Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10604g6.45ON51551525900.0
Kwal_56.225226.45ON51352115150.0
SAKL0E01958g6.45ON52452312221e-163
TDEL0G042506.45ON5175229571e-123
ZYRO0C07194g6.45ON5585658921e-113
TPHA0F024806.45ON6056027822e-96
Skud_15.1486.45ON5484847764e-96
YOL013C (HRD1)6.45ON5514827642e-94
TBLA0B005606.45ON4925177584e-94
Smik_15.1576.45ON5504057522e-92
Suva_15.1596.45ON5504047321e-89
KAFR0A052406.45ON5535537093e-86
Kpol_1035.506.45ON6015797091e-85
KLLA0C05874g6.45ON5535536921e-83
NCAS0D020106.45ON5104886785e-82
CAGL0E02299g6.45ON5454476422e-76
NDAI0C027706.45ON6305026352e-74
KNAG0E027406.45ON5564315987e-70
ACL019C6.45ON5755675911e-68
Ecym_30486.45ON6704044867e-53
KLTH0G12408g8.317ON603451171e-05
Skud_11.1922.545ON758681152e-05
YKL034W (TUL1)2.545ON7581131153e-05
Suva_11.1892.545ON758541143e-05
Smik_11.2132.545ON759681134e-05
Kwal_26.80992.545ON7501081134e-05
Kwal_56.239008.317ON5891081125e-05
Skud_4.4028.317ON612801091e-04
KLTH0D07216g2.545ON7471081091e-04
AFR275W2.545ON753541091e-04
Kwal_27.105463.279ON10499991e-04
KAFR0B014602.545ON761541082e-04
Ecym_26583.279ON1591001012e-04
CAGL0L01947g2.545ON7571081072e-04
TDEL0F044408.317ON554881063e-04
TBLA0I014902.545ON750651054e-04
TPHA0C042602.545ON757631054e-04
NDAI0K018102.545ON762571054e-04
KLLA0F25674g2.545ON757551055e-04
Ecym_42508.317ON657401045e-04
KLTH0C05258g3.279ON15282985e-04
YDR143C (SAN1)8.317ON610581036e-04
TBLA0A096405.628ON325731026e-04
Suva_2.3048.317ON624421037e-04
Suva_4.3023.279ON15091978e-04
Smik_4.3878.317ON634521010.001
AGR034W3.279ON15997960.001
SAKL0A09812g2.545ON7511081010.001
ZYRO0E05632g2.545ON7651081010.001
Skud_2.1863.279ON17873960.001
TDEL0B063402.545ON762541000.001
Kpol_1002.72.545ON754621000.001
NCAS0A047602.545ON761551000.001
KNAG0A070902.545ON762551000.001
SAKL0H17116gsingletonON54440990.002
Ecym_72412.545ON75854990.002
NDAI0G026308.317ON66137990.002
CAGL0M08690g5.628ON32873980.002
NCAS0C033108.317ON57063980.002
KLTH0E02464g5.628ON32965970.002
SAKL0H15686g8.317ON59948980.002
TDEL0F02870na 1ON26089960.003
KAFR0B030708.317ON64349980.003
CAGL0K02563g2.542ON58653970.004
KNAG0A074303.405ON10257890.004
KLLA0F25740g2.542ON51763960.004
KNAG0I020902.157ON427122950.004
Suva_2.4335.628ON33767940.005
TPHA0C008508.317ON78145960.005
KAFR0A019902.542ON56053950.006
Kwal_55.199995.628ON15265900.006
KNAG0I013801.389ON1493146950.007
NCAS0A082803.279ON11838880.007
Skud_4.5285.628ON33765930.007
CAGL0E01441g8.317ON71734940.008
KNAG0G023908.317ON68847940.009
YBR062C3.279ON18073900.009
KNAG0C056602.542ON50753930.010
NCAS0A04680singletonON27478920.010
KLLA0E16677g5.628ON30573920.010
Kpol_526.345.628ON32853920.011
AER390W5.628ON31655920.011
KLLA0E04071g8.317ON70478930.012
Smik_4.5165.628ON33767910.013
NDAI0A074503.279ON17387880.015
YDR265W (PEX10)5.628ON33766900.016
CAGL0K08052g3.405ON30554900.017
KLLA0F18458g3.279ON14067860.019
SAKL0G07370g5.628ON32173890.023
NDAI0H008405.628ON34149890.026
Ecym_13285.628ON32051880.030
NDAI0B018202.542ON62578880.036
Smik_2.1963.279ON18535850.037
ZYRO0C11176g5.628ON36865880.037
SAKL0D03058g3.279ON15542840.040
ZYRO0D05830g8.317ON78036880.042
YHL010C (ETP1)2.542ON58551880.043
TDEL0A049405.628ON32668870.045
SAKL0C03586gsingletonON147493880.046
Skud_8.352.542ON58551870.046
SAKL0C01760gsingletonON147493880.047
ZYRO0E06996g3.279ON17253840.048
Smik_8.322.542ON58551870.049
TDEL0D034603.279ON14453830.051
Kpol_1036.668.317ON66831870.057
TBLA0G023102.542ON67453870.059
Kwal_26.80902.542ON52068860.060
Kwal_26.8030na 2ON66047870.062
Suva_8.422.542ON58551860.066
TPHA0C003505.628ON27866850.068
KLTH0D07150g2.542ON54051860.071
ZYRO0B02244g2.542ON56351860.075
Kpol_1052.193.279ON10335790.076
SAKL0A09526gna 2ON66249860.081
Ecym_54453.405ON32157840.091
Kpol_1002.82.542ON55878850.094
TDEL0A03090na 2ON58649850.095
NCAS0A113503.405ON42854840.096
KLTH0D06886gna 2ON66447840.11
TDEL0A031802.542ON56751840.11
TBLA0I019603.279ON18435810.13
Skud_4.5765.339ON29364820.15
SAKL0A09746g2.542ON54860830.16
Ecym_7253na 2ON61773830.17
TPHA0A033403.405ON38455820.18
NCAS0A125502.542ON57278820.18
KAFR0H005605.628ON32790810.21
TPHA0I005608.808ON39457810.24
ZYRO0C17424g3.405ON27353790.34
CAGL0H10274g3.279ON17595770.38
KLLA0E17711g3.190ON16227760.39
KLLA0E07151g3.28ON11055740.41
ABR104W3.405ON32853790.44
TPHA0C042502.542ON55649790.48
SAKL0B08976g3.405ON32266780.57
SAKL0C13178g3.28ON13822740.61
Suva_2.4815.339ON28764770.62
TBLA0B026708.808ON47836780.67
TDEL0C054203.405ON9360710.67
CAGL0L06336g8.247ON600112780.68
KLLA0E06469g7.440ON96524780.69
NCAS0B009908.808ON39263770.69
TPHA0A039903.279ON17542750.70
KAFR0H007103.405ON22868760.77
AGL191W8.317ON58246770.93
ZYRO0B02046gna 2ON44549760.94
Skud_15.203.28ON12122720.95
NCAS0C044803.28ON10922711.0
Suva_2.137.440ON103823771.0
KAFR0C017803.28ON11822711.1
TBLA0D006508.799ON1568120761.1
ZYRO0E05192g1.389ON152032761.2
Kwal_27.123278.799ON1574120761.3
NDAI0E046007.440ON103423761.3
KLLA0E18503gna 2ON65030751.4
TDEL0H033703.190ON15335721.4
TDEL0C030407.440ON100523751.5
NDAI0D02810na 1ON252114731.7
Kwal_26.8362singletonOFF12347701.7
SAKL0B06226g8.799ON1557105751.7
KLTH0G18150g1.389ON155457751.7
NCAS0C052905.628ON33051731.8
KAFR0C004603.279ON15731711.8
KLLA0C15697g3.405ON30453731.9
ADL181W3.28ON10822691.9
KLLA0C14344g8.799ON1518122742.0
Kpol_1064.268.712ON34749732.2
NCAS0A087801.389ON150250742.4
TDEL0B009808.799ON155939742.4
Ecym_74188.799ON154754732.5
TPHA0I005908.799ON159155732.8
Kwal_55.21206singletonON27559722.8
ZYRO0F12760g8.799ON1555105732.8
Kwal_56.231123.190ON13539692.9
KLTH0F19228g3.28ON11022682.9
KLTH0F18502gsingletonON26758713.1
TDEL0E043905.190ON1957112733.1
Kwal_55.220543.28ON11122673.2
TDEL0B061701.389ON147029723.2
ZYRO0B10692g5.190ON1938103723.4
KLTH0C05500g7.440ON98524723.4
KLTH0E13992g8.799ON155039723.5
CAGL0H07315g5.339ON27866713.5
TBLA0C013301.389ON145248724.2
KNAG0J015605.628ON30970704.5
YPR093C (ASR1)3.405ON28827704.6
Kpol_538.53.405ON33555704.6
NDAI0E004408.808ON41635704.8
KNAG0J008503.279ON16235684.9
KAFR0B046002.157ON40874704.9
Ecym_72442.542ON53253705.0
CAGL0B05049g1.389ON147060715.2
TBLA0A039008.317ON69858705.5
TBLA0B087103.28ON12222665.7
NDAI0G038603.28ON12322666.2
AGL079C2.542ON50653696.5
Skud_7.2106.211ON68536696.8
CAGL0B02013g8.288ON112021706.9
YOL133W (HRT1)3.28ON12122657.0
ZYRO0B14388g4.332ON46044698.0
TPHA0B036501.389ON157675698.1
Smik_16.3333.405ON29028688.1
TBLA0A002603.190ON18475678.1
Kpol_1014.163.28ON10722648.2
KAFR0D046405.339ON30273688.3
Smik_15.203.28ON12122658.3
Suva_15.263.28ON12222658.3
AAL030C1.389ON153923698.8
Kpol_1048.731.389ON154926698.8
TDEL0A004703.28ON11822649.0
ZYRO0C03058g3.28ON11622649.2
SAKL0H16148g8.298ON53055689.6
NDAI0E010008.712ON34759689.6
CAGL0E01567g3.28ON10222639.7
NCAS0B003708.712ON34749679.9
TBLA0D012108.712ON352706710.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10604g
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...  1002   0.0  
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   588   0.0  
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   475   e-163
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   373   e-123
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   348   e-113
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   305   2e-96
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   303   4e-96
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   298   2e-94
TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   296   4e-94
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   294   2e-92
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   286   1e-89
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   277   3e-86
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   277   1e-85
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   271   1e-83
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   265   5e-82
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   251   2e-76
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   249   2e-74
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   234   7e-70
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   232   1e-68
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   191   7e-53
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    50   1e-05
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    49   2e-05
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    49   3e-05
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    49   3e-05
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    48   4e-05
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    48   4e-05
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    48   5e-05
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    47   1e-04
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    47   1e-04
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    47   1e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    43   1e-04
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    46   2e-04
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    44   2e-04
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    46   2e-04
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    45   3e-04
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    45   4e-04
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    45   4e-04
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    45   4e-04
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    45   5e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    45   5e-04
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    42   5e-04
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    44   6e-04
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    44   6e-04
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    44   7e-04
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    42   8e-04
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    44   0.001
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    42   0.001
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    44   0.001
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    44   0.001
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    42   0.001
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    43   0.001
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    43   0.001
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    43   0.001
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    43   0.001
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    43   0.002
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    43   0.002
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     43   0.002
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    42   0.002
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     42   0.002
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    42   0.002
