKPDVPKSKNILALCILTGSFSV-------ICGVFFYLQMKQV 241

Query: 193 LNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDE 235
            NGMT  E+ +   ++ L    +L+    +N   L  ED  D 
Sbjct: 242 NNGMTTNETDKWYAVQELMREGKLIKSEDNNWFALSTEDAPDS 284

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 36/60 (60%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
            YC+ C  ++P R+ HC TC  CV+  DHHC W  NC+G  N+  F+ FL   V+++  L
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIIL 232

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R+ HC TC  CV+  DHHC W  NC+G  N+  F+ FL   +L++  L
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVIL 232

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           YC+ C  ++P R+ HC  C  CVLS DHHC W  NC+G  N+  F+ FL    ++   L 
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLI 232

Query: 139 LLLTQR 144
           LL + R
Sbjct: 233 LLSSFR 238

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL--TWVVLTTSYL 137
           C+ C   KP R+ HC+ C  C+L  DHHC W  NC+G  N+ +F  FL    + +T S++
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 138 GLLLTQRAFDHWASRN 153
            L L        +SRN
Sbjct: 199 RLFLMYCQGHAPSSRN 214

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (57%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R  HC  C+ CVL+ DHHC W  NCVG  N+ +F+ FL    L  + L
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALL 217

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R  HC  C+ C+   DHHC W  NCVG+ N+ +F+ FL   +L++ ++
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFI 247

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R+ HC  C+ C+++ DHHC W  NC+G  N+  F+ FL     T+ +L
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFL 274

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLT 128
            YC  C  ++P R  HC  C  C+L+ DHHC W  NC+G  N+ +F+ FL 
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 35/60 (58%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
            YC  C  ++P R  HC  C  C+LS DHHC W  NC+G  N  +F+ FL   VL++ +L
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWL 244

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 70/168 (41%), Gaps = 15/168 (8%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
            +C  C   KP R+ HC  C +CVL  DHHC W  NC+G  N+ +F  FL    L   Y 
Sbjct: 135 TFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYA 194

Query: 138 GL-LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGM 196
            L ++   A+      N         L FL ++    A ILL  + L F  V     +GM
Sbjct: 195 FLRIILLTAYSDIGFPNI-------VLTFLILSGAFFA-ILLVFTYLQFALVY----DGM 242

Query: 197 TQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKLLSS 244
           T  E  +   I+      RL+    DN + L        G A +  S+
Sbjct: 243 TTNEKDKWFTIQEFMREGRLIRT--DNGQWLIAHPEEPAGQATRFYST 288

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           YC  C  ++P R+ HC TC  CV+  DHHC W  NC+G  N+  F+ FL   + ++  L
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILL 232

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 66/162 (40%), Gaps = 11/162 (6%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C  C   K  R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + + SY  L
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFL 195

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQI 199
            L   +F+  A    R  +  + LC  F        I    + L    VK     GMT  
Sbjct: 196 RLYFISFNSTAVL-PRAVLTLTILCGCF------TIICAIFTYLQLAIVK----EGMTTN 244

Query: 200 ESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGAAQKL 241
           E  +   I+      +LV  L D+ +  F + T      Q L
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTEKGDTGQPL 286

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 32/62 (51%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C  C   KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + +  Y  L
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195

Query: 140 LL 141
            L
Sbjct: 196 RL 197

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 66/156 (42%), Gaps = 11/156 (7%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C  C   KP R+ HC  C +C+L  DHHC W  NC+G  N+  F  FL   + +  Y  L
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFL 195

Query: 140 LLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQI 199
            L   + +   +   R  +  + LC  F    +   I   + L + R        GMT  
Sbjct: 196 RLWCISLNS-KTALPRAVLTLTILCGCFT---IICIIFTYLQLTIVR-------EGMTTN 244

Query: 200 ESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDE 235
           E  +   I+      +LV  L DN +  F + T D+
Sbjct: 245 EQDKWYTIQEYMREGKLVRSLNDNCQSWFLKLTEDD 280

