Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10956g6.29ON1433143370230.0
Kwal_56.224626.29ON1541145049870.0
ACL004W6.29ON1377135437420.0
NCAS0D021306.29ON1434146934000.0
SAKL0E01540g6.29ON1415113733600.0
KNAG0F029206.29ON1492128533260.0
CAGL0E02475g6.29ON1493134832590.0
TDEL0G044006.29ON1490115431620.0
Ecym_30336.29ON147495130910.0
ZYRO0C07524g6.29ON167094130040.0
KLLA0C06182g6.29ON151995129440.0
Kpol_1037.226.29ON1496100729370.0
Smik_15.1666.29ON156691028600.0
Suva_15.1716.29ON156196928140.0
KAFR0A051206.29ON147996728110.0
TPHA0J004006.29ON151284228070.0
NDAI0C026606.29ON165783927320.0
TBLA0E031606.29ON173992327230.0
CAGL0J11594g6.29ON9377878841e-100
Skud_15.1586.29ON15552606571e-68
YOL004W (SIN3)6.29ON15362536283e-65
Kpol_1064.538.403ON48992801.1
TPHA0K017804.78ON76623772.8
CAGL0H09350g5.190ON1965118764.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10956g
         (1433 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  2709   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1925   0.0  
ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  1446   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1314   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1298   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1285   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1259   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1222   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1195   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1161   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1138   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1135   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1106   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1088   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1087   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1085   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1056   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1053   0.0  
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   345   e-100
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...   257   1e-68
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...   246   3e-65
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   1.1  
TPHA0K01780 Chr11 complement(376528..378828) [2301 bp, 766 aa] {...    34   2.8  
CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] ...    34   4.3  

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 2709 bits (7023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1324/1433 (92%), Positives = 1324/1433 (92%)

Query: 1    MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAPVDASQQPHQF 60
            MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAPVDASQQPHQF
Sbjct: 1    MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAPVDASQQPHQF 60

Query: 61   VLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASLNNPLPAXXXXXXX 120
            VLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASLNNPLPA       
Sbjct: 61   VLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASLNNPLPAQQQMLHS 120

Query: 121  XXXXXXXXXXXXXXEHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKS 180
                          EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKS
Sbjct: 121  QQQQQLLQQGVLPLEHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKS 180

Query: 181  QAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNAREL 240
            QAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNAREL
Sbjct: 181  QAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNAREL 240

Query: 241  NLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXX 300
            NLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFN     
Sbjct: 241  NLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNQNLPQ 300

Query: 301  XXXXXXXXXXXXXAMPXXXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHF 360
                         AMP        FMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHF
Sbjct: 301  HEQQNQQHGSQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHF 360

Query: 361  LEILQTYQREQKPIHEVYAQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXX 420
            LEILQTYQREQKPIHEVYAQVTSLFQN               TAAHE             
Sbjct: 361  LEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLLLQQQQQQQ 420

Query: 421  XXXXXXXXXXXXSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLPPLGSFSPPI 480
                        SHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLPPLGSFSPPI
Sbjct: 421  QQLQQQQIQQHQSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLPPLGSFSPPI 480

Query: 481  NGRENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDLRGAMDGNFAPQP 540
            NGRENDPQLNLPAVQPPAMEFA               IPGGTLPLSDLRGAMDGNFAPQP
Sbjct: 481  NGRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDLRGAMDGNFAPQP 540

Query: 541  LQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVY 600
            LQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVY
Sbjct: 541  LQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVY 600

Query: 601  TEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHR 660
            TEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHR
Sbjct: 601  TEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHR 660

Query: 661  LDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 720
            LDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ
Sbjct: 661  LDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQ 720

Query: 721  YEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTI 780
            YEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTI
Sbjct: 721  YEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTI 780

Query: 781  YKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQK 840
            YKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQK
Sbjct: 781  YKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQK 840

Query: 841  VFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDK 900
            VFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDK
Sbjct: 841  VFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDK 900

Query: 901  GVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSDAVSN 960
            GVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSDAVSN
Sbjct: 901  GVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSDAVSN 960

Query: 961  SNPRKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQE 1020
            SNPRKRLWESEQPLKELLRS       RDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQE
Sbjct: 961  SNPRKRLWESEQPLKELLRSKHKHHKKRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQE 1020

Query: 1021 AKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTR 1080
            AKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTR
Sbjct: 1021 AKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTR 1080

Query: 1081 EINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQ 1140
            EINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQ
Sbjct: 1081 EINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQ 1140

Query: 1141 AYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQV 1200
            AYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQV
Sbjct: 1141 AYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQV 1200

Query: 1201 RSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGI 1260
            RSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGI
Sbjct: 1201 RSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGI 1260

Query: 1261 PHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR 1320
            PHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR
Sbjct: 1261 PHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTR 1320

Query: 1321 FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK 1380
            FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK
Sbjct: 1321 FAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK 1380

Query: 1381 HESLNKNPALVQGTRDPRHESSVAKEASSLESHADDTELKAGETTAEDIQGNE 1433
            HESLNKNPALVQGTRDPRHESSVAKEASSLESHADDTELKAGETTAEDIQGNE
Sbjct: 1381 HESLNKNPALVQGTRDPRHESSVAKEASSLESHADDTELKAGETTAEDIQGNE 1433

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1925 bits (4987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 977/1450 (67%), Positives = 1102/1450 (76%), Gaps = 26/1450 (1%)

Query: 1    MPPSWTNQPASQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAPVDASQQPH-- 58
            MP SW+NQ   QTG KSS E   + EQQ  SGG   Q      E+K   P    Q P   
Sbjct: 101  MPQSWSNQATGQTGLKSSAEGHGMVEQQAGSGGSMEQLPGIASEAKGAVPNGMGQPPQLP 160

Query: 59   --QFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASLNNPLPAXXX 116
                VLPSLSGL+ G RAEYG+  QRLP +QGA PQS SSGGSKGFSVASLNNPLP    
Sbjct: 161  QQHVVLPSLSGLETGGRAEYGASAQRLPFMQGAAPQSASSGGSKGFSVASLNNPLPMQQQ 220

Query: 117  XXXXXXXXXXXXXXXXXX---EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 173
                                 EHVQD SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD
Sbjct: 221  QQQQQQQQQQQQLLQQGVLPLEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 280

Query: 174  IMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTP 233
            IMKDYKSQAIDTLGVIERISTLFKGYP+LIQGLNTFLPQGYKIECT NP+DPHSIKVTTP
Sbjct: 281  IMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTTP 340

Query: 234  FDNARELNLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTT 293
            FD  REL+L    TG   V GH +   +   SP ++   E A  + K E  P +LP    
Sbjct: 341  FDTTRELSL-DHNTGGSAVGGHLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAA 399

Query: 294  FNXXXXXXXXXXXXXXXXXXAMPXXXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQ 353
            F                   A          +  NRP+GDVEFSHAISYVNKIKTRFADQ
Sbjct: 400  FAQDQVHHAESDTQREIQKSAQLQQSQQDQQYATNRPNGDVEFSHAISYVNKIKTRFADQ 459

Query: 354  PEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXX 413
            P+IYKHFLEILQTYQREQKPIHEVY QVTSLFQN               TAAHE      
Sbjct: 460  PDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKFLPDATAAHEQHQQLL 519

Query: 414  XXXXXXXXXXXXXXXXXXXSHYQNASQ----DLDQRQQHTHQPFGNTVPFYQTQQGRPQN 469
                               S    + Q    +LDQRQQ ++ PF +   FYQ QQ R QN
Sbjct: 520  QQQQQQQQLQHQIQLQQQQSQQYQSFQSSPQELDQRQQQSNSPFNHPASFYQHQQARAQN 579

Query: 470  LPPLGSFSPPINGRENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDLR 529
            LPPLG+FSPPINGR+N+ Q+NLPAVQPPA++F                +   +LP+SD+R
Sbjct: 580  LPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSDMR 639

Query: 530  GAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDR 589
            G +DG FAPQPL SQDVQ++EPTSRPEIDLDPSLVPVIPEPI+PLEND TLIEETSFFD+
Sbjct: 640  GPVDGGFAPQPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSFFDK 699

Query: 590  AKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPK 649
            AKKYMGNKQVYTEFLKILNLFSQDLI T+ELVDKVEHYLGG+ ELFDWFKSFVNYVE+PK
Sbjct: 700  AKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVERPK 759

Query: 650  HIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASE 709
            HIENV+HEKHRLDLDLCEAC PSYKKLPKADTFMPC GRDEMCWEVLNDEWVGHPVWASE
Sbjct: 760  HIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVWASE 819

Query: 710  DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKL 769
            DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMT EEK+ FKL
Sbjct: 820  DSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKTFKL 879

Query: 770  PPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQRE 829
            PPGLGHTS TIYKKVIRKVYDKDRGFEIIDALHENPAVSVPI+L+RLKQKDEEWRRAQRE
Sbjct: 880  PPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRAQRE 939

Query: 830  WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKP 889
            WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ NKRIYPFT KP
Sbjct: 940  WNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFTSKP 999

Query: 890  KSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIEN 949
            KSQLD+D+ DKGVLFDIL LV+ FIDHS+TYSNPDKEKL+AFF+GFLS+FFSI   +++N
Sbjct: 1000 KSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTDLDN 1059

Query: 950  STPADSDAVSNSNP-RKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSP 1008
              P++   V N +  RKR  + +Q  ++LL+S       + +  ED+S SDDQ++  K+ 
Sbjct: 1060 --PSEEHKVENGDSTRKRSRDDDQFFRDLLKSKHKQAKKKTSQQEDESTSDDQDTAAKTS 1117

Query: 1009 QEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRL 1068
             ++E EE +R +AKKPWLLGNILDEAN+HG+VSNRK +N+FANTN+YVFFRHLTTMYQRL
Sbjct: 1118 PDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYNMFANTNIYVFFRHLTTMYQRL 1177

Query: 1069 SEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRND 1128
            SE KN+NEEVT+EINSR VVQFAKDLNL STQLSDMGLDFKG DAY+QLL LCKRLI++D
Sbjct: 1178 SEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLDFKGADAYEQLLALCKRLIQSD 1237

Query: 1129 MDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTAT 1188
            ++HQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAK+AEIMILFEKDR+   T
Sbjct: 1238 IEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKTAEIMILFEKDRKAPTT 1297

Query: 1189 STKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYL 1248
            ST+EQILYRLQVRS MGLTENMFR+E+N  S HV IQ+VA+DDLTL +P SLKD+W YYL
Sbjct: 1298 STREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFVAVDDLTLNQPNSLKDQWQYYL 1357

Query: 1249 TSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYEL 1308
            TSY+LSHPTEG+PHEEIK PFLEKTL+DD ++DE SE  SP G S+S LRIQ+NPESY L
Sbjct: 1358 TSYSLSHPTEGVPHEEIKAPFLEKTLRDDGDSDEDSEWYSPGGQSVSQLRIQINPESYAL 1417

Query: 1309 QIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKT 1368
            QIEP SKD+FTR  VN+        S  D K   +K+L   ++   GWKKG+  E + K 
Sbjct: 1418 QIEPNSKDLFTRSTVNKHPTKIGEASGRDAK-TMQKSLADMVNSEHGWKKGLQNESIGKA 1476

Query: 1369 LTALNYVRLHG---KHESLNKNPALVQGTRDPRHESS--VAKEASSLESHADDTELKAGE 1423
             + +N+V+  G   K  +++ +P +     +  H +S     E ++ E   DDT+L+A E
Sbjct: 1477 ESIINFVKARGFLEKATTVSPDPKV-----EKEHSASNGAIPEGATTEKPGDDTDLRADE 1531

Query: 1424 TTAEDIQGNE 1433
            TTAEDIQGNE
Sbjct: 1532 TTAEDIQGNE 1541

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 1446 bits (3742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 769/1354 (56%), Positives = 932/1354 (68%), Gaps = 130/1354 (9%)

Query: 59   QFVLPSLS--GLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGS--KGFSVASLNNPLPAX 114
             + LPS+S  GL        GS   RLP +Q A        GS   GF+V  L   +P  
Sbjct: 53   HYTLPSISAAGLPGAGEPHGGS---RLPPMQNALGVGGGGPGSIANGFAVGRLEGAVPVS 109

Query: 115  XXXXXXXXXXXXXXXXXXXXEHVQDPS-YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 173
                                   QD S YRPLN KDALSYLEQVKFQF++RPDVYNHFLD
Sbjct: 110  GTGGPGSPGPQVP---------AQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLD 160

Query: 174  IMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTP 233
            IMKD+KSQAIDT GVIER+STLF GYP LIQG NTFLP GY IEC  +PNDP  IKVTTP
Sbjct: 161  IMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPHGYNIECPSDPNDP--IKVTTP 218

Query: 234  FDNARELNLATMATGNGI--VEGHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVP 291
            F    E+ + T A GN        P L  + +V            V    E +P  +  P
Sbjct: 219  FGTIGEIPI-TGAGGNHAHGANTEPRLQSTQNV----------PTVYRSAEGSPAAIATP 267

Query: 292  TTFNXXXXXXXXXXXXXXXXXXAMPXXXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFA 351
             T                                 G + +GDVEFSHAISYVNKIKTRFA
Sbjct: 268  ATTQEQYG--------------------------TGPKKAGDVEFSHAISYVNKIKTRFA 301

Query: 352  DQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXX 411
            +QP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN               +A       
Sbjct: 302  EQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQ----- 356

Query: 412  XXXXXXXXXXXXXXXXXXXXXSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLP 471
                                 SH Q     +     H        +P  Q    + QNLP
Sbjct: 357  -------------------LQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQ-QNLP 396

Query: 472  PLGSFSPPINGRENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDLRGA 531
            PLG+FS P    ++ P ++LP+VQ P +  +               +    +P+SDLRGA
Sbjct: 397  PLGNFSTP---GDHHP-MSLPSVQGPNVGLSQGQSGHIVTQG----VSNQHIPVSDLRGA 448

Query: 532  MDGNF-APQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRA 590
             D +F A +  Q QDVQ++EPT RPEIDLDPSLVPVIPEPIKPLE++L L+EE +FFD+A
Sbjct: 449  PDASFRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKA 508

Query: 591  KKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKH 650
            KK++GNKQ+YTEFLKILNL+SQDL+  E+LV+ V HYL GSPELFDWFKSFV Y E+PKH
Sbjct: 509  KKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKH 568

Query: 651  IENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASED 710
            IENVIHEKHRLDLDLCEAC PSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASED
Sbjct: 569  IENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASED 628