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    42   0.002
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      42   0.003
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    42   0.003
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    42   0.004
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    39   0.004
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    42   0.004
KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {O...    41   0.004
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    41   0.005
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    42   0.005
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    41   0.006
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    39   0.006
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    41   0.007
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    39   0.007
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    40   0.007
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    41   0.008
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    41   0.009
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    39   0.009
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    40   0.010
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      40   0.010
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    40   0.010
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    40   0.011
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    40   0.011
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    40   0.012
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    40   0.013
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    39   0.015
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    39   0.016
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    39   0.017
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    38   0.019
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    39   0.023
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    39   0.026
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    39   0.030
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     39   0.036
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    37   0.037
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    39   0.037
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    37   0.040
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    39   0.042
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    39   0.043
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    38   0.045
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    39   0.046
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    38   0.046
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    39   0.047
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    37   0.048
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    38   0.049
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    37   0.051
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    38   0.057
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    38   0.059
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    38   0.060
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    38   0.062
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    38   0.066
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    37   0.068
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    38   0.071
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    38   0.075
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    35   0.076
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    38   0.081
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    37   0.091
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    37   0.094
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               37   0.095
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    37   0.096
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    37   0.11 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    37   0.11 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    36   0.13 
Skud_4.576 Chr4 complement(1031529..1032410) [882 bp, 293 aa] {O...    36   0.15 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    37   0.16 
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    37   0.17 
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    36   0.18 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    36   0.18 
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    36   0.21 
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    36   0.24 
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    35   0.34 
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    34   0.38 
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    34   0.39 
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    33   0.41 
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    35   0.44 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    35   0.48 
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    35   0.57 
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    33   0.61 
Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}...    34   0.62 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    35   0.67 
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    32   0.67 
CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some ...    35   0.68 
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    35   0.69 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    34   0.69 
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    33   0.70 
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    34   0.77 
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    34   0.93 
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    34   0.94 
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    32   0.95 
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       32   1.0  
Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON} ...    34   1.0  
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    32   1.1  
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    34   1.1  
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    34   1.2  
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    34   1.3  
NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_...    34   1.3  
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    33   1.4  
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...    32   1.4  
TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7....    33   1.5  
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      33   1.7  
Kwal_26.8362 s26 (754563..754934) [372 bp, 123 aa] {OFF} [contig...    32   1.7  
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    33   1.7  
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    33   1.7  
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    33   1.8  
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    32   1.8  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    33   1.9  
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    31   1.9  
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    33   2.0  
Kpol_1064.26 s1064 (46349..47392) [1044 bp, 347 aa] {ON} (46349....    33   2.2  
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    33   2.4  
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    33   2.4  
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    33   2.5  
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    33   2.8  
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    32   2.8  
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    33   2.8  
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    31   2.9  
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    31   2.9  
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    32   3.1  
TDEL0E04390 Chr5 (819719..825592) [5874 bp, 1957 aa] {ON} Anc_5....    33   3.1  
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    30   3.2  
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    32   3.2  
ZYRO0B10692g Chr2 (848105..853921) [5817 bp, 1938 aa] {ON} simil...    32   3.4  
KLTH0C05500g Chr3 complement(475687..478644) [2958 bp, 985 aa] {...    32   3.4  
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    32   3.5  
CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar...    32   3.5  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    32   4.2  
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    32   4.5  
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    32   4.6  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    32   4.6  
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    32   4.8  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    31   4.9  
KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {O...    32   4.9  
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    32   5.0  
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    32   5.2  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    32   5.5  
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    30   5.7  
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    30   6.2  
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    31   6.5  
Skud_7.210 Chr7 (375191..377248) [2058 bp, 685 aa] {ON} YGL071W ...    31   6.8  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    32   6.9  
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    30   7.0  
ZYRO0B14388g Chr2 complement(1169054..1170436) [1383 bp, 460 aa]...    31   8.0  
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    31   8.1  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    31   8.1  
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...    30   8.1  
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    29   8.2  
KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON...    31   8.3  
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    30   8.3  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    30   8.3  
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    31   8.8  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    31   8.8  
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    29   9.0  
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    29   9.2  
SAKL0H16148g Chr8 (1409423..1411015) [1593 bp, 530 aa] {ON} simi...    31   9.6  
NDAI0E01000 Chr5 complement(202491..203534) [1044 bp, 347 aa] {O...    31   9.6  
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    29   9.7  
NCAS0B00370 Chr2 (48637..49680) [1044 bp, 347 aa] {ON} Anc_8.712       30   9.9  
TBLA0D01210 Chr4 complement(305406..306464) [1059 bp, 352 aa] {O...    30   10.0 