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 31/57 (54%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           CK C   KP R+ HC  C +C+L  DHHC W  NC+G  N+  F  F+    LT  Y
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIY 191

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 62/139 (44%), Gaps = 13/139 (9%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C   K  R+ HC  C +C+L  DHHC W  NC+G  N+ +F  FL       SY  +
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATI 192

Query: 140 LLTQRA-FDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQ 198
            L+  A    W S  +   +     CF        A I ++ + + F  V+    +GMT 
Sbjct: 193 RLSSVAPSGLWRSNKSFLSLMILVCCF--------AVISISFTYMQFALVR----DGMTT 240

Query: 199 IESWEKDRIENLFFNERLV 217
            E  +   I  L  NE+L+
Sbjct: 241 NEKDKWYTIHKLMRNEQLL 259

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139
           C+ C   K  R+ HC  C++C+   DHHC W  NCVG+ N+ +F  FL    L  +Y  L
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASL 188

Query: 140 LL 141
            L
Sbjct: 189 RL 190

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 90/241 (37%), Gaps = 56/241 (23%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           H +  +C  C + K ERTHH      CV   DH+C W    +G +N+  FV+F+T+    
Sbjct: 131 HGYPIWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTYFSSL 190

Query: 134 TSYLGLL-------LTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFR 186
              + L        +TQR   H                    N PLN  ++LT++L +F 
Sbjct: 191 LLLMWLSICVYIRDITQRHRGH--------------------NPPLNVNVILTLALALFG 230

Query: 187 CVKNQFL---------NGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFDEGA 237
            + N  +            T +E+    + +N    +      + N      E  FD+  
Sbjct: 231 WLMNTSMLAATVFYMAQNKTSLEAIMDSKRKNFGTRKIFCYYSVPNKSRFVVE--FDKTE 288

Query: 238 AQKLLSSKQLELEDIINFPYDVDILENMKSSMGP-IYSWCLPCGRPRDEGTRFVTNDLSD 296
                S K +              L N+K  MGP +  W +P G+P    T      LSD
Sbjct: 289 FHAFWSKKTM--------------LANLKDFMGPNMLMWIIPLGKPY---TFPCKTKLSD 331

Query: 297 Y 297
           Y
Sbjct: 332 Y 332

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 103/258 (39%), Gaps = 47/258 (18%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           H +  +C  C + K ERTHH      CV   DH+C W    +G +N+  FV+F+ +  + 
Sbjct: 126 HGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSIL 185

Query: 134 TSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFR-CVKNQF 192
                LL+   +   +    T++  H S+         +N  ++LT++  +    +    
Sbjct: 186 -----LLIMWASICVYTKEITQR--HHSQ------GPRINVNVMLTLAFAILGWLLTTST 232

Query: 193 LNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTFD-EGAAQKLLSSKQLELED 251
           L       S  K  +E +  ++R         K+      F     + KL    + +  +
Sbjct: 233 LGSAIFYMSQNKTSLEAIMDSKR---------KKFGTRKIFSYYSESNKLRFVVEFDRSE 283

Query: 252 IINFPYDVDILENMKSSMGP-IYSWCLPCGRP------RDE-------GTRFVTNDL--- 294
              F     IL N+K  MGP +  W +P G+P       DE       G R    ++   
Sbjct: 284 FHAFWSKKTILANVKDFMGPNMLMWLIPLGKPFILSSKTDEVDNSLPSGQRVTLTEILGP 343

Query: 295 -----SDYDIKASIEDKL 307
                SDY I+A IEDK+
Sbjct: 344 YEELYSDYTIQA-IEDKI 360

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 29/57 (50%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           C+ C   K  R+ HC  C +C    DHHC W  NC+G  N+ +F  FL   V  T Y
Sbjct: 131 CRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVY 187