Query: 711  SGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLP 770
            SGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMTPEEK AFKLP
Sbjct: 629  SGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLP 688

Query: 771  PGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREW 830
            PGLGHTS+TIYKKVIRKVYDKDRGFEIIDALHE+PA++VP++LKRLKQKDEEWRRAQREW
Sbjct: 689  PGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREW 748

Query: 831  NKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPK 890
            NKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ+NKRI+P TPK K
Sbjct: 749  NKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAK 808

Query: 891  SQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIE-- 948
            SQL YD K+  V  DIL LV  F+ +++TYS  D E+L  FFKGF+S+FFS    EIE  
Sbjct: 809  SQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEG 868

Query: 949  -------NSTPADSDAVSNS---------NPRKRLW-ESEQPLKELLRSXXXXXXXRDTS 991
                   N T +  D    S         + RKR+  ++E  L+++L         +   
Sbjct: 869  LLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGP- 927

Query: 992  AEDDSISDDQNSPE-KSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFA 1050
                   +DQ+S E +   +IE++E++RQEAKKPWLLG+I+DEA++HG+VS+R  FN+FA
Sbjct: 928  ------QNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFA 981

Query: 1051 NTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKG 1110
            NTN+YVFFRHLTTMY+RL EVK +N EVT+EI++R VVQFAKDLNL+STQL+DMGLDFKG
Sbjct: 982  NTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKG 1041

Query: 1111 KDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDA 1170
             DAY++LL L + LI  +++HQWFEESLRQAYKNKAFK+YT+DKVIQ+LVKHAH+I+ D 
Sbjct: 1042 ADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDH 1101

Query: 1171 KSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAID 1230
            K+ EIM+LF+ DR  T+TSTK+QILYRLQVRS M   ENMFR+E N  + H  IQ+VA++
Sbjct: 1102 KTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVE 1161

Query: 1231 DLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEE-ADEGSEERSP 1289
            DLTL EP+SL+D+W YYLTSY+LSHPTEGI H+ ++ PFLEK ++ DE   D+G E  SP
Sbjct: 1162 DLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSP 1221

Query: 1290 SGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEK----RKT 1345
             G + SN++++++P +Y +++EPG  DIF+R +VN+F       +  D+K++K    +  
Sbjct: 1222 EGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKF------PTRVDVKKKKSAELKLV 1275

Query: 1346 LMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHG 1379
            L   L+G RGWK+G++ +   +    L YV+ +G
Sbjct: 1276 LEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNG 1309

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1314 bits (3400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/1469 (50%), Positives = 929/1469 (63%), Gaps = 209/1469 (14%)

Query: 4    SWTNQPASQTGTKSSVES-----PSLSEQQPVSGGMQGQAAN-----------STGESKA 47
            ++ NQ   QT  K+   S     PSLS      GG+Q  + N           +TG + A
Sbjct: 39   NFANQEQQQTNMKAEPSSEHVILPSLSS----IGGVQTSSENNITNPTQNQIPTTGVNTA 94

Query: 48   NAPVDASQQPHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGSKGFSVASL 107
                 +SQ     +LPS+S   A       S    +P+    QP+  S+  S GFSVAS 
Sbjct: 95   TTSQSSSQ-----MLPSVSSTFA---TPPNSTNITVPAQNQEQPKRNSA--STGFSVASF 144

Query: 108  NNPLPAXXXXXXXXXXXXXXXXXXXXXEH----------------------------VQD 139
            +NPLPA                     +                              QD
Sbjct: 145  DNPLPAVQNQQPLPVQPQPQPQPHPQPQPQPQSQQSQQAQQAQQAQPQPQQPREQDQFQD 204

Query: 140  PSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGY 199
             +YRPLN KDALSYLEQVK+QF+ RPD+YN FLDIMKD+KSQ+IDT GVIER+S LF+GY
Sbjct: 205  LAYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGY 264

Query: 200  PILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSL- 258
            P+L+QG NTFLPQGY+IECT +P+ P  I+VTTP              G   + G P++ 
Sbjct: 265  PMLVQGFNTFLPQGYRIECTTDPDGP--IRVTTPM-------------GTSTLSGGPAME 309

Query: 259  MPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXAMPXX 318
             PS   S  +   H  +   P L          +TF                        
Sbjct: 310  APSSSESNLQQQQHHQSPTIPSL--------AASTFQESNFQQTPQPEDQSAK------- 354

Query: 319  XXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVY 378
                        + +VEFS AI+YVNKIK RFADQP+IYK FLEILQTYQREQKPI+EVY
Sbjct: 355  ------------NAEVEFSQAINYVNKIKNRFADQPDIYKRFLEILQTYQREQKPINEVY 402

Query: 379  AQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXSHYQNA 438
            +QVT LFQ+               +                                QNA
Sbjct: 403  SQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELP-----------------------QNA 439

Query: 439  SQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLPP-----------LGSFSPPING---RE 484
                   QQ    P  N  P +Q Q G P N  P           +GSF+PP NG   RE
Sbjct: 440  G-----IQQRAAIPTPN--PKHQ-QYGYPNNYYPNGTGTQQNLPPIGSFAPP-NGTASRE 490

Query: 485  NDPQ------LNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTL--PLSDLR------- 529
              P         LP++ P                     IP   L  PL+D +       
Sbjct: 491  YAPGNQFVGPGGLPSMIPNDQALQQQQQPGLVHGYTNEAIPVSNLRSPLTDQQYPNLLNM 550

Query: 530  ------GAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEE 583
                  G MD N A  P+  Q     E   RPEIDLDPS+VPVIPEP +PLE +++L+EE
Sbjct: 551  QNQMTPGQMDINNATAPMAQQYTN--EAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEE 608

Query: 584  TSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVN 643
            T+FF++AKK++G KQVYTEFLKILNL+SQDL+ T+EL  KVE+YLG + ELF WFK+FV 
Sbjct: 609  TNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG 668

Query: 644  YVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGH 703
            + EKP  IEN++HEKH+LDLDLCEAC PSYKKLPK DTFMPCSGRDEMCWEVLNDEWVGH
Sbjct: 669  FQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGH 728

Query: 704  PVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEE 763
            PVWASEDSGFIAHRKNQYEE+LFK EEERHEYD+ IE+NLRTIQ LETIANKI NMT EE
Sbjct: 729  PVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEE 788

Query: 764  KQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEW 823
            K+ FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIID LHE PA++VP++LKRLKQKDEEW
Sbjct: 789  KKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEW 848

Query: 824  RRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIY 883
            RRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQTNKRI+
Sbjct: 849  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 908

Query: 884  PFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSIS 943
              TPKPKSQL++   D  +  DIL L + FI+HSSTYSNP+KE++  F + F+S+FFSI 
Sbjct: 909  WLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIP 968

Query: 944  --------------YQEIENSTPADSDAV--------SNSNPRKRLWESEQPLKELLRS- 980
                           QE E  T   S  +        S SN +KR    + PL ++LR  
Sbjct: 969  LDKVNEALSDRSHWLQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLADILRKH 1028

Query: 981  --XXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDE---EVIRQEAKKPWLLGNILDEAN 1035
                     ++++ E+    DD+N    S +E+ ++   E+I +E K+PWLLGNI++ A+
Sbjct: 1029 KYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNIIETAS 1088

Query: 1036 DHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLN 1095
            +HG +SNRK+FN+FANTN+YVFFR  T +Y+RL E+K +NE+VT+E+NSR + QFAKDLN
Sbjct: 1089 NHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQFAKDLN 1148

Query: 1096 LVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKV 1155
            L+STQL DMGLDF G ++Y +LL L KRLI+ND++HQWFEESLRQA+ NKAFK+YTVDKV
Sbjct: 1149 LISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLYTVDKV 1208

Query: 1156 IQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEI 1215
            IQSLVKHAH+I+ D K++EIM+LFEKDR C++TS KEQILYRLQ R++M  TENMFR+E 
Sbjct: 1209 IQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENMFRIEF 1268

Query: 1216 NKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQ 1275
            N++  HVCIQY+A++DLT+K+P+S++  W YY+TSY+L HPTEG+P +E+K+PFLEKTL 
Sbjct: 1269 NEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFLEKTL- 1327

Query: 1276 DDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSN 1335
            + E  +EG  + SP G S S L+I+++P+SY L+IEPGS D+F+R ++N +   S+    
Sbjct: 1328 ELEVDEEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTYSD---- 1383

Query: 1336 TDLKEEKRKTL--MSQ-LDGSRGWKKGMS 1361
               + +KRK++  M++ LDG  GWKK ++
Sbjct: 1384 ---ETKKRKSIDQMTKFLDGKNGWKKNLT 1409

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1298 bits (3360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1137 (60%), Positives = 829/1137 (72%), Gaps = 93/1137 (8%)

Query: 329  RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNX 388
            +  GDVEFSHAISYVNKIKTRFA+QP+IYKHFLEILQTYQREQKPI+EVYAQVT L    
Sbjct: 334  KKGGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVL---- 389

Query: 389  XXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXSHYQNASQDLDQRQQH 448
                                                          +QNA   LD  ++ 
Sbjct: 390  ----------------------------------------------FQNAPDLLDDFKKF 403

Query: 449  ---THQPFGNTVP-------FYQTQQGRPQNLPPLGSFSPPIN--GRENDPQLNLPAVQP 496
                  P   T P       FY  Q    QNLPPLGSFSPP +   RE +  + LPAVQP
Sbjct: 404  LPDASAPQSTTTPAPVNGGTFY-PQAAPQQNLPPLGSFSPPSSGSAREGE-HVGLPAVQP 461

Query: 497  PAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDLRGAMDGNFAPQPLQSQDVQFIEPTSRPE 556
            P+M+ +               +    +P+S++R   DG +      S +VQ++EP +RPE
Sbjct: 462  PSMDISGQPQQHIITQG----MSNDDIPISEVRNTADGAYRSDLRNSGEVQYMEPVARPE 517

Query: 557  IDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIG 616
            IDLDPSLVPVIPEPI+P+EN+++L+EETSFFD+AKK++GNKQ+YTEFLKILNL+SQDL+ 
Sbjct: 518  IDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFIGNKQIYTEFLKILNLYSQDLLD 577

Query: 617  TEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKL 676
             +ELV+KVE+YLGG+ ELFDWFK+FV Y +KPKHIEN++HEKHRLDLDLCEAC PSYKKL
Sbjct: 578  RDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENIVHEKHRLDLDLCEACGPSYKKL 637

Query: 677  PKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 736
            PKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD
Sbjct: 638  PKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD 697

Query: 737  YYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFE 796
            +YIEANLRTIQ LETIANKI+NMTPEEK  FKL PGLGHTS+TIYKKVIRKVYDKDRGFE
Sbjct: 698  FYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLGHTSVTIYKKVIRKVYDKDRGFE 757

Query: 797  IIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQA 856
            IIDALHE P+++VPI+LKRLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQA
Sbjct: 758  IIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQA 817

Query: 857  DKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDH 916
            DKKLLT KQL+SEIS+IKVDQ NKRI+P TPKPKSQLDY  KD+ VL+DIL L   FID 
Sbjct: 818  DKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLDYHFKDREVLYDILNLAKVFIDC 877

Query: 917  SSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTP------ADSDAVSNSN------PR 964
            ++TYSNPDKEK+  F K FL +FFS    E+E +           D   NS        R
Sbjct: 878  NTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARRRGDIGVQDGEENSGQENSDLSR 937

Query: 965  KRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKP 1024
            KR  E E  LK++LR            AE++ I ++    EK+ +E E+EE+IRQEAKKP
Sbjct: 938  KRTREEENLLKDVLRRNKYQKGR--NFAEEEPIPEESEFAEKTVEEKEEEEIIRQEAKKP 995

Query: 1025 WLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINS 1084
            WLLG+I+DEAN+HG+V NRK FN+FANTN+YVFFRHL T+Y RLSEVK++NE VT EI +
Sbjct: 996  WLLGSIVDEANEHGFVENRKTFNMFANTNIYVFFRHLATLYTRLSEVKDINEAVTEEIKN 1055

Query: 1085 RNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKN 1144
            R VVQFAKDLNL+STQLSDMGLDF+G DAY Q+LTL KRLI  D++HQWFEESLRQAYKN
Sbjct: 1056 RKVVQFAKDLNLISTQLSDMGLDFEGADAYGQVLTLSKRLIEGDIEHQWFEESLRQAYKN 1115

Query: 1145 KAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYM 1204
            KAFKIYT+DKV+QSLVKHAH+IITD K+ EIMILFEKDR C  TS KEQILYRLQVRS+M
Sbjct: 1116 KAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMILFEKDRTCLNTSAKEQILYRLQVRSHM 1175

Query: 1205 GLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEE 1264
               ENMFR+E N+ S H  IQ+VA+DDLTL+EP+SL+DRW YY+TSY+LSHPTEGI HEE
Sbjct: 1176 TTAENMFRIEYNRQSTHASIQFVAVDDLTLEEPKSLEDRWKYYVTSYSLSHPTEGISHEE 1235

Query: 1265 IKVPFLEKTLQDDEEADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVN 1324
            ++ PFLEK L+ +EE    + E SP G S SNL++++NPE+Y L ++PGS D F+R ++N
Sbjct: 1236 LQPPFLEKILEKEEEFQCENGEYSPEGVSSSNLKVKINPETYSLDVQPGSYDFFSRKSIN 1295

Query: 1325 RFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGK---H 1381
            +F     N++    + EK K L S L+G++GWK+G+    V K  T + YV+  G     
Sbjct: 1296 KFPIEINNDTYKSKRGEKAKCLTSYLNGAKGWKRGLVASKVLKAQTEIEYVKTKGTLVGL 1355

Query: 1382 ESLNKNPALVQGTRDPRHESSVAK-------EASSLESHADDTELKAGETTAEDIQG 1431
            ES +KN  +V+   D  ++S           E     SH ++ E K  +TT E+ +G
Sbjct: 1356 ESKDKN-DIVKNDIDGENKSYTFSTGQLHDHEEDKPISHQEEPESKGNDTTTEEFEG 1411

 Score =  206 bits (525), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 144/227 (63%), Gaps = 15/227 (6%)

Query: 29  PVSGGMQGQAANSTGESKANAPVDASQQPHQ--FVLPSLSGLDAGTRAEYGSEPQRLPSL 86
           P +  +  +   STG++  N+ ++ +Q   Q  + LPS+SGL++ T ++ G   Q LPS+
Sbjct: 38  PPTSSLDHKIGGSTGDAIKNS-IEQTQPQVQVPYTLPSISGLNS-THSDSGIGQQMLPSV 95