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/515 (94%), Positives = 487/515 (94%)

Query: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI
Sbjct: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120
           LLWK              YEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV
Sbjct: 61  LLWKGLTRLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120

Query: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPS 180
           FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPS
Sbjct: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPS 180

Query: 181 PSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYEXX 240
           PSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYE  
Sbjct: 181 PSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYEKL 240

Query: 241 XXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPD 300
                       RVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPD
Sbjct: 241 VQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPD 300

Query: 301 VTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPI 360
           VTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPI
Sbjct: 301 VTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPI 360

Query: 361 CRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSS 420
           CRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSS
Sbjct: 361 CRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSS 420

Query: 421 NPNFPTWYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQDQESQRVVI 480
           NPNFPTWYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQDQESQRVVI
Sbjct: 421 NPNFPTWYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQDQESQRVVI 480

Query: 481 NDPPATQYQDIERLKRRISELENKVDELTKKARTE 515
           NDPPATQYQDIERLKRRISELENKVDELTKKARTE
Sbjct: 481 NDPPATQYQDIERLKRRISELENKVDELTKKARTE 515

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/521 (56%), Positives = 366/521 (70%), Gaps = 14/521 (2%)

Query: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           MA+RVQRRQF  Y   +Y AAAW+++  +Q SLSFL+   +LCEGLNL++LCNFA VN +
Sbjct: 1   MAVRVQRRQFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGV 60

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120
           LLWK              YEHIFERLSFTIVNCFFMSSAF E +F++VM   A L F++V
Sbjct: 61  LLWKALTHLLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKV 120

Query: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNS--LTNKHD 178
           FHWVL+DRLE+VFQHTDE TN ARLL SRFF N+ +   +D+QM +FC++ +   +    
Sbjct: 121 FHWVLRDRLEHVFQHTDEHTNFARLLLSRFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGF 180

Query: 179 PSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYE 238
            S S  V+++F V+F+MLLVDV EVAMKS+INL+E+ QCKR+F RDG+D+ GL+GKFMYE
Sbjct: 181 YSSSLSVHLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCKRSFARDGEDYTGLEGKFMYE 240

Query: 239 XXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKL 298
                          +  + PFSMPLMIAKDI+WD  A+FHT KS+  TWKSNRQIDEKL
Sbjct: 241 KVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQIDEKL 300

Query: 299 PDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTC 358
           PDV+EAQL AS+DKMCIVCM+DML PSE T+AK KPK+LPCNHCLHLGCLKSWMERSQTC
Sbjct: 301 PDVSEAQLAASDDKMCIVCMDDMLAPSECTNAKQKPKRLPCNHCLHLGCLKSWMERSQTC 360

Query: 359 PICRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVS 418
           PICRV VFD KGNV + +     QP +  A          + ++ TS A+T + S  + S
Sbjct: 361 PICRVPVFDKKGNVVVTSDQTNNQPGTSSA--------VESTADETSTAATTSVSSQSSS 412

Query: 419 SSNPNFPT----WYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQDQE 474
            +  + P+    WY FP     ++G++D KV D +G EI A L+ K R  F+  +   Q 
Sbjct: 413 IAVTDVPSHQRGWYAFPTVQVHDEGSIDIKVTDTSGAEIKATLVCKDRHEFEAIETDAQG 472

Query: 475 SQRVVINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515
            ++VV+ +    Q QDIERLKRRISELENKVDEL+KKARTE
Sbjct: 473 PRKVVVKNDCVYQNQDIERLKRRISELENKVDELSKKARTE 513

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  475 bits (1222), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 244/523 (46%), Positives = 328/523 (62%), Gaps = 18/523 (3%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +R QF+ Y+VFTY+AA WSV D L  S++FL   +KLCEG+NL++L NF ++N +LLWK 
Sbjct: 7   RRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNGVLLWKL 66

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        YEH+FERLSFTIVN  F+SS F E  FLTV++  A+L F++VFHW+L
Sbjct: 67  LTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLKVFHWIL 126

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE+VFQ+ +E TN+ ++L SRF  N++  A VDYQMVR+CL NS++N  D   S+ V
Sbjct: 127 KDRLEFVFQNANENTNLKKMLFSRFNFNLLFLASVDYQMVRYCLSNSISN--DQWTSSSV 184

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDGDDFVGLDGKFMYEXXXXXXX 245
           Y++F +DF+MLLVD   + +  V+N +E+ + +       ++F+GL+GKFMYE       
Sbjct: 185 YLMFGIDFAMLLVDTLSIGLHGVVNFVEVYRLQSHNSHYDEEFLGLEGKFMYEKLIDMGA 244

Query: 246 XXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQ 305
                   +A L PF MP+MI KDIIWD I+L+ T  S+W+TWK+ +++DEKLPDVTE +
Sbjct: 245 RLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLWKTWKNAKKLDEKLPDVTEEE 304

Query: 306 LNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV 365
           LN   + MCIVCM+DMLP SE  +A  KPKKLPC H LHL CLKSWMERSQTCPICR+ V
Sbjct: 305 LNQG-NNMCIVCMDDMLPNSETRNANLKPKKLPCGHILHLSCLKSWMERSQTCPICRLPV 363

Query: 366 FDSKGNVA----------LPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLG 415
           FD +GNV           LP+    Q+   E   +   P    + S   +  +    +  
Sbjct: 364 FDERGNVTRMDSSSQEQQLPHNLQRQEAEGEVVQMTTSPFHTTSASVGPTSTTPTQANRS 423

Query: 416 AVSSSNPNFPT-WYTFPV--TLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQD 472
            +    P  P  WY FP+  T +  D  V FK+ D +  EI A L+ K RP F    E  
Sbjct: 424 VIMPQVPRVPQDWYAFPIEATQTTKDKVV-FKLVDSDNNEITANLLTKTRPQFQKVTEVS 482

Query: 473 QESQRVVINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515
              QR+ I      Q ++IE LKR+ISE+ENK+D LTK+ RTE
Sbjct: 483 G-GQRITIPQSCIEQKEEIESLKRKISEMENKLDALTKRVRTE 524

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  373 bits (957), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 192/522 (36%), Positives = 301/522 (57%), Gaps = 23/522 (4%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           ++RQF+ +++F Y    +SV +  + S+SFL   L+L EG N+V++  F  +NS+LLWK 
Sbjct: 7   RKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNSVLLWKL 66

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        YEHIFERL FTI+N   MSS F E+ FLTV I   LL F++VFHW+L
Sbjct: 67  STSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMKVFHWIL 126

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           +DRLE + Q   E T ++ L+ +RF  N+++ A+ DYQ++  C+ NSL N      SA V
Sbjct: 127 RDRLEALLQTIQESTTLSDLIFTRFTFNLVLLAIADYQIISHCVSNSLDNSF--GASASV 184