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 105/253 (41%), Gaps = 42/253 (16%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           H +  +C +C + K ERTHH      C+   DH+C W    +G +N+  FV+F  +   +
Sbjct: 125 HGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAY--FS 182

Query: 134 TSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQFL 193
           T  L + ++   +    +++   +           +  LNA I   +S LVF  +     
Sbjct: 183 TLLLIMWVSICVYIRIITQHNHNY-----------SPNLNANI---ISTLVFAIL----- 223

Query: 194 NGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPEDTF--DEGAAQKLLSSKQLELED 251
            G     S     I  +  N+  +  +ID+ ++ F           A KL    + +  +
Sbjct: 224 -GWLLTASLLASSIFYMSQNKTSLEAIIDSKRKKFGTRKIFCYYSEANKLRFVVEFDRSE 282

Query: 252 IINFPYDVDILENMKSSMGP-IYSWCLPCGRP-----RDEG-----TRFV------TNDL 294
             +F     IL N+K  MG  I  W +P G+P     + +G     T  V         L
Sbjct: 283 FHSFWDKKSILANIKDFMGSNILMWIIPLGKPYTSRCKSDGKSGSKTTLVEILGPYEETL 342

Query: 295 SDYDIKASIEDKL 307
           SDY I+A IEDK+
Sbjct: 343 SDYTIQA-IEDKI 354

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHF 123
           C+ C   KP R+ HC  C +CV   DHHC W  NCVG  N+  F
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%)

Query: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           C+ C   K  R+ HC  C++C+   DHHC W   C+G  NF +F  FL    L  +Y
Sbjct: 139 CRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTY 195

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 2/105 (1%)

Query: 76  WKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWV--VLT 133
           +  +C  C + K  RTHH      CV   DH+C W    +G  N+  F++FL ++  +L 
Sbjct: 122 YPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYMDCLLL 181

Query: 134 TSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILL 178
             ++ +    R +      N       S  C LFV   L A I +
Sbjct: 182 IMWISMSPFIRVYTFRRDGNLIAIYILSVWCSLFVTGLLTAHIYM 226

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 8/79 (10%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           H +  +C +C + K ERTHH      CV   DH+C W    +G +N+  F++F+ +  + 
Sbjct: 117 HGYPFWCSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAIN 176

Query: 134 --------TSYLGLLLTQR 144
                    SY+ +++ +R
Sbjct: 177 LSIIWVSIVSYIHMIIRKR 195

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           +C  CD+ K ER HH    + CV   DH C W    +G +N+  F++F+ ++ + + ++
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAILSLFV 184

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTW 129
           +C  C + K  R+HH K   +C+L  DH+C W    +  NN+  F++++ W
Sbjct: 117 WCTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGW 167

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYL 137
           +C  C + K  RTHH  T   C+   DH+C W    VG  N+  FV+F  +  L T Y+
Sbjct: 124 WCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYM 182

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 3/73 (4%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNN---FPHFVRFLTWVVLTTS 135
           +C  C + K ER+HH +  K CV   DH+C W    +G  N   F  +V + T  ++T S
Sbjct: 126 WCSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTAS 185

Query: 136 YLGLLLTQRAFDH 148
               L  +R  D+
Sbjct: 186 LTIALFMKRIVDY 198

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 7/64 (10%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRF-------LTWVV 131
           +C  C + K ER HH +    C+   DH+C W    +G NN+  F+++       L W+ 
Sbjct: 116 WCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWIW 175

Query: 132 LTTS 135
           L+ S
Sbjct: 176 LSIS 179

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRF 126
           +C  C + K  RTHH  T   C+   DH+C W    VG  N+  FV+F
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQF 178

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 20/136 (14%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           +C  C + K ER HH +    CV   DH C +  + +G +N+  FV++    V  T +L 
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQY---CVFMTIWLA 182

Query: 139 LLLTQ-RAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLT-------VSLLVFRCVKN 190
           ++ T   A+    +R+ R   H S L     N  L A ++LT        SLL+ +   N
Sbjct: 183 IIWTSIVAYIRSITRDYRG--HGSHL-----NGNLIAILILTTLFWITVTSLLLTQL--N 233