Query: 87  QGAQPQSIS---------SGGSKGFSVASLNNPLPAXXXXXXXXXXXXXXXXXXXXXEHV 137
           Q + P             +    GFSVASLNNPLP                         
Sbjct: 96  QSSLPPPPPPALQPTHRHTPSGTGFSVASLNNPLPEQQQQQQQQQQQQQQQQQQQQQP-- 153

Query: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
           QDPSYRPLN KDALSYLEQVKFQFNNRPDVYNHFLDIMKD+KSQAIDT GVIER+S LF+
Sbjct: 154 QDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

Query: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLAT 244
           GYP LIQG NTFLPQGYKIEC+ NPNDPH IKVTTPF     + L T
Sbjct: 214 GYPNLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNT 260

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 339 VEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 398

Query: 205 GLNTFLPQGYKIECTLNP 222
               FLP     + T  P
Sbjct: 399 DFKKFLPDASAPQSTTTP 416

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 34/48 (70%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A+SY+ ++K +F ++P++Y HFL+I++ ++ +      V  +V++LFQ
Sbjct: 166 ALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQ 213

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 570 PIKPLENDLTLIEETSFFDRAKKYMGNK-QVYTEFLKILNLFSQDLIGTEELVDKVEHYL 628
           P  P    L + +  S+ ++ K    N+  VY  FL I+  F    I T  ++++V +  
Sbjct: 153 PQDPSYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLF 212

Query: 629 GGSPELFDWFKSFV 642
            G P L   F +F+
Sbjct: 213 QGYPNLIQGFNTFL 226

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1285 bits (3326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1285 (53%), Positives = 855/1285 (66%), Gaps = 129/1285 (10%)

Query: 139  DPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 198
            D  YRPLN KDALSYLEQVK QFN+RP +YN FLDIMKD+KSQ IDT GVIER+STLFKG
Sbjct: 215  DSPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKG 274

Query: 199  YPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSL 258
            +P LIQG NTFLPQGY+IEC+ NPN+P  IKVTTP                G++E     
Sbjct: 275  FPALIQGFNTFLPQGYRIECSSNPNEP--IKVTTPM---------------GVLENVRGS 317

Query: 259  MPSDDVSPPKLVGHEPAAVQPKLENAP----TNLPVPTTFNXXXXXXXXXXXXXXXXXXA 314
              + D  P   +G  P    P   + P     +L +P+T                    A
Sbjct: 318  DITADQQPA--IGQLPTTQSPIQASLPPPQSAHLHLPSTV------------------AA 357

Query: 315  MPXXXXXXXXFMGNRP--SGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQK 372
                         N P  + DVEFS AISYVNKIK RF+DQP+IYK+FLEILQTYQREQK
Sbjct: 358  ATTVQQSANVHAENEPKKANDVEFSQAISYVNKIKNRFSDQPDIYKNFLEILQTYQREQK 417

Query: 373  PIHEVYAQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXX 432
            PI+EVYAQVT LF N               +A++E                         
Sbjct: 418  PINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQPKQSPYSPQV------------- 464

Query: 433  SHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQ-NLPPLGSFSPPING--------- 482
              Y  A    D  + +    + NT  +Y  Q  +PQ NLPP+GSFSPP NG         
Sbjct: 465  --YSGA----DMARGYM---YNNTGVYYPPQVNQPQSNLPPIGSFSPPANGVAPTTGTAI 515

Query: 483  ---RENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDLRGAMDGN---- 535
                E      +PA+ P   + A                 GGT+P  +  G +  +    
Sbjct: 516  PHADEQHVVAGVPAMAPHEQQHAPSMINNDGIQISNMR-GGGTVPALNQYGMISPHDYTQ 574

Query: 536  ---------------------FAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPL 574
                                    +   S D+Q      RPEIDLDPS+VPV+PEP +P+
Sbjct: 575  QQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQV-----RPEIDLDPSIVPVVPEPTEPI 629

Query: 575  ENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPEL 634
            EN+L+L EETSFF++ KK +GN+Q+Y EFLK+LNLFSQDLI  +ELV KVE+YL G PEL
Sbjct: 630  ENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYLAGQPEL 689

Query: 635  FDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWE 694
            F+WFK+FV Y +KPK IENVIHEKHRLDLDLCEA  PSYKKLPK+DTFMPCSGRD+MCWE
Sbjct: 690  FEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGRDDMCWE 749

Query: 695  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIAN 754
            VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETIA+
Sbjct: 750  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIAS 809

Query: 755  KISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILK 814
            KI+NMT EEK  FKLPPGLGHTS+TIYKK+IRKVYDK+RGFEIID LHE+PA++VPI+LK
Sbjct: 810  KIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAITVPIVLK 869

Query: 815  RLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK 874
            RLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSIK
Sbjct: 870  RLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIK 929

Query: 875  VDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKG 934
            VDQ NKR++  TPKPK QLDY   D  ++FDI+ L + F+DH STYSNPDKE+L   F+ 
Sbjct: 930  VDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERLKDLFRV 989

Query: 935  FLSVFFSISYQEIENSTPADSD----------AVSNSNPRKRLWESEQPLKELLRSXXXX 984
            F+S+FF I    I  +    SD             +S  R R  + E  L ++L      
Sbjct: 990  FISLFFFIPRDLISAALDTKSDEGKSTDTKFEKADDSKKRPRP-DVELSLSDILHRAKYQ 1048

Query: 985  XXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRK 1044
                  + E   +S+D +  + + +  E  E   + A KPWL+G+I++ AN HG V++R 
Sbjct: 1049 KLK---NGEGLGMSEDDDEEKLAKEAEEMSE---KNASKPWLVGDIVERANSHGLVTDRA 1102

Query: 1045 IFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDM 1104
            ++NLF NTNVY+F RH +T+Y RL E+K M+E VT+EIN+R VVQFA+DLNL+STQL DM
Sbjct: 1103 VYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLNLLSTQLRDM 1162

Query: 1105 GLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAH 1164
            GLDF GK+AY + L L KRLIRN+++HQWFEESLRQAY NKAFK+YTVDKV+ SLVKHAH
Sbjct: 1163 GLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKVVHSLVKHAH 1222

Query: 1165 SIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCI 1224
            +++TD KS+E+M LFEKDR  ++T  K+QILYRL  RS+M  TENMFRV+ NKD+ HV I
Sbjct: 1223 TLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQYNKDTRHVSI 1282

Query: 1225 QYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQ---DDEEAD 1281
            QY+ +DD+TL++ +   +RW+YY+TSYAL HPTEGI  +++ VPFLE+ L+   D  + +
Sbjct: 1283 QYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILEFENDMLDVE 1342

Query: 1282 EGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEE 1341
             GS+  +P G S S L+I ++P++Y+L I+ GS DIF+R ++N +    ++     + E+
Sbjct: 1343 AGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDSKGYVQMVEK 1402

Query: 1342 KRKTLMSQLDGSRGWKKGMSQELVD 1366
            +++T    LDG  GWKK +S ++++
Sbjct: 1403 RKETAQKFLDGRFGWKKDLSDDVIN 1427

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 51/134 (38%), Gaps = 35/134 (26%)

Query: 11  SQTGTKSSVESPSLSEQQPVSGGMQGQAANSTGESKANAP---------VDASQQ----- 56
           +Q   + S++   L E +P   G++      +G+SK+ +P         V  SQ      
Sbjct: 6   NQNQQERSMDRRELLESRPAGDGVKKDVLGVSGDSKSVSPTSHYNISNSVSGSQHDTATK 65

Query: 57  -----------------PHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGS 99
                                 LPSLS L    R   G   Q +    G   Q   S  S
Sbjct: 66  AAAAAVTETGTGTGTGTSKHVTLPSLSALSHELRNSPGK--QDMARTSGGDGQRRKS--S 121

Query: 100 KGFSVASLNNPLPA 113
            GFS+ASL+NPLPA
Sbjct: 122 NGFSLASLDNPLPA 135

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1259 bits (3259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1348 (50%), Positives = 872/1348 (64%), Gaps = 130/1348 (9%)

Query: 139  DP-SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
            DP SYRPLN KDALSYLEQVKFQF+ RPD+YN FLDIMKD+KSQ IDT GVIER+S+LFK
Sbjct: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 198  GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257
            GYP LIQG NTFLPQGY+IEC+ NPNDP  IKVTTP           M +   ++   P 
Sbjct: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDP--IKVTTP-----------MGSSTTVLNTAPQ 287

Query: 258  LMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXAMPX 317
              PS           +  A + +L++  T  P+PT  +                      
Sbjct: 288  KSPSPSDIQTNNQQTQAIAQEAQLQSQAT--PIPTQHDVGQN------------------ 327

Query: 318  XXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEV 377
                   F   +   DVEFS AI+YVNKIKTRFADQP+IYK FLEILQTYQREQKPIHEV
Sbjct: 328  -------FGSAKKPADVEFSQAITYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEV 380

Query: 378  YAQVTSLFQNXXXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXSHYQN 437
            YAQVT LFQN               +A+                           ++   
Sbjct: 381  YAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQVQQQQHYQSLSDKMGGNAEAANY--- 437

Query: 438  ASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQN-LPPLGSFSPPING-------RENDPQL 489
            A+  ++  Q   ++P    V +   Q    Q  LPP+GSFSPP NG       +  +P+ 
Sbjct: 438  AASGMNA-QTGYYEPVKGGVSYNTQQNQHQQQNLPPIGSFSPPTNGPFVDQTQQSANPET 496

Query: 490  NLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGT-------------------LPLSDLRG 530
                +  P+M                  +   +                   +P+S+LR 
Sbjct: 497  QKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNSQQQVLSQNIHSNDDIPVSNLRT 556

Query: 531  -AMDGNFAPQPLQSQ---------DVQFI----EPTSRPEIDLDPSLVPVIPEPIKPLEN 576
              ++ N+ P+ +  Q         D  ++    E   RPEIDLDPSLVPV+PEP +P+EN
Sbjct: 557  TVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVRPEIDLDPSLVPVVPEPTEPIEN 616

Query: 577  DLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFD 636
             L L+EET+FF+R KK +GNKQ+Y EFLKILNLFS DL+  +ELVDKVE+Y+G + ELFD
Sbjct: 617  SLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDLLTVDELVDKVEYYIGANKELFD 676

Query: 637  WFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVL 696
            WFK FV Y +KPK IEN++HEKH+LDLDLCEA  PSYKKLPK DTFMPCSGRD+MCWEVL
Sbjct: 677  WFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYKKLPKTDTFMPCSGRDDMCWEVL 736

Query: 697  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKI 756
            NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIE+NLRTIQ LETIANKI
Sbjct: 737  NDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNLRTIQTLETIANKI 796

Query: 757  SNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRL 816
            +NMT  EK  F+LPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALH  PA+SVPIIL+RL
Sbjct: 797  ANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHNYPAISVPIILRRL 856

Query: 817  KQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVD 876
            KQKDEEWRRAQREWNK+WR+LEQKV++KSLDHLGLTFKQADKKLLT KQLISEI+ IKVD
Sbjct: 857  KQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEINGIKVD 916

Query: 877  QTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFL 936
            Q +KRI+  TPKPK+QLDYD  D  +LFDI+ L   F  +++ YSNPDKE++    + F+
Sbjct: 917  QNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFTINTNLYSNPDKERIKDMLRVFV 976

Query: 937  SVFFSISYQEIENS---------TPADSDAVSN----------------SNPRKRLWESE 971
            S FFSI  +E+ ++            DSD  S                 S+ +KR ++++
Sbjct: 977  SQFFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQIAEEIGETEQDTSSSKKRPFDND 1036

Query: 972  QPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNIL 1031
              + ++L          +   +      +    +++   IED   +  E +K WL+G+++
Sbjct: 1037 LNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVGTIEDSGSL-SEHRKQWLVGDVV 1095

Query: 1032 DEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFA 1091
            D AN    + NR I+NLFANTN+Y+FFRHL T+Y+RLSEVK +N+E+ +EI SR V  FA
Sbjct: 1096 DSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSEVKQINDEINKEIKSRRVTTFA 1155

Query: 1092 KDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYT 1151
            KDL L+STQLS++GLDF   DAY QLLTL KRLI  D++HQWFEES+RQAY N+AFK+YT
Sbjct: 1156 KDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIEHQWFEESIRQAYNNRAFKLYT 1215

Query: 1152 VDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMF 1211
            +DKV+QS VKHAH++I+D+K++EIM+LFE  R  T T+TK+QILYR+Q RS+M  TENMF
Sbjct: 1216 IDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTTKDQILYRIQCRSHMSSTENMF 1275

Query: 1212 RVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLE 1271
            R+E  ++  H  IQY+A+DDLTLK  +S ++ W+YY+TSY+LS+PTEG+PHE ++VPFLE
Sbjct: 1276 RIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTSYSLSNPTEGVPHENLEVPFLE 1335

Query: 1272 KTLQDDEE--ADEGSEER-SPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRF-- 1326
            K ++ D+E   D G+    S +G S SNL I ++ E Y L ++ GS D+++R  + ++  
Sbjct: 1336 KVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYNLILQGGSSDVYSRATIQKYPI 1395

Query: 1327 LNSSENN-SNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGKHES-L 1384
            + S E+  +N   K ++ + ++S  DG+            D      NY+  +G  +  +
Sbjct: 1396 VASDESRAANISEKTQEIRKVLSHYDGNSN----------DDVNEKFNYILANGTIDGYV 1445

Query: 1385 NKNPALVQGTRDPRHESSVAKEASSLES 1412
             ++ A+VQ T    ++ S  +  SS++S
Sbjct: 1446 RQSAAVVQETEKTYNDDS-GRNTSSIKS 1472

 Score = 33.5 bits (75), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 13/59 (22%)

Query: 59  QFVLPSLSGLDAGTRAEYGSEPQRL-PSLQGAQPQSISSGGSK----GFSVASLNNPLP 112
           + +LPS S L         +E  R+  S+    P+SI++  S     GFSVASL+NPLP
Sbjct: 60  RIILPSFSSLK--------TEDNRIDTSMNPIGPKSITTSSSTPASVGFSVASLDNPLP 110

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1154 (56%), Positives = 801/1154 (69%), Gaps = 98/1154 (8%)

Query: 329  RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNX 388
            + + DVEFS AI+YVNKIK RFA+QP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN 
Sbjct: 375  KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434