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQC-----KRAFERDGDD--FVGLDGKFMYE 238
           +++  ++F++LL+D+    + + +   E  Q      + A   D DD  F GL+GKF+YE
Sbjct: 185 HLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQTHGRRNAVNDDEDDTQFSGLEGKFIYE 244

Query: 239 XXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKL 298
                             L PF MP+M+ KD++WD + L    K +W+ W++N+Q+D+KL
Sbjct: 245 RVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWKIWRNNKQLDDKL 304

Query: 299 PDVTEAQLNASEDKMCIVCMEDMLPPSE---ATSAKHKPKKLPCNHCLHLGCLKSWMERS 355
           P ++E QL  + D MCI+CM++++P  +     + K+KPK+LPC H LHL CLK+WMERS
Sbjct: 305 PTMSEDQLR-NIDNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVLHLYCLKNWMERS 363

Query: 356 QTCPICRVSVFDSKGNVALPN-QNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSL 414
           QTCPICR++VFD  GNV        A+   +++ +V +  +  + E    +      G +
Sbjct: 364 QTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQIQDNQQQMGEGQV 423

Query: 415 GAVSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDINGVE-INAKLIIKKRPGFDVPKEQDQ 473
             + S       WY+FPV    ++  V F +++    E + A L+I++    +   + D 
Sbjct: 424 AVLDS-------WYSFPVE-ETSENLVTFSMKNSATNETVPASLLIERTNASERYDDDDD 475

Query: 474 ESQRVVINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515
           + + ++I D    Q Q IE LKRR+SELE++V+ L K+ R +
Sbjct: 476 QVETIIIPDEVVDQAQTIENLKRRVSELESQVEHLNKRVRKD 517

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  348 bits (892), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/565 (35%), Positives = 299/565 (52%), Gaps = 74/565 (13%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +RRQ   + +  Y    ++V +  + S+SFL A +KL  G N+V+L  F I+NS +LWK 
Sbjct: 7   RRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNSAVLWKL 66

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        YEHIFERL FTI+N  FMSS F E  F TV +   LL +++VFHW+L
Sbjct: 67  STAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMKVFHWIL 126

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE + Q   E T +  L+C+RF  N+++ A++DY++V  C+ NSL+N    S S  V
Sbjct: 127 KDRLEALLQSIHESTTLKSLICTRFSFNLVLLAILDYKIVSGCITNSLSNSFGASTS--V 184

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCK-------RAFERDGDD----------- 227
           +++  ++F+MLL+D+  +AM +V+N  E  + +          + DG D           
Sbjct: 185 HLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENEDEDVNGS 244

Query: 228 -FVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWR 286
            F GL+GKFMYE                  L PF M +++ KD+ WD + L     S+WR
Sbjct: 245 SFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQIVSSLWR 304

Query: 287 TWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSE-----------ATSAKHKPK 335
            W++N+Q+D+KL  ++  +L+A+ D +CIVCM+++    E           A + K+KPK
Sbjct: 305 IWQNNKQLDDKLKTMSPVELSAT-DNICIVCMDELCADLEEVVQGPDREKVAKTGKYKPK 363

Query: 336 KLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQ---NAAQQPISEDASVAQ 392
           +LPC H LHL CLK+WMERSQTCPICR+ VFD  GNV        N   Q  ++  +V  
Sbjct: 364 RLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQSSTTNRTTQATNQSTNVTT 423

Query: 393 QPLSAAN-------------ESNSTSLASTHTG------SLG------AVSSSNPNFPT- 426
              +                +S+  S AST +       +LG        + SN N    
Sbjct: 424 TAATTTTTTTTTTTTSTTEMDSSGGSTASTPSSRQSTQQTLGDLTPTPTTADSNSNIANL 483

Query: 427 WYTFPVTLSDNDGAVDFKVRD-INGVEINAKLIIKKRPGFDVPKEQDQESQRVVINDPPA 485
           WY++P+     DG V F +RD ++G  + AKL +            D E+QR+ I +   
Sbjct: 484 WYSYPIQ-EAKDGVVTFSLRDSVSGNPVRAKLTLNN----------DNETQRITIPNECI 532

Query: 486 TQYQDIERLKRRISELENKVDELTK 510
              + I+ LKRRISELE +V E+++
Sbjct: 533 HHLESIQGLKRRISELEAQVREMSE 557

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  305 bits (782), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 200/602 (33%), Positives = 302/602 (50%), Gaps = 100/602 (16%)

Query: 2   ALRVQRR-QFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           +L V R+ Q    T   YT+  +     +Q S S+L   +KL +GLN+++L  F ++N  
Sbjct: 3   SLSVTRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVA 62

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFAL-LTFIR 119
            +WK              YEHI ERL FTI+N   +SS F E   +  +  + + L F++
Sbjct: 63  FIWKGLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMK 122

Query: 120 VFHWVLKDRLEYVFQHTDERTNIARLLCS-RFFLNVIIFAVVDYQMVRFCLRNSLTNKHD 178
           V HWVLKDRLE + Q  ++ ++I  L+ S RFFLN+ +FAV+DYQM+  C+ NS+ N   
Sbjct: 123 VAHWVLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMG 182

Query: 179 PSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQC------------KRAFERDGD 226
            S S  +++L  V+F+MLLVD+  + + + +NL E  +             +     D +
Sbjct: 183 ASTS--IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKSIEDRNLNIVGEDEDGLVDDEE 240

Query: 227 DFVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWR 286
           +F  L+GKFMYE               +    PF M +++ KD+IWD I L+ +  S+W+
Sbjct: 241 EFNELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWK 300

Query: 287 TWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPP------------------SEAT 328
           TW++++Q+DEKLP V+  +L +S++ MCIVCM+ ++                    + A 
Sbjct: 301 TWRNSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAAI 360

Query: 329 SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDA 388
            +K KPKKLPC H LHLGCLK+WMERSQTCPICR+SVFDS GN+ LP  N     +    
Sbjct: 361 HSKQKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNI-LPFNNTRSDTMRNTE 419

Query: 389 SVAQQPLSAANES--NSTS----LASTHTGSLGAVSSSNPNFPT---------------- 426
             A     AA+ES  N T     L+S    S+G   + + NF +                
Sbjct: 420 LTATNSNDAADESTENDTEMDALLSSQVQESVGDTLARDINFRSSIGDADVEGENNDNYD 479

Query: 427 --------------------------------WYTFPVTLSDNDGAVDFKVRDINGVE-- 452
                                           W +F +  S N  ++ F++ D+   +  
Sbjct: 480 LDNELEIPNSDNPSQLLNSESQNAECEFNNVKWKSFLIK-SVNKESISFELTDLKNPDQT 538

Query: 453 INAKLIIKKRPGFDVPKEQDQESQRVVINDPP---ATQYQDIERLKRRISELENKVDELT 509
           I  KLIIK++P     K   Q    VVI D     AT+ + I+ L  +I+ELE K+ +++
Sbjct: 539 ILTKLIIKEKPILKDSKNIKQ----VVIKDEDIWMATEPKTIKSLNDKINELERKLKDIS 594

Query: 510 KK 511
            K
Sbjct: 595 SK 596

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  303 bits (776), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 177/484 (36%), Positives = 267/484 (55%), Gaps = 50/484 (10%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +R+Q + + V TY    + V    + S+SFL   LKL EG NL+VL  F ++NS LLW+ 
Sbjct: 6   RRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        +EHIFERL FTI+N  FMSS F E  F TV     LL +++VFHW+L
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWIL 125