Query: 191 QFLNGMTQIESWEKDR 206
             +   T IE  E+ R
Sbjct: 234 CIVKNKTSIEVMERRR 249

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRF 126
           +C  C + K ERTHH  T   CV   DH+C W    VG  N+  F++F
Sbjct: 126 WCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 1/95 (1%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLG 138
           +C  C + K  RTHH      CV   DH+C W    +G  N+  FV+F  ++ L    L 
Sbjct: 127 WCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFTFYLDLVVLILM 186

Query: 139 LLLTQRAFDHWASRNTRKF-VHTSELCFLFVNAPL 172
           + +  +      S N   + V     C L +  PL
Sbjct: 187 ISIATQMRQMKGSANGNVYAVFALACCALLMAGPL 221

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 73  IHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTW 129
           I+ +  +C  C + K  RTHH K    C+   DHHC W    +G +N+  F +F+ +
Sbjct: 117 INGYPIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFY 173

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 76  WKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLT 133
           +  +C  C+  K  R+HH      C+   DH+C W    +G +N+  FV FL +  ++
Sbjct: 115 YPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLFYCTVS 172

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 11/111 (9%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL--------T 128
           K++C +    KP R+ +       V   DH+CPW  N VG  N   F+ F+        T
Sbjct: 469 KSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITSMESGIFT 528

Query: 129 WVVLTTSYLGLLLTQRAFDHWASRNTRKFV-HTSELCFLFVNAPLNAFILL 178
           ++ L   Y   L  + A++  + +N++ F+   S+LC    +      I+L
Sbjct: 529 FLALCLEYFDEL--EDAYEEISQKNSKCFILGDSDLCSGLAHDKFTFLIML 577

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 47/106 (44%), Gaps = 5/106 (4%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVG---HNNFPHFVRFLTWVVLT 133
           KN+C +    KP R+ +       V   DH CPW  N VG   H NF  F+  +   ++T
Sbjct: 471 KNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLVEAGIIT 530

Query: 134 TSYLGLLLTQRAFDHW-ASRNTRKF-VHTSELCFLFVNAPLNAFIL 177
            + L         DH+  + NT  F +  ++LC+ F    L   IL
Sbjct: 531 FASLCFEYFDELKDHFEVNENTSCFLLGDNDLCYGFTYDRLTFLIL 576

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 74  HQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTW--VV 131
           H +  +C  C + K  RT H      CV   DH+C W    +G  N+  FV+F+ +  V+
Sbjct: 110 HGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFVFYFAVL 169

Query: 132 LTTSYLGLLLTQRAFDHWASR 152
           L   ++ + +  R    + +R
Sbjct: 170 LMIVWITISVYIRDIRQYHAR 190

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL 127
           +C  C + K  RTHH      CV  +DH+C W    +G  N+  F +FL
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFL 169

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 7/95 (7%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTT-S 135
           KN+C +    KP R+         V   DH+CPW  N VG  N   F+ F+T +     +
Sbjct: 469 KNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITLMESGIFT 528

Query: 136 YLGLLLT-----QRAFDHWASRNTRKFV-HTSELC 164
           +L L L      + A +  + +N + F+   S+LC
Sbjct: 529 FLALCLEYFDELEDAHEDTSQKNGKCFILGASDLC 563

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVL 132
           N+C +    KP R+ +       V   DH CPW  N +G  N   FV F+  +V+
Sbjct: 477 NFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVI 531

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWV---VLT 133
           KN+C +    KP R+         V   DH+CPW  N VG  N   F+ F+T +   +LT
Sbjct: 468 KNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFITLMECGILT 527

Query: 134 TSYLGLLLTQRAFDHWASRN 153
              L L       D +  RN
Sbjct: 528 FFKLCLEYFDELEDSYEDRN 547

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 41/98 (41%), Gaps = 10/98 (10%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTS- 135
           KN+C +    KP R+H        V   DH CPW  N +G  N  +F+    W +L T  
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFM----WFILLTEV 509