Query: 389  XXXXXXXXXXXXXXTAAHEXXXXXXXXXXXXXXXXXXXXXXXXXSHYQNASQDLDQRQQH 448
                          + +                           S Y N +     RQ  
Sbjct: 435  PDLLDDFKKFLPDSSPS-------ANRQQQQPGVLQQQSPAFGLSAYYNETSPPTSRQNL 487

Query: 449  THQPFGNTVP---------FYQTQQGRPQNLPPLGSFSPPINGRENDPQLNLPAVQPPAM 499
               P G+  P         +Y+ QQ +   LPP+      I+ R            PP +
Sbjct: 488  P--PLGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQR-----------SPPHI 534

Query: 500  EFAXXXXXXXXXXXXXXXIPGGTLPLSDLRGAMDGN--------FAPQPLQSQ------D 545
                              I G  +P+S+LR  +              Q + SQ      D
Sbjct: 535  --------------ATQGIAGEPMPVSNLRSQITAQSPSELAQLHQQQQIPSQPTANIPD 580

Query: 546  VQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLK 605
             Q+++   RPEIDLDPS+VPV+PEP  P+E+ LTL+EETSFFDRAKK++GNKQ+YTEFLK
Sbjct: 581  GQYLDIAVRPEIDLDPSIVPVVPEPTAPIEDSLTLVEETSFFDRAKKFIGNKQIYTEFLK 640

Query: 606  ILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDL 665
            ILNLFSQDL+  +ELV +VEHYLGG+ ELF WFK+FV + +KPKHIEN++HEKHRLDLDL
Sbjct: 641  ILNLFSQDLLDVDELVGRVEHYLGGNKELFVWFKNFVGFQDKPKHIENIVHEKHRLDLDL 700

Query: 666  CEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 725
            CEAC PSYKKLPK+DTFMPCSGRDEMCW VLNDEWVGHPVWASEDSGFIAHRKNQYEETL
Sbjct: 701  CEACGPSYKKLPKSDTFMPCSGRDEMCWAVLNDEWVGHPVWASEDSGFIAHRKNQYEETL 760

Query: 726  FKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVI 785
            FKIEEERHEYD+YIE+NLRTIQ LETIA+KI+NM+ EEK  FKLPPGLGHTS+TIYKKVI
Sbjct: 761  FKIEEERHEYDFYIESNLRTIQTLETIASKIANMSEEEKATFKLPPGLGHTSLTIYKKVI 820

Query: 786  RKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKS 845
            RKVYDK+RGFEIIDALHE PA++VP++LKRLKQKDEEWRRAQREWNKVWRELEQKV+YKS
Sbjct: 821  RKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKS 880

Query: 846  LDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFD 905
            LDHLGLTFKQADKKLLT KQLISEI SIK DQTNKR++  TPKPK QLDY + DK V FD
Sbjct: 881  LDHLGLTFKQADKKLLTTKQLISEIGSIKTDQTNKRMHWLTPKPKDQLDYYVPDKSVFFD 940

Query: 906  ILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEI--------------ENST 951
            IL L + FI+H+S+YSNPDK +L   FK F+S+FFSI   E+              E+ST
Sbjct: 941  ILSLTDTFINHNSSYSNPDKIRLKDLFKIFVSLFFSIPMYEVNEAVSRRGNLDDDKEDST 1000

Query: 952  -PADSDAVSNSNPRKRLWESEQPLKELL-RSXXXXXXXRDTSAEDDSISDDQNSPEKSPQ 1009
               +SD ++NS   KR  E E  L E+L R+       R   A D++  +        P+
Sbjct: 1001 QKMESDNLNNS---KRPREDEISLSEVLHRAKNQRFKSR---AADETSEESAAE--PEPE 1052

Query: 1010 EIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLS 1069
              E+EE IRQEAKKPWLLGN+++E N  G ++NRK FN+FANTN+YVFFRHLTT+Y+RL 
Sbjct: 1053 LNEEEETIRQEAKKPWLLGNLVEEVNAQGLINNRKTFNMFANTNIYVFFRHLTTLYERLE 1112

Query: 1070 EVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDM 1129
            EVK MN+ VT+EINSR VVQFAKDLNL+S QL +MGLDF+G DAY+QL  LCKRLI  D+
Sbjct: 1113 EVKKMNDAVTKEINSRKVVQFAKDLNLISQQLKEMGLDFEGADAYEQLRHLCKRLIEGDI 1172

Query: 1130 DHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATS 1189
            +HQWFEESLRQAY NKAFK+YTVDKVIQSLVKHAH+I+TD+K++EIM  FEKDR    TS
Sbjct: 1173 EHQWFEESLRQAYNNKAFKLYTVDKVIQSLVKHAHTILTDSKTSEIMTSFEKDRTQINTS 1232

Query: 1190 TKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLT 1249
             K+QILYRLQVRSYM  TENMFR+E NK S +V IQ++A+DDLTL EP SL+++W YY+T
Sbjct: 1233 AKDQILYRLQVRSYMSSTENMFRIEYNKQSKNVRIQFIAVDDLTLAEPRSLEEKWRYYVT 1292

Query: 1250 SYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGS-------EERSPSGHSLSNLRIQVN 1302
            SY+LSHPTEGI  EE+++PFLEK L+ +E  D GS       ++ SP G S S L+I+++
Sbjct: 1293 SYSLSHPTEGISQEELQLPFLEKVLETEE--DYGSDVDNFSIDKFSPEGVSKSTLKIKID 1350

Query: 1303 PESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQ 1362
            PE+Y L IE GS D+F+R +VNRF    ++N  T  KE+K+  ++  L+  +GWKK +  
Sbjct: 1351 PETYLLDIEAGSYDVFSRKSVNRFPVIVDSNDYTTKKEKKKNMVIQFLESKKGWKKNLDD 1410

Query: 1363 ELVDKTLTALNYVRLHGKHESLNKNPALVQGTR-------DPRHESSVAKEASSLESHAD 1415
            + V      L  V+ +G  +  N+     Q +        +   ES+VA + +SL     
Sbjct: 1411 DQVKAIQEKLARVKENGSLDDFNEASQTQQASEIIAPSKVEQSKESTVA-DVNSLPKELV 1469

Query: 1416 DTELKAGETTAEDI 1429
            + E +  +TTA+++
Sbjct: 1470 EAEDRGNDTTADEV 1483

 Score =  174 bits (440), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 110/270 (40%), Positives = 136/270 (50%), Gaps = 52/270 (19%)

Query: 31  SGGMQGQAANSTGESKANAP------VDASQQPHQFVLPSLSGLDAGTRAEYGSE----- 79
           +G  Q    ++ G +    P      +    +PH   LPS+S L +G  A  G +     
Sbjct: 39  NGMNQAVETSTVGLTGGKTPEMTKQEIKVESKPH-VTLPSISDL-SGESAHNGKDGLTSS 96

Query: 80  --PQRLPSLQGAQPQSISSGG----------------------SKGFSVASLNNPLPAXX 115
             P RLPS+Q          G                      S G S AS +NPLP   
Sbjct: 97  NTPLRLPSVQSTYGSKAPGAGQEVNGTIMESTVNPAPAQGRQNSVGLSFASFDNPLPPQQ 156

Query: 116 XXXXXXX--------XXXXXXXXXXXXEHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDV 167
                                      +   D  YRPLN KDALSYLEQVK+QFN+RPDV
Sbjct: 157 QTILSSSHFQVLPPHQQQQEQQQQMQQQMQHDAYYRPLNVKDALSYLEQVKYQFNSRPDV 216

Query: 168 YNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHS 227
           YNHFLDIMKD+KSQAIDT GVI+R+STLFKGYP LIQG NTFLPQGY+IEC+ NP++P  
Sbjct: 217 YNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQGFNTFLPQGYRIECSANPDEP-- 274

Query: 228 IKVTTPFDNARELNLATMATGNGIVEGHPS 257
           I+VTTP  ++     +   T    V G P+
Sbjct: 275 IRVTTPMGSS-----SVAGTIENAVAGFPA 299

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A++Y+ ++K +F  +PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 380 VEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 439

Query: 205 GLNTFLP 211
               FLP
Sbjct: 440 DFKKFLP 446

 Score = 39.3 bits (90), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 33/48 (68%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V  +V++LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

 Score = 33.5 bits (75), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 578 LTLIEETSFFDRAK-KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFD 636
           L + +  S+ ++ K ++     VY  FL I+  F    I T  ++D+V     G P L  
Sbjct: 194 LNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPGLIQ 253

Query: 637 WFKSFV 642
            F +F+
Sbjct: 254 GFNTFL 259

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1195 bits (3091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/951 (63%), Positives = 735/951 (77%), Gaps = 49/951 (5%)

Query: 469  NLPPLGSFSPPINGRENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLSDL 528
            NLPPLGSFS P    ++ P +NLP VQ P M                  +    +P+SDL
Sbjct: 488  NLPPLGSFSTP---GDHHP-MNLPLVQAPNMNL----NQGHPAHIITQGMSNQKIPISDL 539

Query: 529  RGAMDGNFAPQPL-QSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFF 587
            R   D ++ P    Q QD Q++E  +RPEIDLDPSLVPVIPEPIKPLE++L L+EE SFF
Sbjct: 540  RTTADTSYRPAEYSQGQDTQYMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFF 599

Query: 588  DRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEK 647
            D+AKKY+GNKQ+YTEFLKILNL+SQDL+  E LV+KV HYL G PELFDWFKSFV Y EK
Sbjct: 600  DKAKKYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEK 659

Query: 648  PKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA 707
            PKHIEN++HEKHRLDLDLCEAC PSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA
Sbjct: 660  PKHIENIVHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWA 719

Query: 708  SEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAF 767
            SEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMTPEEK  F
Sbjct: 720  SEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATF 779

Query: 768  KLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQ 827
            KLPPGLGHTS+TIYKKVIRKVYDKDRG+EIIDALHE PA++VPI+LKRLKQKDEEWRRAQ
Sbjct: 780  KLPPGLGHTSVTIYKKVIRKVYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQ 839

Query: 828  REWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTP 887
            REWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ NKRI+P TP
Sbjct: 840  REWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTP 899

Query: 888  KPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEI 947
            K KSQLD+D  D  V +DIL L   F+++++TYS PDKE+L  FFKGF+S+F S    +I
Sbjct: 900  KAKSQLDHDFTDPEVFYDILNLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQI 959

Query: 948  ENSTPADSDAVSNSN---------------------PRKRLWE-SEQPLKELLRSXXXXX 985
            E +  A  DA S+S                      P+KR  E S++ L+++L       
Sbjct: 960  EKAL-AKRDAASSSQSSNSNTETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQK 1018

Query: 986  XXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKI 1045
              R++   D SIS       +   ++E+EE+IRQEAK PWLLG+I+DEA++HG+V NRK 
Sbjct: 1019 GGRNSPRGDSSIS------AEKESDMEEEEIIRQEAKNPWLLGSIVDEADNHGHVENRKT 1072

Query: 1046 FNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMG 1105
            FNLFANTN+YVFFRHL T+Y+RL EVK MN+EVT+EI +R VVQFAKDLNL+STQL+DMG
Sbjct: 1073 FNLFANTNIYVFFRHLATIYERLVEVKKMNDEVTKEIANRKVVQFAKDLNLISTQLTDMG 1132

Query: 1106 LDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHS 1165
            LDFKG+DAY++LL L + LI  D++HQWFEESLRQAYKNKAFKIYTVDKVIQ+LVKHAH+
Sbjct: 1133 LDFKGEDAYEKLLQLSRSLIAGDLEHQWFEESLRQAYKNKAFKIYTVDKVIQALVKHAHA 1192

Query: 1166 IITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQ 1225
            IITD K+ EIM+LFEKDR   +TSTK+QILYRLQVRS M   ENMFR+E N+ + HVCIQ
Sbjct: 1193 IITDNKTVEIMMLFEKDRTSLSTSTKDQILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQ 1252

Query: 1226 YVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADEGSE 1285
            +VA+DDLTL+EP+SLKD+W YYLTSY+LSHPTEGI H+ ++ PFLEK ++ +E+  E  +
Sbjct: 1253 FVAVDDLTLEEPKSLKDKWQYYLTSYSLSHPTEGISHDNLRSPFLEKIIESEEDIIEDKD 1312

Query: 1286 ER-SPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRK 1344
            E+ SP G + SNL+++++P +Y +++E GS DIF+R AVN+F          D++++K  
Sbjct: 1313 EKYSPEGVATSNLKVKIDPITYSMEVEFGSHDIFSRKAVNKF------PVRVDIRKKKSS 1366

Query: 1345 TLMSQLD----GSRGWKKGMSQELVDKTLTALNYVRLHGKHESLNKNPALV 1391
             L  +L+     + GWKK +S + + +    L +V+L+G  E  + + A+ 
Sbjct: 1367 ELKLELERFLNSNSGWKKDLSAKQIAEVEKRLEFVKLNGNLEEYSDDSAVA 1417

 Score =  270 bits (689), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 187/350 (53%), Gaps = 26/350 (7%)

Query: 59  QFVLPSLS-GL-DAGTRAEYGSEPQRLPSLQGA----------QPQSISSGGSKGFSVAS 106
            + LPS+S GL  +G       +  RLP +Q                   G S GFS++S
Sbjct: 61  HYTLPSISAGLPGSGEHQHQQHDGSRLPPMQNTLAAAASAPPGGGGGGGGGVSNGFSMSS 120

Query: 107 LNNPLPAXXXXXXXXXXXXXXXXXXXXXE----HVQDPSYRPLNFKDALSYLEQVKFQFN 162
           L+NPLP                           H    SYRPLN KDALSYLEQVKFQFN
Sbjct: 121 LDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSYLEQVKFQFN 180

Query: 163 NRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNP 222
           +RPDVYNHFLDIMKD+KSQAIDT GVIER+STLF+GYP LIQG NTFLPQGY IEC+ +P
Sbjct: 181 SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSDP 240

Query: 223 NDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPSDDVSPPKLVGHEPAAVQPKLE 282
           NDP  IKVTTPF    E+ +             P   P            +PA V     
Sbjct: 241 NDP--IKVTTPFGTTGEVAIGGGGGSGVCGHVVPRAEPLQQQL---RQHQQPATVAEAAA 295

Query: 283 NAPTNLPVPTTFNXXX-----XXXXXXXXXXXXXXXAMPXXXXXXXXFMGNRPSGDVEFS 337
            A                                   MP          G + +GDVEFS
Sbjct: 296 AAAAAAGGGGGGAIAGGGPPPQAQTLVVYQSTDGSPTMPQRQPQDQFGTGGKKTGDVEFS 355