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE + Q  ++ T +  L+ SRF  N+++ AVVD+Q++  C+ +  TN++    S  +
Sbjct: 126 KDRLEALLQSINDSTTMKNLILSRFSFNLVLLAVVDFQILIRCISSIYTNQNIDIISTSL 185

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDG-----DD------------- 227
           Y++  ++F+MLL+D+  + +++ +N  E  + +++   +      DD             
Sbjct: 186 YLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEEAHAV 245

Query: 228 ----------FVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIAL 277
                     F GL+GKFMYE               ++ L PF MPLM+ KD++WD +AL
Sbjct: 246 LNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWDVLAL 305

Query: 278 FHTGKSVWRTWKSNRQIDEKLPDVTEAQL--NASEDKMCIVCMEDMLPPSEATSAKH--- 332
           + +G S+W+ W++N+Q+D+ L  VT  QL  +A+ED +CI+CM++++      + K+   
Sbjct: 306 YQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQADQTWKNKNK 365

Query: 333 KPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQ 392
           KPK+LPC H LHL CLK+WMERSQTCPICR+SVFD KGNV      +     S + +V  
Sbjct: 366 KPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVVQSTFTSNTGTTSTNTTVTG 425

Query: 393 QPLSAANE---SNSTSLASTHTGS--LGAVSSSNPN------------FPTWYTFPVTLS 435
              +  N    +N T L  T T S  +G + + N N               WYTFP+  +
Sbjct: 426 ATSATINRQVFTNQTELLPTRTTSPDVGIIPNHNINTLASRSTSTSTSSTMWYTFPLQQT 485

Query: 436 DNDG 439
           D+D 
Sbjct: 486 DDDS 489

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  298 bits (764), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/482 (35%), Positives = 262/482 (54%), Gaps = 56/482 (11%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +R+Q   + V TY    + V    + S+SFL   LKL EG NL+VL  F ++NS LLW+ 
Sbjct: 6   RRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        +EHIFERL FTI+N  FMSS F E  F TV     LL +++VFHW+L
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHWIL 125

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE + Q  ++ T +  L+ SRF  N+++ AVVDYQ++  C+ +  TN+     S  +
Sbjct: 126 KDRLEALLQSINDSTTMKTLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIESTSL 185

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERD------GD------------- 226
           Y++  ++F+MLL+D+  + +++ +N  E  + +++   +      GD             
Sbjct: 186 YLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQSQ 245

Query: 227 --------------DFVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIW 272
                          F GL+GKFMYE               ++ L PF MP+M+ KD++W
Sbjct: 246 PVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVW 305

Query: 273 DGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQL--NASEDKMCIVCMEDML-PPSEAT- 328
           D +AL+ +G S+W+ W++N+Q+D+ L  VT  QL  +A++D +CI+CM++++  P++ T 
Sbjct: 306 DILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPNQQTW 365

Query: 329 -SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
            +   KPK+LPC H LHL CLK+WMERSQTCPICR+ VFD KGNV      +     ++ 
Sbjct: 366 KNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDITTQT 425

Query: 388 ASVAQQPLSAANE--SNSTSLASTHTGS---------------LGAVSSSNPNFPTWYTF 430
                  ++   +  +N   L  T T S               +   S+S P+ PTWYTF
Sbjct: 426 TVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPS-PTWYTF 484

Query: 431 PV 432
           P+
Sbjct: 485 PL 486

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  296 bits (758), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 176/517 (34%), Positives = 281/517 (54%), Gaps = 60/517 (11%)

Query: 9   QFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKXXXX 68
           QFV +T+F Y     SV   +  S+SFL   +KL +G N++++  F+I+NSI+LWK    
Sbjct: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINSIILWKFSNY 69

Query: 69  XXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLKDR 128
                     YEH+ ERL FT++N  FMSS F E+   T +IL  LL +++V +W+L+DR
Sbjct: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMKVSNWILRDR 129

Query: 129 LEYVFQHTDERTNIARLLCS-RFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPVYI 187
           LE + Q  ++ T I  L+ S +FF N+I+F+++DY M+ FC+ NSL +  +   SA VY+
Sbjct: 130 LESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSNIGSSASVYL 189

Query: 188 LFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAF----------ERDGDDFVGLDGKFMY 237
           L  ++F+MLLVD+  +   S++N+ E  +               E D   F GL+GKF+Y
Sbjct: 190 LMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGFNGLEGKFIY 249

Query: 238 EXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEK 297
           E               +  L PF+MP+M++KD++ D + L     ++W+ W +NR++D++
Sbjct: 250 EKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQ 309

Query: 298 LPDVTEAQLNASEDKMCIVCMEDM-LPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ 356
           LP VT+ QL++ EDK+CI+CM+D+ +   +    K KPK LPC H LH+ CLK+WMERSQ
Sbjct: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ 369

Query: 357 TCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGA 416
           TCP+CR+ VF+ KG V    +  A  P   + S +    S  NE                
Sbjct: 370 TCPMCRLPVFNEKGEVLPTRRERATTP---EPSTSTSSDSEENEE--------------- 411

Query: 417 VSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDINGVEINAKLIIKKRPGFDVPKEQDQESQ 476
                     W +FP+   D D  + F + + +G  + ++L+I      D  +  D    
Sbjct: 412 ----------WVSFPIETID-DSTITFNLANDDGRILKSRLLINSTT--DTTQNSD---- 454

Query: 477 RVVINDPPATQYQDIERLKRRISELENKVDELTKKAR 513
                        DI  LK++I++L++++++L K  +
Sbjct: 455 -------------DILGLKQKINQLQDQINQLNKNMK 478

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  294 bits (752), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 158/405 (39%), Positives = 234/405 (57%), Gaps = 37/405 (9%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +R+Q V + V TY    + V    + S+SFL   LKL EG NL+VL  F ++NS LLW  
Sbjct: 6   RRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLWHL 65

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        +EHIFERL FTI+N  FMSS F E  F TV     LL +++VFHW+L
Sbjct: 66  LTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWIL 125

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE + Q  ++ T +  L+ SRF LN+++ A +DYQ++  C+ +  TN+     S  +
Sbjct: 126 KDRLEALLQSINDSTTMKTLIFSRFSLNLVLLAALDYQIIVHCISSIYTNQKIDIVSTSL 185

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFERDG-----DD------------- 227
           Y++  ++F+MLL+D+  + +++ +N  E  + +++   DG     DD             
Sbjct: 186 YLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDFDGSQ 245

Query: 228 --------------FVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWD 273
                         F GL+GKFMYE               ++ L PF MP+M+ KD+IWD
Sbjct: 246 HALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVIWD 305

Query: 274 GIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQL--NASEDKMCIVCMEDMLPPSEATSAK 331
            +AL+ +   +W+ W++N+Q+D+ L  VT  QL  +A+ED +CI+CM++++  +   + K
Sbjct: 306 ILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHSTNQQTWK 365

Query: 332 H---KPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           +   KPK+LPC H LHL CLK+WMERSQTCPICR+ VFD KGNV 
Sbjct: 366 NKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVV 410

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  286 bits (732), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 154/404 (38%), Positives = 234/404 (57%), Gaps = 36/404 (8%)

Query: 6   QRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKX 65
           +R+Q V + V TY    + V    + S+SFL   LKL EG NL+VL  F ++NS LLW+ 
Sbjct: 6   RRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLWQL 65

Query: 66  XXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVL 125
                        +EHIFERL FTI+N  FMSS F E  F TV     LL +++VFHW++
Sbjct: 66  LTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHWII 125

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDRLE + Q  ++ T +  L+ SRF  N+ + A+ DYQ++  C+ +  TNK+    S  +
Sbjct: 126 KDRLEALLQSINDSTTLKTLIFSRFSFNLALLALTDYQIITRCISSIYTNKNIDVVSTSL 185