Query: 136 --YLGLLLTQRAFDHWASRNTRK---FVHTSELCFLFV 168
             +  + LT + FD     N       +   ELC  FV
Sbjct: 510 GIWFFISLTMKYFDILEDTNEDVACFLLGDDELCAGFV 547

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLT 128
           KN+C +    KP R+         V   DH+CPW  N VG  N   F+ F+ 
Sbjct: 469 KNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIA 520

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 55/134 (41%), Gaps = 12/134 (8%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL----TWVVLT 133
           N+C +    KP R+ +       V   DH+CPW  N VG  N   F+ F+    T + L 
Sbjct: 462 NFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILSMETGIGLF 521

Query: 134 TSYLGLLLTQRAFDHWASRNTRKFVHTSELC-------FLFVNAPLNAFILLTVSLLVFR 186
           TS       Q    +   +     +   ELC       F F+    +AF  L VSLL+F 
Sbjct: 522 TSLCLEYFDQLEDLYDDDKLKCLLLGDDELCAGFTHDRFSFLIMAWSAFQFLWVSLLIFV 581

Query: 187 CVKNQFLNGMTQIE 200
            V  Q   G+T  E
Sbjct: 582 QVF-QVTKGVTSYE 594

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTS 135
           +++C      KP R+   +  +  ++  DH CPW  N VG  N   F+ FL  +V   S
Sbjct: 451 RHFCVDTYKRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVS 509

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 41/103 (39%), Gaps = 1/103 (0%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVL-TTS 135
           KN+C +    KP R        + VL  DH+CPW  N VG  N   F+ ++  V L    
Sbjct: 457 KNFCIETWQRKPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSVGLGIVC 516

Query: 136 YLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILL 178
           ++ L +               F+   ELC  F  +     I++
Sbjct: 517 FVKLSMEFFDAFDDDDDVACGFLGDDELCAGFTYSKFTFLIMV 559

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWV 130
           +N+C +    KP R+ +       V   DH+CPW  N VG  N   FV F   V
Sbjct: 445 ENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           +N+C +    KP R+         V   DH+CPW  N +G  N   F+ F+  V +    
Sbjct: 460 RNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIGI-L 518

Query: 137 LGLLLTQRAFD 147
           + + LT + FD
Sbjct: 519 IFVCLTMKYFD 529

>KLTH0G04708g Chr7 (373469..375484) [2016 bp, 671 aa] {ON} similar
           to uniprot|Q04119 Saccharomyces cerevisiae YDR452W PPN1
           Vacuolar endopolyphosphatase with a role in phosphate
           metabolism functions as a homodimer
          Length = 671

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 94/225 (41%), Gaps = 42/225 (18%)

Query: 175 FILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELF--PEDT 232
           +I+L   LLV  CVK + L  M +  S ++  +E     E    QL  +L+ L   P+ +
Sbjct: 25  YIILAFPLLVVVCVKKEQLIHMLRAPSGQRLSVE-----EVPSEQLAGHLEALGLSPDSS 79

Query: 233 -----FDEGAAQKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGT 287
                F  G +QK L  + L + DI       D L    SS+  +     P G+ +DE T
Sbjct: 80  VKVVRFSNGKSQK-LRGRFLHITDI-----HPDPLYKTGSSIENVCHRGRPEGK-KDEAT 132

Query: 288 RFVTN--------DLSDYDIK---ASIEDKLLSLPWPPDGGRQKSQRS-----ADIASTL 331
           RF T         DL +Y +K    ++ DK+  + W  D  R  + R+     A+I    
Sbjct: 133 RFGTAMAGCDSSMDLMEYTLKWIENNLRDKIDFVVWTGDNIRHDNDRNNPRTEAEIFDMN 192