Query: 338 HAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
           HAISYVNKIKTRFADQP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 356 HAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 405

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 352 VEFSHAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 411

Query: 205 GLNTFLP 211
               FLP
Sbjct: 412 DFKKFLP 418

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/941 (60%), Positives = 717/941 (76%), Gaps = 36/941 (3%)

Query: 518  IPGGTLPLSDLRGAMDGNFAPQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLEND 577
            +P  T+PL+           PQ    Q+VQ+++   RPEIDLDPS+VPV+PEP +P+E+ 
Sbjct: 739  LPPQTIPLT-----QPSQLGPQ----QEVQYVDIAVRPEIDLDPSIVPVVPEPTEPIEDS 789

Query: 578  LTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDW 637
            L+L+EETSFFD+AKK++GNKQ+YTEFLKILNL+SQDL+  + LV+KVEHYLGGS ELF W
Sbjct: 790  LSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLVEKVEHYLGGSKELFTW 849

Query: 638  FKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLN 697
            FK+FV Y ++PK+IENVIHEKHRLDLD+CEA  PSYKKLPK+DTFMPCSGRDEMCWEVLN
Sbjct: 850  FKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDTFMPCSGRDEMCWEVLN 909

Query: 698  DEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKIS 757
            DEW+GHPVWASEDSGFIAHRKNQYEETLFK+EEERHEYD+YIE+NLRTIQ LETIA+KI+
Sbjct: 910  DEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIESNLRTIQTLETIASKIA 969

Query: 758  NMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLK 817
            NMT EEK  FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE+PAV+VP++LKRLK
Sbjct: 970  NMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEHPAVAVPVVLKRLK 1029

Query: 818  QKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ 877
            QKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ
Sbjct: 1030 QKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQ 1089

Query: 878  TNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLS 937
            TNKRI+  TPKPKSQLDYD  D+ +  DIL L   F++H+  YSN DKE+L  F K FLS
Sbjct: 1090 TNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYSNSDKERLKDFLKSFLS 1149

Query: 938  VFFSISYQEIEN-------STPADSDAVSNSNPR-----KRLWESEQPLKELLRSXXXXX 985
            +FFSI   E+ +       S   + +A    N       KR  E E PL+++L       
Sbjct: 1150 LFFSIPVSEVNDGLRRRSPSNKEEHEANKKENGTALAHGKRPREIELPLRDILHRNKYQK 1209

Query: 986  XXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKI 1045
                +  E+ SI   +   ++  +  E+EE+I+QEAKKPWLLGNI++EAN  G +SNRK 
Sbjct: 1210 LKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAKKPWLLGNIVEEANAQGIISNRKS 1269

Query: 1046 FNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMG 1105
            FNLFANT++YVFFRHLTT+Y+RL EVK++++EVT+EINSR V QFAKDLNL+S QL +MG
Sbjct: 1270 FNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEINSRKVSQFAKDLNLISEQLKNMG 1329

Query: 1106 LDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHS 1165
            LDF G DAY+QLL L KRLI  D++HQWFEESLRQAY N+AFK YTVDKV+Q+LVKHAH+
Sbjct: 1330 LDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAYNNRAFKFYTVDKVVQALVKHAHT 1389

Query: 1166 IITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQ 1225
            I+TD K +EIM+LFEKDR    TS K+QILYR+Q RS+M  TENMFR+E N+ S HVCIQ
Sbjct: 1390 ILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARSHMSNTENMFRIEFNRISKHVCIQ 1449

Query: 1226 YVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEADE--- 1282
            Y+AIDDLTL E +SL+D+W YY+TSY+LSHPTEGI HE+++VPFLEK ++ ++E DE   
Sbjct: 1450 YIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISHEDLQVPFLEKIIESEQEYDEDNG 1509

Query: 1283 GSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEK 1342
            G  + SP G S S+LRI+++PE+Y L++EPGS D+F+R AVN+F     + S+    ++K
Sbjct: 1510 GDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFSRKAVNKFPLEKNSESHKTKVDKK 1569

Query: 1343 RKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGKHESLN-KNPALVQGTRDPRHES 1401
             + +   LD  +GWKK +  + +      LN+V+ +G  +    +   L   T++     
Sbjct: 1570 NELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYGTLQGYRAQENGLESTTKEAPFSD 1629

Query: 1402 SVAKEASSLE----------SHADDTELKAG-ETTAEDIQG 1431
            +V ++A S            S+    E + G +TTAED++ 
Sbjct: 1630 AVERKADSAAQADGAANGGPSNTAGVEERGGNDTTAEDVEA 1670

 Score =  174 bits (442), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 93/173 (53%), Positives = 110/173 (63%), Gaps = 21/173 (12%)

Query: 88  GAQPQSISSGGSKGFSVASLNNPLPAXXXXXXXXXXXXXXXXXXXXXEH----------- 136
           G +P+S    GS G SVAS +NPLP                      +            
Sbjct: 212 GVKPRS----GSAGMSVASFDNPLPPSQPSVPSLHYQMLSSQQQQEQKGQDQQQQHQQQQ 267

Query: 137 ----VQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERI 192
               + D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVIER+
Sbjct: 268 QQIPLHDQYYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERV 327

Query: 193 STLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATM 245
           STLF+GYP LIQG NTFLPQGY+I+C+ NP++P  IKVTTP  ++    +A M
Sbjct: 328 STLFRGYPNLIQGFNTFLPQGYRIDCSQNPDEP--IKVTTPMGSSTVAGVAEM 378

 Score =  105 bits (263), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (91%)

Query: 329 RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
           + + DVEFS AISYVNKIK RF+DQP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQN
Sbjct: 515 KKAADVEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 573

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F+++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 520 VEFSQAISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLD 579

Query: 205 GLNTFLP 211
               FLP
Sbjct: 580 DFKKFLP 586

 Score = 39.7 bits (91), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 33/49 (67%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V  +V++LF+ 
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRG 333

 Score = 33.1 bits (74), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 550 EPTSRPEIDLDPSLVPVIPEPIKPLENDLT-------LIEETSFFDRAK-KYMGNKQVYT 601
           +PTS       P+  P +P P++P   D T         +  S+ ++ K ++     +Y 
Sbjct: 486 QPTSAVSSGTGPTQ-PEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYK 544

Query: 602 EFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFV 642
            FL+IL  + ++     E+  +V      +P+L D FK F+
Sbjct: 545 HFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFL 585

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/951 (59%), Positives = 705/951 (74%), Gaps = 62/951 (6%)

Query: 466  RPQNLPPLGSFSPPINGR--ENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTL 523
            +P NLPPLG+FS        EN   L       P+M                  +    +
Sbjct: 569  QPTNLPPLGNFSASGQASPAENSHML-------PSMHQHIAGGHVIPQHVVTQGMSNQDI 621

Query: 524  PLSDLRGAMDGNFA-----------PQPLQSQDVQFIE-PTSRPEIDLDPSLVPVIPEPI 571
            P+S++R  M+G +            PQPL+   VQ++E P +RPEIDLDPSLVPV+PEPI
Sbjct: 622  PVSEMRSTMNGTYNQVEYIQGAPGYPQPLEG--VQYMEAPMARPEIDLDPSLVPVVPEPI 679

Query: 572  KPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGS 631
            +P E+ + L +E +FF+R K+++GNKQVY EFLKILNL+SQDL+ T ELV KVE YL  S
Sbjct: 680  QPPEDAIALGDEVTFFERVKRFIGNKQVYAEFLKILNLYSQDLLTTSELVSKVEFYLHSS 739

Query: 632  PELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEM 691
             ELFDWFKSFV Y EKPKHIEN++HEKHRLDLDLCEAC PSYKKLPK DTFMPCSGRDEM
Sbjct: 740  KELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEM 799

Query: 692  CWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLET 751
            CWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYD+YIE+NLRTIQ LET
Sbjct: 800  CWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKVEEERHEYDFYIESNLRTIQTLET 859

Query: 752  IANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPI 811
            IANKI+NMT EEK  FKLPPGLGHTS+TIYKKV+RKVYDKDRGFEIIDALHE+PAV+VPI
Sbjct: 860  IANKIANMTNEEKNNFKLPPGLGHTSLTIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPI 919

Query: 812  ILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEIS 871
            +LKRLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEIS
Sbjct: 920  VLKRLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEIS 979

Query: 872  SIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAF 931
            SIKVDQTNKRI+P TPKPKSQLD+++ D+ VL+DIL LV  F+  +++YSN DK KL  F
Sbjct: 980  SIKVDQTNKRIHPLTPKPKSQLDFEINDREVLYDILDLVFTFVKTNASYSNSDKIKLDHF 1039

Query: 932  FKGFLSVFFSISYQEI-----------------ENSTPADSDAVSNSNPRKRLWESEQPL 974
            FK F+S+FFS   +++                 E+S  +DS+    SN R    E    +
Sbjct: 1040 FKAFISLFFSYPIKDVNEAVSERSSITDQENGEEDSNKSDSE---KSNKRTLSDEDSYLM 1096

Query: 975  KELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEA 1034
            K++LR        R  +A+  +  ++QNS      E ++ E++ +EA KPWLLG+++DEA
Sbjct: 1097 KDILR--------RTKNAKTSNSEENQNSSSVKSNEEDETELLAKEAAKPWLLGSLIDEA 1148

Query: 1035 NDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDL 1094
            N+ G VS+R IFNLF NT +YVFFRHL T+Y+RL EVK ++ EVT EI +R +VQFA DL
Sbjct: 1149 NNSGIVSDRHIFNLFTNTTIYVFFRHLNTLYERLLEVKKIDAEVTDEIKNRKIVQFASDL 1208

Query: 1095 NLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDK 1154
            NL+STQL+DMGL FK   AY +LL L KRLI  D+DHQWFEESLRQAYKNKAFKIYT+DK
Sbjct: 1209 NLISTQLADMGLAFKDTKAYGELLRLSKRLITGDLDHQWFEESLRQAYKNKAFKIYTIDK 1268

Query: 1155 VIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVE 1214
            V+QSLVKHAHSIITD K+A +M+LFE+DR    T+ K+QILYRL+VR+ MG +ENMFR+E
Sbjct: 1269 VVQSLVKHAHSIITDPKNAMVMVLFEQDRLKRDTTAKDQILYRLKVRNTMGESENMFRIE 1328

Query: 1215 INKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTL 1274
             N DS HV IQYVA+DDLTLKEP+++K++W YY+TSY+LSHPTEGI  E+I  PFL K +
Sbjct: 1329 YNTDSSHVSIQYVAVDDLTLKEPQNMKEKWDYYVTSYSLSHPTEGITQEDISQPFLGKII 1388

Query: 1275 QDDEEA---DEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSE 1331
            + + E    +E +++ SP G S S L++ ++PE+YEL  E GS D+FTR +VN+F +S  
Sbjct: 1389 EKEAEYLDDEEQNDKFSPEGVSQSKLKVNIHPETYELTFECGSTDVFTRKSVNKFPSSQS 1448

Query: 1332 NNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHGKHE 1382
                + + +         L+ S+GWKK +S E++ +  + +  ++  GK E
Sbjct: 1449 TQPASKMDKF--------LNSSKGWKKNLSTEIIGRAESKMKILKEQGKLE 1491

 Score =  170 bits (430), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/107 (73%), Positives = 91/107 (85%), Gaps = 2/107 (1%)

Query: 135 EHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERIST 194
           +  Q  SYRPLN KDALSYLEQVKFQF++RPDVYNHFLDIMKD+KSQAIDT GVI+R++T
Sbjct: 194 QQAQYSSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTT 253

Query: 195 LFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELN 241
           LF+G+P LIQG NTFLP GYKIEC+ NPNDP  IKVTTPF    E++
Sbjct: 254 LFQGFPNLIQGFNTFLPHGYKIECSTNPNDP--IKVTTPFGTTGEVS 298

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (59%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y  FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 425 VEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLD 484

Query: 205 GLNTFLP 211
               FLP
Sbjct: 485 DFKKFLP 491

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 34/48 (70%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A+SY+ ++K +F+ +P++Y HFL+I++ ++ +      V  +VT+LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1007 (56%), Positives = 729/1007 (72%), Gaps = 69/1007 (6%)

Query: 468  QNLPPLGSFSPPINGR--------ENDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIP 519
            QNLPPLG+FSPP NG           + Q ++ A+  P+M  A               + 
Sbjct: 471  QNLPPLGNFSPPSNGAVPGRPEEFSTEAQHHMMAL--PSMLQAPTEHAQLHAQQHIAPMT 528

Query: 520  GGTLPLSDLRGAMDGN-----FAPQPLQS----------------------QDVQFIEPT 552
               +P+SDLR  +  N     + P  L                        +     E  
Sbjct: 529  NEAIPISDLRSQIIDNNHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGI 588

Query: 553  SRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQ 612
             RPEIDLDPS+VPVIPEP +P+E  L+L+EE +FFD+AKK++GNKQVY EFLKILNL+SQ
Sbjct: 589  VRPEIDLDPSIVPVIPEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQ 648

Query: 613  DLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPS 672
            D++  ++L++KV++YLG + ELFDWFK+FV + +KPKHIENV+HEKH+LDLDLCEAC PS
Sbjct: 649  DILSLDDLIEKVDYYLGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPS 708

Query: 673  YKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 732
            YKKLPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER
Sbjct: 709  YKKLPKTDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEER 768

Query: 733  HEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKD 792
            HEYD+YIE+NLRTIQ LETIA+KI+NMT EEKQAFKLP GLGHTS TIY+KVIRKVYDK+
Sbjct: 769  HEYDFYIESNLRTIQTLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKE 828

Query: 793  RGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLT 852
            RGFEIIDALHE P+V+VP++LKRLKQKD+EWRRAQREWNKVWRELEQKVF+KSLDHLGLT
Sbjct: 829  RGFEIIDALHEYPSVAVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLT 888

Query: 853  FKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNN 912
            FKQ+DKKLLT KQL++EISSIKVDQTNKRI+  TPKPKSQLDY++KDK VLFDIL L + 
Sbjct: 889  FKQSDKKLLTTKQLLAEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADV 948

Query: 913  FIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSD----------AVSNSN 962
            FI+H+S+YSNPDKE+L  F + ++ +FFSI  +EI+++  A  D            S  N
Sbjct: 949  FINHTSSYSNPDKERLRDFLQSYIGLFFSIPIREIKDAVEAAIDNGKQLDENEQNSSKKN 1008