Query: 186 YILFCVDFSMLLVDVAEVAMKSVINLIE--------------LIQCKRAFERDGD----- 226
           Y++  ++F+MLL+D+  + +++ +N  E              ++Q +   E + D     
Sbjct: 186 YLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDSGEPH 245

Query: 227 ------------DFVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDG 274
                        F GL+GKFMYE               ++ L PF MP+M+ KD++WD 
Sbjct: 246 AELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDV 305

Query: 275 IALFHTGKSVWRTWKSNRQIDEKLPDVTEAQL--NASEDKMCIVCMEDMLPPSEATSAKH 332
           +AL+ +  ++W+ W++N+Q+D+ L  VT  Q+  +A+ED +CI+CM++++  +   + K+
Sbjct: 306 LALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQAWKN 365

Query: 333 K---PKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           K   PK+LPC H LHL CLK+WMERSQTCPICR+ VFD KGNV 
Sbjct: 366 KNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVV 409

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  277 bits (709), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 172/553 (31%), Positives = 275/553 (49%), Gaps = 82/553 (14%)

Query: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           M ++ +++Q V +++  Y     ++    + S +FL   +KL +G+N+++L  F  +N  
Sbjct: 1   MIVQSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLF 60

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120
           LLW+              +EHIFERL FTI+N  FM S F EYQF   ++   +L+ ++V
Sbjct: 61  LLWEFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKV 120

Query: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLR---------- 170
           FHW+LKDRLE + Q  ++ T++  L+ SR+ LN+ IF+V+D+ +     R          
Sbjct: 121 FHWILKDRLESLLQSINDATDLKNLIFSRYMLNLAIFSVLDFWICSNTYRAFRGYDNNNS 180

Query: 171 ---------NSLTNKHDPSPS--APVYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKR 219
                    ++L NK++ +P+    +++LF ++F +L +D+  +AM +V+N  E    +R
Sbjct: 181 TNNNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQR 240

Query: 220 AFERDG-------------------DDFVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPF 260
           A                         +F GL+GKFMYE               +  L   
Sbjct: 241 ATAHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQT 300

Query: 261 SMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMED 320
            + +M+ KD++WD + L+    S+W+ +K+N+Q+D+KLP ++   +    D +CIVCM+D
Sbjct: 301 KLQIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDD 360

Query: 321 MLPP-------------SEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFD 367
           ++P               ++ S   +PKKLPC H LHL CLK+WMERSQTCPICR+ VFD
Sbjct: 361 LVPSLHGKEAVEMTQADIDSISKSKRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVFD 420

Query: 368 SKGNVA---LPNQNAAQQPISEDASVAQQPLSAANESNSTSLAS----THTGSLGAVSSS 420
             GNV        N   QP + DA V     + +    ST +      T T +    +SS
Sbjct: 421 ENGNVKPFLHTTTNNNMQP-NNDADVTSTTATNSRTDTSTPMTDVPTPTRTSASALTTSS 479

Query: 421 -------NPNFPT----WYTFPV-TLSDNDGAVDFKVRDI--NGVEINAKLIIKKRPGFD 466
                  N   P     WY F + ++SD    V F VR+   N   I  KL+I++     
Sbjct: 480 IITQDFKNGITPIDSVEWYAFEIDSISDARNEVKFNVRNASSNNRSIPMKLLIERM---- 535

Query: 467 VPKEQDQESQRVV 479
              E+  E Q V+
Sbjct: 536 ---EETAEGQIVI 545

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  277 bits (709), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 191/579 (32%), Positives = 284/579 (49%), Gaps = 98/579 (16%)

Query: 20  AAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKXXXXXXXXXXXXXXY 79
           A   S+   +  S S+L   +KL +G N +VL  FAI+N   +W+              Y
Sbjct: 23  ATFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEY 82

Query: 80  EHIFERLSFTIVNCFFMSSAFPEYQF-LTVMILFALLTFIRVFHWVLKDRLEYVFQH-TD 137
           EH+ ERL FTI+N     S F +     T  I    L F++V HW+L+DRL+ + Q   D
Sbjct: 83  EHVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFND 142

Query: 138 ERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLL 197
             T  + +L + FFLN+IIF +VDY+MV +C+ NSL+N      S  V++L  ++F+MLL
Sbjct: 143 SSTLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSM--GASTTVHLLLGMEFTMLL 200

Query: 198 VDVAEVAMKSVINLIELIQCKRAFERDGD---------------DFVGLDGKFMYEXXXX 242
           +D+  + + + +NL E        ER  +                F  L+GKFMYE    
Sbjct: 201 IDLLNLFLHTCLNLYEF--HLTTLERSSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTID 258

Query: 243 XXXXXXXXXXRVASLAPFSMPL-MIAKDIIWDGIALF-HTGKSVWRTWKSNRQIDEKLPD 300
                      +  L P  M   ++ KD+IW+ I+L+ HTG S+W+TWK+N+Q+D+KLP 
Sbjct: 259 VFTRFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTG-SLWKTWKNNKQLDDKLPT 317

Query: 301 VTEAQLNASEDKMCIVCMEDMLPP---------------SEATSAKHKPKKLPCNHCLHL 345
            +  +L  +++ +CIVCM+D+LP                     +K KPKKLPC H LHL
Sbjct: 318 ASIEELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKSKQKPKKLPCGHILHL 377

Query: 346 GCLKSWMERSQTCPICRVSVFDSKGNVALPN----------------------------- 376
            CLK+WMERSQTCPICR+ VFD KGNV +P+                             
Sbjct: 378 NCLKNWMERSQTCPICRLPVFDDKGNV-MPSTHSQNQTETQQQQPQTQTQSTTELQPQTE 436

Query: 377 -----------------QNAAQQPISEDASVAQQPLSAAN-ESNSTSLASTHTGS----L 414
                            QN  + P  + A  A +  + +N + N T+   +  GS     
Sbjct: 437 VQPDLNQRQETNIQHNVQNVIETPGRDSAQDASRGGTGSNSDHNLTNTQVSSEGSSNEQQ 496

Query: 415 GAVSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDIN--GVEINAKLIIKKRPGFDVPKEQD 472
           G V++S  N  +WY+FP+  S +D ++ F + D +       AKL ++++         D
Sbjct: 497 GNVTNSILNTSSWYSFPIKTS-SDSSITFDISDAHDPAKVYPAKLSVEEKVS-SRTLNSD 554

Query: 473 QESQRVVIND---PPATQYQDIERLKRRISELENKVDEL 508
               +VVI D      T  + I+ LK+RI+ELE KVD L
Sbjct: 555 GGMLQVVIKDKDIKTVTDSKTIDLLKKRITELEEKVDSL 593

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  271 bits (692), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 176/553 (31%), Positives = 281/553 (50%), Gaps = 68/553 (12%)

Query: 8   RQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKXXX 67
           ++F+ Y++ +YTAAAWS+  C+  S S+L A  K+ EG++ ++  N  ++NS+L+ K   
Sbjct: 24  QKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGVI 83

Query: 68  XXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFI--RVFHWVL 125
                      YEHI ER+S+T++      S+      ++VM +  +L F+  R  HW+L
Sbjct: 84  HMLFGQLRLIEYEHILERISYTVITLLLSCSSMN--GLISVMQIHCVL-FVCCRTLHWIL 140

Query: 126 KDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           KDR+E  FQ  D R  +  +L SRF  N+++   VD  +V + +   L      S     
Sbjct: 141 KDRMEVTFQANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAYYVNKILYK----SNIDVT 196