Query: 332 ETFSSGGEATLRN------RSFDSRISVPRTEWHNDWGENLSDFG 370
              +   EA  RN      R FD  I VP    ++ +  NL   G
Sbjct: 193 SKLTKRFEAMFRNPDSVDPRDFDVSI-VPSVGNNDVFPHNLFSLG 236

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 10/131 (7%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVG---HNNFPHFVRFLTWVVLT 133
           K++C       P R  + +     +L  DH+CPW  N +G   H  F +F+  L   +L 
Sbjct: 445 KHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYFILLLDLGILA 504

Query: 134 TSYLGLLLTQRAFDHWASRNTRK-FVHTSELCFLFVNAPLNAFILLTVSLLVFRCVKNQF 192
            + L L       DH  +++  K  + + +LC  F   P   F      LL + CV+  +
Sbjct: 505 LAKLCLEYFDELKDHAKNKDALKCSILSKDLCAGFTYDPFTLF------LLEWVCVQGMW 558

Query: 193 LNGMTQIESWE 203
           +  ++ ++ +E
Sbjct: 559 ILALSFVQFFE 569

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFV 124
           KN+C +    KP R+         V   DH+CPW  N +G  N   F+
Sbjct: 461 KNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFL 508

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 26/51 (50%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL 127
           +++C +    KP R+ +       +L  DH+CPW  N VG  N   F+ F+
Sbjct: 453 RSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFI 503

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 6/108 (5%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVG---HNNFPHFVRFLTWVVLT 133
           +++C +    KP R+         +   DH+CPW  N VG   H  F +FV  +   V  
Sbjct: 459 RHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAVWI 518

Query: 134 TSYLGLLLTQRAFDHWASRNTRK---FVHTSELCFLFVNAPLNAFILL 178
            ++L L       D++   N       +  SELC           ILL
Sbjct: 519 FAHLCLEYFDELEDNYDDYNGDLKCFLIGDSELCAGLTYDLFTTLILL 566

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 8/70 (11%)

Query: 79  YCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL--------TWV 130
           +C K    KP R    K  +Q V   DH+C W  N VG  N   ++ FL        T+ 
Sbjct: 404 FCLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFG 463

Query: 131 VLTTSYLGLL 140
           VL   Y GL+
Sbjct: 464 VLNWRYFGLM 473

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL 127
           +++C +    KP R+      +  V   DH+CPW  N +G  N   F+ F+
Sbjct: 465 RHFCLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFI 515

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 78  NYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRF 126
           N+C +    KP R+ +       V   +H+CPW  N +G  N   F+ F
Sbjct: 429 NFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFF 477

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 4/60 (6%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           +N+C +    KP R+         V   DH CPW  N +G  N   F+ F     LT  Y
Sbjct: 442 ENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFF----ALTVQY 497

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFL 127
           K++C      KP R+      +  V   DH CPW  N +G  N   F+ F+
Sbjct: 449 KHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTFLFFI 499

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 61/135 (45%), Gaps = 12/135 (8%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           K++C       P R+ +       +   DH+CPW  N +G  N   F+ F+ ++ +   +
Sbjct: 453 KHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGV-F 511

Query: 137 LGLLLTQRAFD-HWASRNTRKFVHTS----ELCFLFVNAPLNAFILLTVSLLVFRCVKNQ 191
           + + L+ R F+  W + +  +    S    +LC  +   P ++F+L  V      C +  
Sbjct: 512 IFVRLSIRYFELEWQNLDDIQMDCRSSFCPQLCKGYYLDPFHSFMLAWV------CFQTM 565

Query: 192 FLNGMTQIESWEKDR 206
           ++  +T ++ +E  +
Sbjct: 566 WVVALTFVQIFEASK 580

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 10/128 (7%)

Query: 128 TWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTSELCFLFVNAPLNAFILLTVSLLVFRC 187
           T+  ++T   G L  ++  D     N + F +   L FL +  PLN F LL      F  
Sbjct: 451 TFASISTVLGGSLTDEQDMDLIF--NPQDFQYIDSLKFLNIMTPLNEFNLLRGHKEDFDL 508