Query: 963  PRKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAK 1022
              KR  + E  L ++L             + + S+     SP ++ Q+  D E+IRQEAK
Sbjct: 1009 SNKRPRDVEICLSDILNRSRYQRLKHSLDSSEASLG--AVSPGQNEQDDMD-EMIRQEAK 1065

Query: 1023 KPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREI 1082
            KPWLLG++++EAN  G + NRKI+N+FAN N+YVF R+L T+Y RL EVK++N+ VT+EI
Sbjct: 1066 KPWLLGSLVEEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEI 1125

Query: 1083 NSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAY 1142
            N R VVQFAKDLNL+S QL +MGLDF G D+Y QLL L KRLI  D++HQWFEESLRQAY
Sbjct: 1126 NGRKVVQFAKDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAY 1185

Query: 1143 KNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRS 1202
            +N+AFK+YT+DKVIQSLVKHAH+I+TD+KS+++M LFEKDR  ++T++K+QILYRLQ RS
Sbjct: 1186 RNRAFKLYTIDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRS 1245

Query: 1203 YMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPH 1262
            +M  TE+MFR+E N     + IQY+A+DDLTL+EP++L+D+W YY+TSY+LSHPTEGIP 
Sbjct: 1246 HMSTTEHMFRIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQ 1305

Query: 1263 EEIKVPFLEKTLQDDE---EADEGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFT 1319
            EEIK+PFL+K ++ ++   E ++ + + SP G S SNL I+++PE+Y L++EPGS DIF+
Sbjct: 1306 EEIKIPFLDKVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFS 1365

Query: 1320 RFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRLHG 1379
            R +VN+F     + S    K+ +R    + L+G  GWK+ +S + + K     N +    
Sbjct: 1366 RKSVNKFPVDVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDL---- 1421

Query: 1380 KHESLNKNPALVQGTRDPRHESSVAKEASSLESHADDTELKAGETTA 1426
                  KN    Q +R      S   E +S+  +A D+  K  E+T 
Sbjct: 1422 ------KNGTFQQRSR------SATSETTSVPLNASDSTQKEQESTG 1456

 Score =  166 bits (419), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 94/136 (69%), Gaps = 7/136 (5%)

Query: 99  SKGFSVASLNNPLPAXXXXXXXXXXXXXXXXXXXXXEHVQDPSYRPLNFKDALSYLEQVK 158
           S   SVAS +NPLP                       +     YRPLN KDAL+YLEQVK
Sbjct: 83  STTLSVASFDNPLPPAPAAHLQQQQQQQQQQQQADGSY-----YRPLNVKDALTYLEQVK 137

Query: 159 FQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIEC 218
            QFN+RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP LIQG NTFLPQGY IEC
Sbjct: 138 LQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQGFNTFLPQGYTIEC 197

Query: 219 TLNPNDPHSIKVTTPF 234
           + NP+DP  IKVTTP 
Sbjct: 198 SSNPDDP--IKVTTPL 211

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 51/56 (91%)

Query: 332 GDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
            DVEFS A+SYVNKIK RFADQP+IYKHFLEILQTYQREQKPI EVYAQVT LFQN
Sbjct: 359 ADVEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQN 414

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 361 VEFSQAVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLD 420

Query: 205 GLNTFLP 211
               FLP
Sbjct: 421 DFKKFLP 427

 Score = 39.7 bits (91), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 33/48 (68%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A++Y+ ++K +F  +P+IY HFL+I++ ++ +      V  +V++LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1106 bits (2860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/910 (60%), Positives = 694/910 (76%), Gaps = 26/910 (2%)

Query: 468  QNLPPLGSFSPPINGRE-NDPQLNLPAVQPPAMEFAXXXXXXXXXXXXXXXIPGGTLPLS 526
            QNLPP+GSFSPP NG   ++   +   +QPP +                  I    LPLS
Sbjct: 570  QNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHL-MPLPSMVQHGANIVHQGIANENLPLS 628

Query: 527  DLRGAMDGNFAPQPLQSQDV---QFIEPTS---------RPEIDLDPSLVPVIPEPIKPL 574
            DLR ++   +AP  +Q Q     Q I P +         RPEIDLDPS+VPV+PEP +P+
Sbjct: 629  DLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPEIDLDPSIVPVVPEPTEPI 688

Query: 575  ENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPEL 634
            E++++L EE +FF++AK+Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ YLG + EL
Sbjct: 689  EDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKEL 748

Query: 635  FDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWE 694
            F WFK+FV Y E+ K IEN++HEKHRLDLDLCEA  PSYK+LPK+DTFMPCSGRD+MCWE
Sbjct: 749  FSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWE 808

Query: 695  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIAN 754
            VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTIQ LETI N
Sbjct: 809  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVN 868

Query: 755  KISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILK 814
            KI NMT  EK  FKLPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PAV+ P++LK
Sbjct: 869  KIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLK 928

Query: 815  RLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK 874
            RLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIK
Sbjct: 929  RLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIK 988

Query: 875  VDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKG 934
            VDQTNK+I+  TPKPKSQLD+D  DK +  DIL L ++FI H++ YSNPDKE+L    K 
Sbjct: 989  VDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKERLKDLLKY 1048

Query: 935  FLSVFFSISYQEIENSTPADSDAV---------SNSNPRKRLWESEQPLKELLRSXXXXX 985
            F+S+FFSIS +EIE S  A   +V          +S  RKR ++ E  L ++L       
Sbjct: 1049 FISLFFSISLEEIEESLQAYKQSVSESSGSDDGGSSVSRKRSYQQEMTLLDILHRSRYQK 1108

Query: 986  XXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKI 1045
              R +  ED  +     +P++    IE+EE+I +EAK PWL GN+++EAN  G + NR I
Sbjct: 1109 LKR-SKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTGNLVEEANSQGMIQNRGI 1167

Query: 1046 FNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMG 1105
            FNLFANTN+Y+FFRH TT+Y+RL E+K MNE+VT+EIN+R+ V FAKDL+L+S QLS+MG
Sbjct: 1168 FNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTVTFAKDLDLLSNQLSEMG 1227

Query: 1106 LDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHS 1165
            LDF G+DAY Q+L L +RLI  D++HQWFEESLRQAY N+AFK+YT+DKV QSLVKHAH+
Sbjct: 1228 LDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFKLYTIDKVTQSLVKHAHT 1287

Query: 1166 IITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQ 1225
            ++TDAK+AEIM LF KDR  T TS K QI+YRLQVRS+M  TENMFR+E +K + HV IQ
Sbjct: 1288 LMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQ 1347

Query: 1226 YVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEAD--EG 1283
            Y+A+DDLTLKEP+  +D+W YY+TSYAL HPTEG+ HE++K+PFLE+ ++  ++ D  + 
Sbjct: 1348 YIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIPFLERLIEFGQDIDGKDV 1407

Query: 1284 SEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKR 1343
             E+ SP G S+S L+I++ P +Y+L IE GS D+FTR + N++   + ++++ ++  +K+
Sbjct: 1408 DEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANKYPTVANDDTHKEVVVQKK 1467

Query: 1344 KTLMSQLDGS 1353
            + +   LD +
Sbjct: 1468 ELISRFLDCA 1477

 Score =  250 bits (638), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 162/254 (63%), Gaps = 14/254 (5%)

Query: 140 PSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGY 199
           P YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+GY
Sbjct: 227 PDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGY 286

Query: 200 PILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLM 259
           PILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP       N  +      I    PS +
Sbjct: 287 PILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTTTVNNNISPPERGTIDAQEPSSL 344

Query: 260 PSDDVSPPKLVGHEPAAVQPKLENAPTN------LPVPTTFNXXXXXXXXXXXXXXXXXX 313
           P  D +  +   H    V   + ++  N      LP+  T                    
Sbjct: 345 PEADGNGTQR-SHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQ 403

Query: 314 AMPXXXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKP 373
             P            + + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTYQREQKP
Sbjct: 404 IQPLAVQEDV-----KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKP 458

Query: 374 IHEVYAQVTSLFQN 387
           I+EVYAQVT LFQN
Sbjct: 459 INEVYAQVTHLFQN 472

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 419 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 478

Query: 205 GLNTFLP 211
               FLP
Sbjct: 479 DFKKFLP 485

 Score = 34.7 bits (78), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 18/117 (15%)

Query: 542 QSQDVQFIEPTSRPEIDLDPSL----VPV---IPEPIKPL--------ENDLTLIEETSF 586
           Q+QD Q + P S     L PS+    +PV   IP+ I+PL          D+   +  S+
Sbjct: 370 QNQDQQQVLPLSATSTGL-PSIQQSEIPVHHQIPQ-IQPLAVQEDVKKNVDVEFSQAISY 427

Query: 587 FDRAK-KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFV 642
            ++ K ++     +Y  FL+IL  + ++     E+  +V H    +P+L + FK F+
Sbjct: 428 VNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1088 bits (2814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/969 (57%), Positives = 704/969 (72%), Gaps = 50/969 (5%)

Query: 460  YQTQQGRPQ-NLPPLGSFSPPINGRENDPQL-NLPAVQPPAMEFAXXXXXXXXXXXXXXX 517
            + T  G PQ NLPP+GSFSPP NG        +   +QPP +                  
Sbjct: 554  HSTNGGIPQQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHL-MPLPSMVQQGPNMVHQG 612

Query: 518  IPGGTLPLSDLRGAMDGNFAPQPLQSQ-----------DVQFIEPTSRPEIDLDPSLVPV 566
            I    +PLSDLR ++   +AP   Q Q           D Q+ +   RPEIDLDPS+VPV
Sbjct: 613  IVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEIDLDPSIVPV 672

Query: 567  IPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEH 626
            +PEP +P+E++++L EE +FF++AK+Y+GNK +YTEFLKILNL+SQD++  ++LV+KV+ 
Sbjct: 673  VPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDF 732

Query: 627  YLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCS 686
            YLG + ELF WFK+FV Y EK K IENV+HEKHRLDLDLCEA  PSYK+LPK+DTFMPCS
Sbjct: 733  YLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCS 792

Query: 687  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTI 746
            GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYD+YIE+NLRTI
Sbjct: 793  GRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTI 852

Query: 747  QLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPA 806
            Q LETI NKI NMT  EK  FKLPPGLGHTSMTIYKKVIRKVYDK+RGFEIIDALHE+PA
Sbjct: 853  QCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPA 912

Query: 807  VSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQL 866
            V+ P++LKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQL
Sbjct: 913  VTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQL 972

Query: 867  ISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKE 926
            ISEISSIKVDQTNK+I+  TPKPKSQLD+D  DK + +DIL L ++FI H++ YSNPDKE
Sbjct: 973  ISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDKE 1032

Query: 927  KLAAFFKGFLSVFFSISYQEIENSTPA---------DSDAVSNSNPRKRLWESEQPLKEL 977
            +L      F+S+FFSI  ++IE +  +          SD   +S PRKR ++ E  L ++
Sbjct: 1033 RLKDLLNYFISLFFSIPLEKIEEALQSYKQNLSDSSGSDDGDSSTPRKRPYQQEMSLLDI 1092

Query: 978  LRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDH 1037
            L         R ++ ED  +       ++    IE+EE+I +EAK PWL GN+++EAN  
Sbjct: 1093 LHRSKYQKLKR-SNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLTGNLVEEANSQ 1151

Query: 1038 GYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLV 1097
            G + NR IFNLFAN+N+Y+FFRH TT+Y+RL E+K MNE+VT+EI+ R++V FAKDL+L+
Sbjct: 1152 GIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSMVTFAKDLDLL 1211

Query: 1098 STQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQ 1157
            S+QLS+MGLDF G+DAY Q+L L +RLI  +++HQWFEE LRQAY NKAFK+YT+DKVIQ
Sbjct: 1212 SSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAFKLYTIDKVIQ 1271

Query: 1158 SLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINK 1217
             LVKHAH+++TDAK+AEIM LF KDR  + TS K+QI+YRLQ RSYM  TENMFR+E ++
Sbjct: 1272 LLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNTENMFRMEFDR 1331

Query: 1218 DSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDD 1277
             + HV +QY+A+DDLTLKEP + +D+W YY+TSYAL HPTEGI HE++K+PFLE+ ++  
Sbjct: 1332 RNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKIPFLERLIEYG 1391

Query: 1278 EEAD--EGSEERSPSGHSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSN 1335
            ++ D  E  E+ SP G S+S L+I++ P +Y+L IE GS D+FTR A N++   + ++ +
Sbjct: 1392 QDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAANKYPTVANDDIH 1451

Query: 1336 ----------------------TDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALN 1373
                                   DL E K+ ++  +LD  +G       ++ DK   A N
Sbjct: 1452 KEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKG--ATTKADVDDKITVAKN 1509

Query: 1374 YVRLHGKHE 1382
               +  K E
Sbjct: 1510 EKAIEAKEE 1518

 Score =  255 bits (651), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 140/259 (54%), Positives = 164/259 (63%), Gaps = 23/259 (8%)

Query: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
           +DP YRPLN KDALSYLEQVKFQFN+RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 63  EDPDYRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 122

Query: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257
           GYPILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP       N  +    + +    PS
Sbjct: 123 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPMGTTTVNNNVSPPARSALEPQEPS 180

Query: 258 LMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXAMPX 317
            +P  D            +  P+  N P  +P     +                   +P 
Sbjct: 181 SLPEAD-----------GSTIPQSHNVPM-VPSNVYHSEQSQDQQQQPLPLLANPSGLPS 228

Query: 318 XXXXXXXFMGNRP---------SGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQ 368
                     ++P         + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTYQ
Sbjct: 229 IHQPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQ 288

Query: 369 REQKPIHEVYAQVTSLFQN 387
           REQKPI+EVYAQVT LFQN
Sbjct: 289 REQKPINEVYAQVTHLFQN 307

 Score = 53.1 bits (126), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 254 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 313

Query: 205 GLNTFLP 211
               FLP
Sbjct: 314 DFKKFLP 320

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/967 (56%), Positives = 705/967 (72%), Gaps = 71/967 (7%)

Query: 468  QNLPPLGSFSPPIN-GRENDPQLNLPAVQP-PAM---EFAXXXXXXXXXXXXXXXIPGGT 522
            Q+LPP+GSFSPP N G     Q   P +   P+M   E                 I    
Sbjct: 477  QSLPPIGSFSPPANTGISMHDQSQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDE 536

Query: 523  LPLSDLR------GAMD--GNFAPQPLQSQDV---------------------------- 546
            +P+SD+R      GA+   G +   P    D+                            
Sbjct: 537  IPVSDVRMAQYPNGAVPDYGQYPTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELL 596