Query: 186 YILFCVD-FSMLLVDVAEVAMKSVINLIEL--IQCKRAFERDGDDFV------------- 229
           Y LF +  +++L  D+ +V +++ +NL EL  IQ +    R+ D  V             
Sbjct: 197 YTLFIISQYAILGTDLLQVILRTGLNLFELSTIQNRARIRRNADHHVDEPVINHEERPNA 256

Query: 230 --------------GLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGI 275
                         GL+GKF+YE              + AS   FS   ++   ++W+ I
Sbjct: 257 VAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIKFAS--SFSTGRVMMVTVLWEAI 314

Query: 276 ALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPK 335
             F + + +W+ WKS++ +D  L D T+ Q+ + E  +CIVCMED LP  +  S   K K
Sbjct: 315 TTFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDFLPSHQRKSDGKKVK 374

Query: 336 KLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPL 395
            LPC H LHL CLK+W+ RS TCPICR+ +FD  GNV +P Q+ +Q   S D +   Q +
Sbjct: 375 ILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNV-MPYQDHSQ---STDPNTTAQEI 430

Query: 396 SAA------NESNSTSLASTHTG-SLGAVSSSNPN---FPTWYT---FPVTLSDNDGAVD 442
           S        +++N  +L +T+   +L   +S+  N    PT  T    P+   D +    
Sbjct: 431 SPGIAVETNSQTNINTLETTNQNITLSPDNSTAQNLAFLPTRNTSLIIPIQRED-EHKHK 489

Query: 443 FKVRDINGVEINAKLIIKKRPGFDVPKEQDQESQRVVINDPPATQYQDIERLKRRISELE 502
           FK+   +G EI   LI+  R   D  K      Q ++I+       QD  +LKR+I++LE
Sbjct: 490 FKILTESGKEIEGSLIL--RNNIDTTKGSVVLPQDLLID-------QDASQLKRKIADLE 540

Query: 503 NKVDELTKKARTE 515
           +K++EL+KK + E
Sbjct: 541 SKLEELSKKVKRE 553

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  265 bits (678), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 154/488 (31%), Positives = 256/488 (52%), Gaps = 50/488 (10%)

Query: 3   LRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILL 62
           L+ +R Q + +T   Y      +++    S SFL   LKL +G N++++  F ++N++LL
Sbjct: 2   LQTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLL 61

Query: 63  WKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFH 122
           WK               EHI ERL FTI+N  F+S+ F E  F+T+     +L ++++F+
Sbjct: 62  WKFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFY 121

Query: 123 WVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCL------------- 169
           W+LKDRLE++ Q ++   +++R + S+F+LN+II + ++ Q+++ C+             
Sbjct: 122 WILKDRLEFLIQ-SNTNYSVSRFIFSKFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 170 ----RNSLTNKHDPSPSA---------PVYILFCVDFSMLLVDVAEVAMKSVINLIELIQ 216
                 SL N   PS +          P+Y++  ++F++LL++   + + S+++L E+ +
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 217 CKRAFERDGD----------------DFVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPF 260
             +  + +                  DF GL+ KF+YE               ++   P 
Sbjct: 241 SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300

Query: 261 SMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMED 320
           ++P+++ KDIIWD I+L+   K +++  K+N+ +D KLPD+    L  S D +CIVCM+D
Sbjct: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQDS-DNVCIVCMDD 359

Query: 321 MLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAA 380
           +L        K K K+LPC H LHL CLK+WMERSQTCPICR+ VFD  GNV    + A 
Sbjct: 360 LLSEEHK---KKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESERPAT 416

Query: 381 QQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSNPNFPTWYTFPVTLSDNDGA 440
                 D  VA     + + S S   +          +S + N  TWY+FP+T  + D +
Sbjct: 417 AADADVDVDVAAAQPPSTSSSPSIPHSPIQETLEPEEASIDNN--TWYSFPITHINKDKS 474

Query: 441 V-DFKVRD 447
           V  F++RD
Sbjct: 475 VISFELRD 482

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  251 bits (642), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/447 (33%), Positives = 229/447 (51%), Gaps = 41/447 (9%)

Query: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           M   + +R+F+ +T  TY    + V+   Q S+SFL   LKL EG N++++  F ++NS 
Sbjct: 1   MLTAIHKREFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNST 60

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120
           LLW+              +EHIFERL F ++N  FM S F E  F T+     +L +++V
Sbjct: 61  LLWQFLTSMLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKV 120

Query: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSL------- 173
           FHW+L+DRL+ + Q  +E T    LL +R+  N+++  V+D  ++ FC+  +        
Sbjct: 121 FHWILRDRLDLLLQGINEDTRWKDLLVNRYICNLLLLVVIDSYVISFCVSTAYNIASSIF 180

Query: 174 ---TNKHDPSPSAP------VYILFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAFER- 223
              TN       +P      +YI+  ++F+ L++D+  + + + +   E     R F + 
Sbjct: 181 TAGTNSIVLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEF-HLSRKFSQN 239

Query: 224 -----------------DGDD-FVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLM 265
                            DGD  F GL+GKFMYE               V      ++PLM
Sbjct: 240 NPTFNSISAEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLM 299

Query: 266 IAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASE--DKMCIVCMEDMLP 323
           + KDI  D   L+   KS+   WK+++Q+D KLP +T   LN     D +CIVCM++++ 
Sbjct: 300 LVKDIFVDVWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVS 359

Query: 324 --PSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQ-NAA 380
             P    S   KPKKLPC H LHL CLK+WMERSQTCPICR+ VFD  G +  P+  N +
Sbjct: 360 ENPHHHQSDGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEILAPSSANVS 419

Query: 381 QQPISEDASVAQQPLSAANESNSTSLA 407
           Q  ++   +  Q+  +     + TS+A
Sbjct: 420 QTNLNPGENPDQRDEADDELEDDTSIA 446

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  249 bits (635), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 254/502 (50%), Gaps = 87/502 (17%)

Query: 3   LRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILL 62
           L  ++ QFV +++  Y    +++++    S SFL  CLKL EG N++++  F ++NS+L 
Sbjct: 8   LNSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLS 67

Query: 63  WKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFH 122
           WK               EHI ERL FT++N   M++ F E  F T+ I   LL  +RV+H
Sbjct: 68  WKLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYH 127

Query: 123 WVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLR------------ 170
           W+LKDRLE++ Q  ++ T++ +++ S+F  N+I  ++++ ++++ CL             
Sbjct: 128 WILKDRLEFIIQTINDSTSMTKIIFSKFSFNLISLSLINLKLIQNCLTWDDINFWKNNQN 187

Query: 171 --NSLTNKH-DP-----------SPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIELIQ 216
             NS+ N   +P           + S PVY++  ++FS+LL++   V   S+++L E  +
Sbjct: 188 LFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYK 247

Query: 217 CK----------------RAFERDGDD---------------------FVGLDGKFMYEX 239
            K                RA     D+                     F GL+GKF+YE 
Sbjct: 248 SKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEK 307

Query: 240 XXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLP 299
                         V+ L P ++P+++ KDI+WD  +L+    S+++ WK+N++++  LP
Sbjct: 308 IIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALP 367

Query: 300 DVTEAQLNASEDKMCIVCMEDMLPPSEAT-----------SAKH--------KPKKLPCN 340
           ++T   L  S D +CI+CM+D+LP  E             S+ H        KPKKLPC 
Sbjct: 368 NMTPDDLQHS-DNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCG 426

Query: 341 HCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQQPLSAANE 400
           H LH  CLK+WMERSQTCPICR+ VFD  GNV +   N        D+S  Q   ++ N 
Sbjct: 427 HFLHFSCLKNWMERSQTCPICRLDVFDKNGNVKVY-PNTNTNTNVNDSSHDQ---TSENR 482