Query: 188 VKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLK---ELFPEDTFDEGAAQKLLSS 244
           V  + +  +  I   EK   E+    E + P+ +D L+   E   + T      QK+L  
Sbjct: 509 VIKEVIKALNAIRDQEK---EHFVGEEEIFPKNLDYLQWTPEADTKQTLSYFNTQKILVE 565

Query: 245 --KQLELE 250
             KQLE E
Sbjct: 566 IDKQLEYE 573

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 20/43 (46%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNN 119
           +N+C +    K  R+ +       V   DH+CPW  N +G  N
Sbjct: 439 ENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKN 481

>ACL040C Chr3 complement(293391..294419) [1029 bp, 342 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL175C
           (AIR2) and YIL079C (AIR1)
          Length = 342

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 12/59 (20%)

Query: 73  IHQWKNYCKKCDNYKPERTHHCKTCKQ-----CVLSMDH---HCPWTMNCVGHNNFPHF 123
           IH+ +  CK C     +R H  K C       C L  DH   HCP TM C   N+  H+
Sbjct: 62  IHEAEAKCKNCS----QRGHIKKNCPHVICSYCGLMDDHYSQHCPRTMRCSHCNDSGHY 116

>KLTH0F05896g Chr6 complement(521903..525343) [3441 bp, 1146 aa]
           {ON} similar to uniprot|P12685 Saccharomyces cerevisiae
           YJL129C TRK1 Component of the Trk1p-Trk2p potassium
           transport system 180 kDa high affinity potassium
           transporter
          Length = 1146

 Score = 30.8 bits (68), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 114 CVGHNNFPHFVRFLTWVVLTTS-YLGLLLTQRAF--DHWASRNTRKFVHTSELCFLFVNA 170
            +G+  FP F+RF+ WV+   S  L L+     F  DH     T  F        LF+  
Sbjct: 714 IIGNTGFPVFLRFIIWVMFKLSPELSLIKESLGFLLDHPRRCFTLLFPSAPTWWLLFILV 773

Query: 171 PLNA-----FILLTVSLLVFRCVKNQF--LNGMTQIES 201
            LNA     FI+L ++  V   + + F  LNG+ Q  S
Sbjct: 774 TLNAIDLILFIVLDLNSQVVEGLTSGFKVLNGLFQAVS 811

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 58/141 (41%), Gaps = 20/141 (14%)

Query: 77  KNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSY 136
           K++C       P R+ + +     + + DH CPW  N +G  N   F  F+  + ++  +
Sbjct: 465 KHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISVWW 524

Query: 137 LGLLLTQ---RAFDHWASRNTR-----KFVHTSELCFLFVNAPLNAFILL---------T 179
              L+ +      D+  +R  +      F+   +LCF   +   N F+LL          
Sbjct: 525 FLPLMMEYFDELEDYLENRKGKHFGDCHFLGDEDLCFGLHHDTFN-FLLLCWVIFQAFWV 583

Query: 180 VSLLVFRCVKNQFLNGMTQIE 200
           + L+  + V  Q L G+T  E
Sbjct: 584 LCLIAVQTV--QMLKGVTDYE 602

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
           Anc_1.113 YJR097W
          Length = 168

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 290 VTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDS 349
           VT D +  DIK + ++KLL++    + G+     +  +    E +    E TLR +   S
Sbjct: 16  VTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKSNTYSVNQIQEAYGVLAEQTLRTQYDAS 75

Query: 350 RISVPRTEWHNDWGENLSDFGVD 372
              + +     + GE L ++ +D
Sbjct: 76  LELIQKANGFYNNGEGLDEYSLD 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.452 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,800,821
Number of extensions: 1753162
Number of successful extensions: 4990
Number of sequences better than 10.0: 131
Number of HSP's gapped: 5001
Number of HSP's successfully gapped: 131
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)