Query: 547  -----QFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYT 601
                 Q++E   RPEIDLDPS+VPV+PEP +P+E++ TLIEETSFFD+AKK++ NKQ+YT
Sbjct: 597  EQQQQQYVEAPVRPEIDLDPSIVPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYT 656

Query: 602  EFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRL 661
            EFLK+LNLFSQDLI  ++LV+KVE+Y+G S ELF+WF++FV Y   PK IEN++HEKHRL
Sbjct: 657  EFLKVLNLFSQDLISVDDLVNKVEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRL 716

Query: 662  DLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 721
            DLDLCEAC PSYK+LPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQY
Sbjct: 717  DLDLCEACGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQY 776

Query: 722  EETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIY 781
            EETLFKIEEERHEYDYYIE+NLRTIQ LE I NKISNM+ EEK+ FKL PGLGHTS+TIY
Sbjct: 777  EETLFKIEEERHEYDYYIESNLRTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIY 836

Query: 782  KKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKV 841
            KKVIRKVYDK+RGFEIIDALHE+PA++ PI+LKRLKQKDEEWRRAQREWNKVWRELEQKV
Sbjct: 837  KKVIRKVYDKERGFEIIDALHEHPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKV 896

Query: 842  FYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKG 901
            ++KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ NKRI+  TPKPKSQL++D+KD  
Sbjct: 897  YFKSLDHLGLTFKQADKKLLTIKQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFE 956

Query: 902  VLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENS-----TPADSD 956
            +LFDIL L  NFI+HSSTYS  DKE+L  F K F+S+FFS+   EI N+        +S+
Sbjct: 957  ILFDILSLSENFINHSSTYSTSDKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSE 1016

Query: 957  AVSNS-------NPRKR-LWESEQPLKELL---RSXXXXXXXRDTSAEDDSISDDQNSPE 1005
             V++S       N +KR + + E  + ++L   +        R + +++++  D     E
Sbjct: 1017 KVTDSALPDGTENQKKRSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEE 1076

Query: 1006 KSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMY 1065
               +  E+ ++IRQ+AK+PWLLG+I+D+ N  G +++RK FNLFANTN+YVF RH TT+Y
Sbjct: 1077 SDERLAEEADLIRQDAKRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLY 1136

Query: 1066 QRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLI 1125
            +RL E+K MN EVT+EIN+R  V+FA+DL LVSTQL +MGLDF  KD+Y++LL L KRLI
Sbjct: 1137 ERLLELKEMNGEVTKEINNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLI 1196

Query: 1126 RNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRC 1185
             ND++HQWFEESLRQAY N+AFK+YTVDKV+Q+LVKH H+++TD K+ E+M LFEKDR  
Sbjct: 1197 ENDIEHQWFEESLRQAYNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLS 1256

Query: 1186 TATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWH 1245
            +ATS K+QILYRLQ RS+M  TE MFR+E NKD  ++CIQY+A+DDLTLKE  + +++W 
Sbjct: 1257 SATSAKDQILYRLQARSHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWK 1316

Query: 1246 YYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDE-------EADEGSEERSPSGHSLSNLR 1298
            YY+TSY+L HPTEGI HE +++PFL+K L+ D+       E ++ + + SP G S S  +
Sbjct: 1317 YYVTSYSLPHPTEGIDHESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYK 1376

Query: 1299 IQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQ-LDGSRGWK 1357
            I+++P +Y L I+ GS DIF+R ++N++     N  +  LK  K+K +++  L+ + GWK
Sbjct: 1377 IKIHPGNYALDIQTGSFDIFSRKSLNKY-PVKVNEDHESLKLNKKKNILNTFLESNNGWK 1435

Query: 1358 KGMSQEL 1364
            K + ++L
Sbjct: 1436 KHLKKQL 1442

 Score =  239 bits (610), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 155/367 (42%), Positives = 192/367 (52%), Gaps = 63/367 (17%)

Query: 40  NSTGESKANAPVDASQQPHQFVLPSLSGLDAGTRAEYGSEPQRLPSLQGAQPQSISSGGS 99
           N+ G ++ N+ +D+   P     P  S +   +     +  Q  PS     P  I++G  
Sbjct: 99  NTNGSNRKNSTMDSIMNPE----PPTSMVSKAS----TTNTQTTPSSSSVPP--INNGNV 148

Query: 100 K-----------GFSVASLNNPLPAXXXXXXXXXXXXXXXXXXXXXEHVQ--------DP 140
           K           G SVAS +NPLP                      + +         D 
Sbjct: 149 KVKNERAPFFGTGVSVASFDNPLPPLNQQQSQPSFPAMHMRDQQQQQQMAAAPAAAEDDA 208

Query: 141 SYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYP 200
           SYRPLN KDALSYLEQVK QFN+RPD+YN FLDIMKD+KSQ IDT GVIER+STLF+GYP
Sbjct: 209 SYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYP 268

Query: 201 ILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMP 260
            LIQG NTFLP GY+I+C  NPNDP  IKVTTP  ++    L  M     +   + +L  
Sbjct: 269 SLIQGFNTFLPTGYRIDCPSNPNDP--IKVTTPIGSS---TLHEMT--RSVQRANSNLQQ 321

Query: 261 SDDVSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXAMPXXXX 320
              +S   ++      +     NA  N  V +  +                         
Sbjct: 322 QQALSQNNMMQQAQIPIGSISNNANLNAAVQSVDDQAK---------------------- 359

Query: 321 XXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQ 380
                  N+   DVEFS AI+YVNKIK RFADQP+IYK+FLEILQTYQREQKPI+EVYAQ
Sbjct: 360 -----QANKKPADVEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQ 414

Query: 381 VTSLFQN 387
           VT LFQN
Sbjct: 415 VTILFQN 421

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 42/71 (59%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A++Y+ ++K +F ++PD+Y +FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 368 VEFSQAINYVNKIKNRFADQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLD 427

Query: 205 GLNTFLPQGYK 215
               FLP   K
Sbjct: 428 DFKKFLPDSSK 438

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 578 LTLIEETSFFDRAKKYMGNK-QVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFD 636
           L + +  S+ ++ K+   ++  +Y +FL I+  F    I T  ++++V     G P L  
Sbjct: 213 LNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFRGYPSLIQ 272

Query: 637 WFKSFV 642
            F +F+
Sbjct: 273 GFNTFL 278

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/842 (60%), Positives = 666/842 (79%), Gaps = 20/842 (2%)

Query: 554  RPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQD 613
            RPEIDLDPS+VPVIPEP++P+E+ L+L+EET+FFD+AKK++ NKQ+Y EFLKILNL+SQ+
Sbjct: 623  RPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNLYSQN 682

Query: 614  LIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEACFPSY 673
            ++   ELV+KV++YLG + ELFDWFK FV Y +KPKHIEN++HEKH+LDLDLCEA  PSY
Sbjct: 683  ILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAYGPSY 742

Query: 674  KKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 733
            KKLPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH
Sbjct: 743  KKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERH 802

Query: 734  EYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDR 793
            EYD+YIE+NLRTIQ LETIA+KI+NMT EE+  FKLP GLGHTS+TIY+KVIRKVY K+R
Sbjct: 803  EYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVYGKER 862

Query: 794  GFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTF 853
            GFE+IDALHE PAV+VPIILKRLKQKDEEWRRAQREWNKVWREL+QKV+YKSLDHLGLTF
Sbjct: 863  GFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHLGLTF 922

Query: 854  KQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNF 913
            KQADKKLLT KQLISEISSIKVDQTNK+++  TPKPKSQLDY + D+ +L+DIL L + F
Sbjct: 923  KQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKLTDVF 982

Query: 914  IDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIE---------NSTPADSDAVSNSN-- 962
            I+H+S YSNPDKE+L  F + F+S+FF I   +I+         + T  DS+  S  +  
Sbjct: 983  INHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPLDDTKTDSEESSGDSDK 1042

Query: 963  -PRKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNSPEKSPQEIEDEEVIRQEA 1021
             P+KR  E +      +         +    ++++ S+D +    S   ++D+E+IRQEA
Sbjct: 1043 FPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDIS----SATSVDDDELIRQEA 1098

Query: 1022 KKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQRLSEVKNMNEEVTRE 1081
            +KPWLLG+I+D+AN  G + NR  +N+F NTN+YVF RHL T+Y+RL+E K MN EVT E
Sbjct: 1099 QKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQMNAEVTEE 1158

Query: 1082 INSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRNDMDHQWFEESLRQA 1141
            I +R++V FAKDLNLVSTQL +MGLDF+G D+Y QLL L  RLI  +++H WFEESLRQA
Sbjct: 1159 IKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWFEESLRQA 1218

Query: 1142 YKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTATSTKEQILYRLQVR 1201
            ++NKAFK+YT+DKV QS+VKHAH+I++D K+AEIM+L EKDR C  TS+K+QILYRLQ R
Sbjct: 1219 FRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQILYRLQAR 1278

Query: 1202 SYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYYLTSYALSHPTEGIP 1261
            S+M  T+NMFR+E NK S ++ IQY+ +DDLTL EP++ +++W YY+TSYALSHPTEG+P
Sbjct: 1279 SHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALSHPTEGVP 1338

Query: 1262 HEEIKVPFLEKTLQDDEEADEG----SEERSPSGHSLSNLRIQVNPESYELQIEPGSKDI 1317
             EEI++PFLEK L+ +E   E     +++ SP G S S+L+I+++PE+Y L+IEPGS D 
Sbjct: 1339 QEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEIEPGSFDT 1398

Query: 1318 FTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGWKKGMSQELVDKTLTALNYVRL 1377
            F+R ++N++     ++   + K+     + + L+G  GWK+ +S++ ++      ++++ 
Sbjct: 1399 FSRLSMNKYPIDVTSDDYKNKKKLSIDRVNAFLNGKFGWKQSLSEDEINNINLKYSHIKK 1458

Query: 1378 HG 1379
            +G
Sbjct: 1459 YG 1460

 Score =  163 bits (413), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 75/93 (80%), Positives = 83/93 (89%), Gaps = 2/93 (2%)

Query: 142 YRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPI 201
           YRPLN KDAL+YLEQVK QF++RPD+YNHFLDIMKD+KSQ+IDT GVIER+STLF+GYP 
Sbjct: 142 YRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPS 201

Query: 202 LIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPF 234
           LIQG NTFLPQGY IECT NPNDP  IKVTTP 
Sbjct: 202 LIQGFNTFLPQGYTIECTNNPNDP--IKVTTPI 232

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 50/56 (89%)

Query: 332 GDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
            DVEFS A+SYVNKIK RF D+P+IYK FLEILQTYQ+EQKPIHEVY+QVT LFQN
Sbjct: 350 ADVEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQN 405

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 39/67 (58%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F + PD+Y  FL+I++ Y+ +      V  +++ LF+  P L+ 
Sbjct: 352 VEFSQAVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLD 411

Query: 205 GLNTFLP 211
               FLP
Sbjct: 412 DFKKFLP 418

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 34/48 (70%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A++Y+ ++K +F+ +P+IY HFL+I++ ++ +      V  +V++LF+
Sbjct: 150 ALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1056 bits (2732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/839 (61%), Positives = 648/839 (77%), Gaps = 34/839 (4%)

Query: 550  EPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNL 609
            E  +RPEIDLDPS+VP+IPEP +P+EN++TL+EETSFF++ KK++ +K +Y EFLK+LNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 610  FSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDLDLCEAC 669
            +SQDL+ T ELV +V++Y+G + ELFDWFK+FV Y E P  IEN+IHEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 670  FPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 729
             PSYKKLPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 730  EERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKKVIRKVY 789
            EERHEYD++IE+NLRTIQ LETIANKI+NMT EEK+ FKLP GLGHTS TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 790  DKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 849
            DK+RGFEIIDALHE+PA +VPIIL+RLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 850  GLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVLFDILCL 909
            GLTFKQADKKLLT KQLISEISSI+VDQ NKRI+  TPKPKSQLD+   D  +L DIL L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 910  VNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPADSD------------- 956
             N FIDH+STYSN +KE+L  F + F+ +FFSI   EI+      +D             
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSST 1132

Query: 957  AVSNSNPRKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDDQNS---------PEKS 1007
            + S  + +KR  E + PL ++LR             E ++ S++ +            + 
Sbjct: 1133 SNSTPSAKKRSLELDIPLADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDEELKRQQ 1192

Query: 1008 PQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQR 1067
             ++ E++ +I +E KKPWLLG+++D+ ++HG + NR IFNLFANTN+YVFFRH TT+Y+R
Sbjct: 1193 QEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHWTTIYER 1252

Query: 1068 LSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIRN 1127
            L E+K +N++VTREINSR V  FAKDL L+STQL+ MGLDFK  D+Y +LL L KRLI+N
Sbjct: 1253 LLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLTKRLIKN 1312

Query: 1128 DMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCTA 1187
            D++HQWFEESLRQAY NKAFK+YT DKVIQ+LVKHA+SI+TD+K++EIM LFEKDR  ++
Sbjct: 1313 DIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEKDRLRSS 1372

Query: 1188 TSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHYY 1247
            T+T++QI+YRLQ R++M  TENMFR+E N+++ HVCIQY+A++DLTLK   + K+ W YY
Sbjct: 1373 TTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTKETWEYY 1432

Query: 1248 LTSYALSHPTEGIPHEEIKVPFLEKTLQ----------DDEEADEGSEERSPSGHSLSNL 1297
            +TSYAL HPTEG+P E +KVPFLEK L           ++ E +E  E+ SP G S S L
Sbjct: 1433 VTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEGISTSKL 1492

Query: 1298 RIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGW 1356
            +I+++ E+Y L +EPGS D+F+R ++N+F   ++   ++   +EK +     L   RGW
Sbjct: 1493 KIKIDQETYNLDVEPGSFDVFSRKSLNKFPTDAKKIESS--IKEKSEAFNKFLSSKRGW 1549

 Score =  161 bits (407), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 75/112 (66%), Positives = 88/112 (78%), Gaps = 2/112 (1%)

Query: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
           +DP YRPLN KDALSYLEQVK QFN++P +YN FLDIMKD+KSQ IDT GVIER+STLFK
Sbjct: 266 EDPEYRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

Query: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGN 249
           GYP+LIQG NTFLPQGY I C+ NP+DP  ++VTTP   +   NL  +   N
Sbjct: 326 GYPVLIQGFNTFLPQGYTIHCSDNPDDP--VRVTTPMGTSTYTNLPNVDNTN 375

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%)

Query: 333 DVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
           +VEFS AI+YVNKIKTR+ADQP IYKHFLEILQTYQRE+KPI EVY QVT LF +
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFND 518

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 42/68 (61%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A++Y+ ++K ++ ++P +Y HFL+I++ Y+ +      V E+++ LF   P L++
Sbjct: 465 VEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLE 524

Query: 205 GLNTFLPQ 212
               FLP+
Sbjct: 525 DFKKFLPE 532

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V++LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/923 (56%), Positives = 682/923 (73%), Gaps = 41/923 (4%)

Query: 544  QDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEF 603
            Q V + E   RPEIDLDPSLVP++PEP +P+E+ L L+EET+FFD+ KKY+GNK +Y EF
Sbjct: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880

Query: 604  LKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHIENVIHEKHRLDL 663
            LK+LNL+S DL+  +ELV+K+++YL  + ELF WFK+FV YVEKPKHIEN++HEKH+LDL
Sbjct: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940

Query: 664  DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEE 723
            DLCEAC PSYKKLPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   ++
Sbjct: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000

Query: 724  TLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPPGLGHTSMTIYKK 783
               +++++ HEYD+YIE+NLRTIQ LETIA+KI+NMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060

Query: 784  VIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWNKVWRELEQKVFY 843
            VIRKVYDK+RGFEIIDALHE PA++VP++LKRLKQKDEEWRRAQREWNKVWRELEQKVF+
Sbjct: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120

Query: 844  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKSQLDYDLKDKGVL 903
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQT+KR++  TPKPKSQLD++L DK ++
Sbjct: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180

Query: 904  FDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIENSTPA---------- 953
            FDIL  V  F++H+STYSNP+KE+L  F K F S+FFSI  +EI+ +             
Sbjct: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRDITEKNDEK 1240

Query: 954  --DSDAVSNSNPRKRL-WESEQPLKELL-RSXXXXXXXRDTSAEDDSIS---DDQNSPEK 1006
              D       N +KR   +    L+++L R+        D S E D      DDQ     
Sbjct: 1241 LEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDDQ----- 1295

Query: 1007 SPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANTNVYVFFRHLTTMYQ 1066
              + +E+EE++RQEAKKPWLLG +++EAN  G + +R IFN+F+NTN+Y+F RHLTTMY+
Sbjct: 1296 --KLLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYE 1353

Query: 1067 RLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKDAYDQLLTLCKRLIR 1126
            RL E+K MN++V+REI+ R + +FAKDLNL+STQL++MGLDF   D Y QLL LCKRLI 
Sbjct: 1354 RLHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLIL 1413

Query: 1127 NDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEIMILFEKDRRCT 1186
             D++HQWFEESLRQA+ NKAFK+YT+DKV Q+LVKHAH+II+D K+ EIM LFEKDR   
Sbjct: 1414 GDLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKN 1473

Query: 1187 ATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLKEPESLKDRWHY 1246
            +TS+K+QILYRLQ R+ M   ENMFR+E N  + H+CIQY+A+DDLT+K+ ++L+++W Y
Sbjct: 1474 STSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKY 1533

Query: 1247 YLTSYALSHPTEGIPHEEIKVPFLEKTLQ----------DDEEADEGSEERSPSGHSLSN 1296
            Y+TSYALSHPTEGI  E I++PFLE+ ++          DD++  +   + SP G S S 
Sbjct: 1534 YITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGST 1593

Query: 1297 LRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDGSRGW 1356
            L+I+++P++Y L IE GS DIF+R ++N+F      +S      + + T+   L+   GW
Sbjct: 1594 LKIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGW 1653

Query: 1357 KKGMSQELVDKTLTALNYVRLHGKHESLNKNPAL--VQGTR----DPRHESSVAKEASSL 1410
            K+ +S++ ++   +  +++  +G  E   +   L  V GT      P    +V + A+ +
Sbjct: 1654 KRAISKDQMESIESKWDHLSNNGNLEGYQEKSILKDVNGTDISKISPMKTFTVTESANGV 1713

Query: 1411 ESHADDTELKAGETTAEDIQGNE 1433
             +   D E +  +TTAE++ GNE
Sbjct: 1714 PNDKADGEERGNDTTAEEV-GNE 1735

 Score =  157 bits (398), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 81/97 (83%), Gaps = 2/97 (2%)

Query: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
           +D  YRPLN KDALSYLEQVKFQFN+RPDVYNHFLDIMKD+KSQAIDT GVI R+S+LF 
Sbjct: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354

Query: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPF 234
            YP LIQG NTFLPQGY+IEC+ NPN P  I V TP 
Sbjct: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLP--ITVITPM 389

 Score =  101 bits (252), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/58 (82%), Positives = 52/58 (89%)

Query: 329 RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQ 386
           R + DVEFS AISYVNKIK RFA+QP IYKHFLEILQTYQREQKPI+EVY+QVT LFQ
Sbjct: 538 RRTQDVEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQ 595

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 66/143 (46%), Gaps = 21/143 (14%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F N+P +Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 543 VEFSQAISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLE 602

Query: 205 GLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPSLMPSDDV 264
               FLP         + N+  SI VT+  +N            NG  +  P L P  ++
Sbjct: 603 DFKKFLPDS-------SANNNGSI-VTSQEEN--------FMYANGFNQQQPHLTPHSEI 646

Query: 265 SPPKL-----VGHEPAAVQPKLE 282
               L        +P  V PK E
Sbjct: 647 QAQNLPPLGSFSTQPNGVFPKQE 669

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 34/49 (69%)

Query: 339 AISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQN 387
           A+SY+ ++K +F  +P++Y HFL+I++ ++ +      V A+V+SLF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
            {ON} weakly similar to uniprot|P22579 Saccharomyces
            cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  345 bits (884), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 244/787 (31%), Positives = 393/787 (49%), Gaps = 95/787 (12%)

Query: 596  NKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVN-YVEKPKHIENV 654
            ++ +Y EFLK++NLF+Q LI       +   + G    L   F + ++ Y +  + ++  
Sbjct: 216  DESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPT 275

Query: 655  IHEKHRLDL-DLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGF 713
            +      D+ D      PSYK+L   +T   C GRD +C EVLNDEWVGHPVWASE+ GF
Sbjct: 276  LKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVGF 335

Query: 714  IAHRKNQYEETLFKIEEERHEYDYYI-------------EANLRTIQLLETIANKISNMT 760
            IAH+KNQYEETLFK+EEERHEYD+++             E +L+  +      N++S  +
Sbjct: 336  IAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVS--S 393

Query: 761  PEEKQAFKLPPGLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKD 820
            P+E       P +   S+T  +KVIR++Y  + G  +IDA+  NP   VP ILK  K+K 
Sbjct: 394  PKE-------PMISLNSIT--EKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKY 444

Query: 821  EEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNK 880
            ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK A+K+ L  KQL+ E  S K D+  K
Sbjct: 445  QQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLK 504

Query: 881  RIYPFTPKPKSQLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFF 940
              Y        +  Y+  DK VL+D+  ++   +  +S+ S   K      F+ F  + F
Sbjct: 505  EHY-----DNYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLF 559

Query: 941  SISYQEIENSTPADSDAVSNSNPRKRLWESEQPLKELLRSXXXXXXXRDTSAEDDSISDD 1000
                   E+S     D     NP                                +IS +
Sbjct: 560  E------ESSFTKHLDFQFCHNP--------------------------------AISSN 581

Query: 1001 QNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGY---VSNRKIFNLFANTNVYVF 1057
                E   + +  + ++ ++    W        +ND       SNR+  N+F + N+   
Sbjct: 582  SQISEDDVEAMFMKGILEEKGLGRWF-------SNDTELKKEFSNRQNINIFCDINIMSL 634

Query: 1058 FRHLTTMYQRLSEVKNMNEEVTREINS--RNVVQFAKDLNLVSTQLSDMGLDFKGKDAYD 1115
            F ++ T+Y+R ++VK     + +++ +  R     AK L L+  QLSD GL+    D Y+
Sbjct: 635  FHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSDNGLELGQDDGYE 694

Query: 1116 QLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKSAEI 1175
             + T  K+ +  ++DHQWFEESLR  ++NKA+K+YT+D+VI++++    +I       +I
Sbjct: 695  WIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILGVITTISQTPSLLQI 754

Query: 1176 MILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDLTLK 1235
            + L   + +   T+  +Q+ YR +VR  M    +MFR+EI +DS  +  QY+ +DDL   
Sbjct: 755  LDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDSNAIYGQYIGVDDLLHA 814

Query: 1236 EPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEEAD---EGSEERSPSGH 1292
            + +  K     Y   Y  +  T+ +  + +  P+    L   EE +          P   
Sbjct: 815  QLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKREEQNIPFMNGNIYKP--- 871

Query: 1293 SLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEKRKTLMSQLDG 1352
               +L + +NP  Y + I PGS DI +   + +  +S +++  T +      +L+S++  
Sbjct: 872  ---HLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKTQM-----ASLISKIAK 923

Query: 1353 SRGWKKG 1359
            +R  ++ 
Sbjct: 924  NRKQQRA 930

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
           (REAL)
          Length = 1555

 Score =  257 bits (657), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 165/260 (63%), Gaps = 22/260 (8%)

Query: 138 QDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFK 197
           +DP YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+
Sbjct: 220 EDPDYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR 279

Query: 198 GYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHPS 257
           GYPILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP      +N     +G G V+G   
Sbjct: 280 GYPILIQGFNTFLPQGYRIECSTNPDDP--IRVTTPM-GTTTVNNNVSPSGRGTVDGQ-- 334

Query: 258 LMPSDDVSPPKLVGHEPAAVQP--KLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXAM 315
                   P  L   +  A+QP   L   P+N+                           
Sbjct: 335 -------EPSSLSEPDGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHP 387

Query: 316 PXXXXXXXXFMGN--------RPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTY 367
           P          G         + + DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTY
Sbjct: 388 PEIPPHHQILQGQSLPVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTY 447

Query: 368 QREQKPIHEVYAQVTSLFQN 387
           QREQKPI+EVYAQVT LFQN
Sbjct: 448 QREQKPINEVYAQVTHLFQN 467

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 414 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 473

Query: 205 GLNTFLP 211
               FLP
Sbjct: 474 DFKKFLP 480

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}
           SIN3Component of the Sin3p-Rpd3p histone deacetylase
           complex, involved in transcriptional repression and
           activation of diverse processes, including mating-type
           switching and meiosis; involved in the maintenance of
           chromosomal integrity
          Length = 1536

 Score =  246 bits (628), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 159/253 (62%), Gaps = 10/253 (3%)

Query: 139 DPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKG 198
           D  YRPLN KDALSYLEQVKFQF++RPD+YN FLDIMKD+KSQAIDT GVIER+STLF+G
Sbjct: 213 DADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRG 272

Query: 199 YPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTPFDNARELNLATMATGNGIVEGHP-S 257
           YPILIQG NTFLPQGY+IEC+ NP+DP  I+VTTP      +N     +G G  +     
Sbjct: 273 YPILIQGFNTFLPQGYRIECSSNPDDP--IRVTTPMGTTT-VNNNISPSGRGTTDAQELG 329

Query: 258 LMPSDD---VSPPKLVGHEPAAVQPKLENAPTNLPVPTTFNXXXXXXXXXXXXXXXXXXA 314
             P  D   V  P  V   P++V    +N      +P                       
Sbjct: 330 SFPESDGNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIP 389

Query: 315 MPXXXXXXXXFMGNRPSGDVEFSHAISYVNKIKTRFADQPEIYKHFLEILQTYQREQKPI 374
                        N    DVEFS AISYVNKIKTRFADQP+IYKHFLEILQTYQREQKPI
Sbjct: 390 QSQSLVPQEDAKKNV---DVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPI 446

Query: 375 HEVYAQVTSLFQN 387
           +EVYAQVT LFQN
Sbjct: 447 NEVYAQVTHLFQN 459

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 42/67 (62%)

Query: 145 LNFKDALSYLEQVKFQFNNRPDVYNHFLDIMKDYKSQAIDTLGVIERISTLFKGYPILIQ 204
           + F  A+SY+ ++K +F ++PD+Y HFL+I++ Y+ +      V  +++ LF+  P L++
Sbjct: 406 VEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLE 465

Query: 205 GLNTFLP 211
               FLP
Sbjct: 466 DFKKFLP 472

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 3/92 (3%)

Query: 593 YMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNY---VEKPK 649
           Y G K +Y ++LK+LN   QD     + V+  +     S ++ ++  + + Y    E+ K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 650 HIENVIHEKHRLDLDLCEACFPSYKKLPKADT 681
           +I+N IH K    L      F +   L   D+
Sbjct: 140 YIDNFIHSKDAQKLSKSTQVFDAIVNLCLLDS 171

>TPHA0K01780 Chr11 complement(376528..378828) [2301 bp, 766 aa] {ON}
           Anc_4.78 YGR009C
          Length = 766

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 15/23 (65%)

Query: 465 GRPQNLPPLGSFSPPINGRENDP 487
           GRPQNL P  S S P N R NDP
Sbjct: 94  GRPQNLDPYASNSTPSNNRNNDP 116

>CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] {ON}
            similar to uniprot|P19812 Saccharomyces cerevisiae
            YGR184c UBR1
          Length = 1965

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 53/118 (44%), Gaps = 20/118 (16%)

Query: 565  PVIPEPIKPLENDLTLIEETSFFDRAKKYMGNKQVYTEFLKILNLFSQDLI------GTE 618
            P+I + +  +E+D+++ +  SF + A   +      TEF    ++F Q L+      G +
Sbjct: 1622 PLIIDDVN-IESDISIEDYVSFANSATPLL------TEFTDFDDMFVQALLDSKFTEGND 1674

Query: 619  ELVDKVEHYLGGSPELFDWFKSFVNYVEKPKH-------IENVIHEKHRLDLDLCEAC 669
              +  + H   G  +L +  K    YV   K        + NVI+ K+RLD  +C  C
Sbjct: 1675 TYLKDIPHEYPGVVKLINLKKYLNTYVTDSKQFKLLEEALTNVINPKNRLDFRICLTC 1732

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 152,812,284
Number of extensions: 7110638
Number of successful extensions: 22691
Number of sequences better than 10.0: 73
Number of HSP's gapped: 23411
Number of HSP's successfully gapped: 168
Length of query: 1433
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1311
Effective length of database: 39,492,147
Effective search space: 51774204717
Effective search space used: 51774204717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)