Query: 401 SNSTSLASTHTGSLGAVSSSNP 422
             STS ++   GS   ++++ P
Sbjct: 483 PPSTSTSNIIPGSNTNITTNTP 504

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  234 bits (598), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 135/431 (31%), Positives = 208/431 (48%), Gaps = 60/431 (13%)

Query: 1   MALRVQRRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSI 60
           + LR +++QF    V  Y   A++V++    S +FL+    L +G+N V++  F+++N +
Sbjct: 4   LNLRSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIV 63

Query: 61  LLWKXXXXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRV 120
           LLWK               EHIFER+  T++N   +SS   +     +++L  LL  ++V
Sbjct: 64  LLWKGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKV 123

Query: 121 FHWVLKDRLEYVFQHTDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTN-KHDP 179
            HW+L+DRLE   Q  ++ T +  LL S+F  N++IF ++DY + + C  N   N  H  
Sbjct: 124 SHWILRDRLEGFLQRINDTTTLTSLLFSKFSRNLLIFGILDYFVTKICFFNHFGNFYHHG 183

Query: 180 SPSAPVYILFCVDFSMLLVDVAEVAMKSVINL-----IELIQCKRAFERDGDDFV----- 229
             S    I+F ++++++ +D+  +   +V+N       +L   +   E   DDF      
Sbjct: 184 DFSNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEND 243

Query: 230 -------GLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGK 282
                  GL+GKF+YE                  L P     M+ KD +WD   L + G 
Sbjct: 244 SGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGN 303

Query: 283 SVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKH---------- 332
           S+W+ +K+NRQ+++KLP++    L    D MCIVCM+D++     T  +           
Sbjct: 304 SLWKIYKNNRQLNKKLPNIAIEDL-LDHDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEK 362

Query: 333 -------------------------------KPKKLPCNHCLHLGCLKSWMERSQTCPIC 361
                                          KPKKLPC H LH  CLK+WMERSQTCPIC
Sbjct: 363 NTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422

Query: 362 RVSVFDSKGNV 372
           RV VFD  GNV
Sbjct: 423 RVPVFDKDGNV 433

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  232 bits (591), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 165/567 (29%), Positives = 259/567 (45%), Gaps = 78/567 (13%)

Query: 17  TYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKXXXXXXXXXXXX 76
           TY  A WS   C       L A      G++ V+  NF IV+  L               
Sbjct: 17  TYALAGWSAYSCATSFDDPLSALFMASSGVHFVIWGNFLIVHYCLFVWAIIRVLFGQLTA 76

Query: 77  XXYEHIFERLSFTIVN-CFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLKDRLEYVFQH 135
             Y+HIFERL   +V     + +    Y    + ILF   T   V HWVL+DR+++VFQ 
Sbjct: 77  IEYDHIFERLHVVLVTLASIVITMRKTYMAGHMTILF--YTLCLVAHWVLRDRMDFVFQV 134

Query: 136 TDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTN--KHDPSPSAPVYILFCVDF 193
               +++  +LCSRF  ++++  +VDY+M++FC++N+  +  +H+      +Y++  + F
Sbjct: 135 HGTDSSLLGILCSRFMFSLLVLGMVDYKMLKFCVQNTNVDGKRHE------LYLMLALSF 188

Query: 194 SMLLVDVAEVAMKSVINLIELIQCKRA----FERDGD--------DFVGLDGKFMYEXXX 241
           + L++DV  V + + +NL E+++ +R        +G         +   L+GK++YE   
Sbjct: 189 AQLILDVLHVVLLTSLNLFEMVRSRRTRSANLVYEGGTTDDDADDEVFILEGKYIYETVF 248

Query: 242 XXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDV 301
                       +         + +   I    I    +   V+  WK+N+++ EKL DV
Sbjct: 249 DLTITVLKVILDIIQEVFVPWSITVVYSIFVRSIKAGESFLLVYNYWKNNKKLYEKLSDV 308

Query: 302 TEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPIC 361
           +E QL+ + D MCI+CM+DMLP +E T    + K LPC H LH GCLKSWMERSQTCPIC
Sbjct: 309 SEEQLDDT-DSMCIICMDDMLPTTETTKMNRRAKMLPCGHMLHFGCLKSWMERSQTCPIC 367

Query: 362 RVSVFDSKGNVALPNQNAAQQP--------ISEDASV-AQQPLSAANES--NSTSLASTH 410
           R+SVF +  N     Q   Q P        I E   V   Q +S  + S    T++    
Sbjct: 368 RLSVFANDSNSHATTQAREQTPPDLLQERGIDEHIDVIGMQDMSVQSISLHEGTAVRRGT 427

Query: 411 TGSL-------GAVSSSNPNFPTWYTFPVTLSDNDGAVDFKVRDINGVEI---------- 453
           TG+        G +S    +   W  FP+     D  V F + D  G             
Sbjct: 428 TGNCMNQAYDGGLLSHEERDQAGWVAFPIEFR-ADNKVFFNLNDSQGDRQWMASYTSYPR 486

Query: 454 ----------NAKLIIKKRPGFDVPKEQDQESQRVVIN----DPPAT-----------QY 488
                     NA     + P   +P   +  S +V +     D PA            Q 
Sbjct: 487 QNMVNSDDPDNASESHSRIPSPSLPGSLEGTSSQVDVTVSAKDAPANACFVIATSKLEQT 546

Query: 489 QDIERLKRRISELENKVDELTKKARTE 515
           +++E LKR++ ELE++V+EL+K+ +T+
Sbjct: 547 KEVEHLKRKVEELESRVEELSKRIKTD 573

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  191 bits (486), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 124/404 (30%), Positives = 185/404 (45%), Gaps = 41/404 (10%)

Query: 7   RRQFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKXX 66
           R QF+     TY  AAWS+ +C   SLSFL A  K   G++L++  NF +V+  +     
Sbjct: 10  RLQFIA---VTYALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLV 66

Query: 67  XXXXXXXXXXXXYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLK 126
                       YEHIFERL  T+++   +            +I        +V HWV++
Sbjct: 67  VRMLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLCQVLHWVVR 126

Query: 127 DRLEYVFQH-TDERTNIARLLCSRFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPV 185
           DR+E+VF      R  +  LL SRF L++++  VVD++++ +  R     +H        
Sbjct: 127 DRMEFVFAPPIGTRMAMKDLLFSRFMLSIVVLGVVDFKLMMYFYR-----QHQAEQGYLY 181

Query: 186 YILFC----------------VDFSMLLVDVAEVAMKSVINLIELIQCKR---------- 219
           Y+LF                 VDF +L +D  +V + + +  +EL +  R          
Sbjct: 182 YLLFSDNGQNTSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLDN 241

Query: 220 -AFERDGDD---FVGLDGKFMYEXXXXXXXXXXXXXXRVASLAPFSMPLMIAKDIIWDGI 275
              E D +D   F+ L+ KF+YE               +  +       ++  +I    I
Sbjct: 242 NELENDIEDDGAFI-LEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSI 300

Query: 276 ALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPK 335
                   ++  WK+NR++ EKL DVT   L+   D  C +CM+DMLP  +      K K
Sbjct: 301 ETCERCVLLFNYWKNNRRLHEKLLDVTAGHLDGV-DITCTICMDDMLPSKDVKVNNKKAK 359

Query: 336 KLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNA 379
            LPC H LH GCLKSWM+R+QTCPICR  VF S    A  N N+
Sbjct: 360 MLPCGHMLHFGCLKSWMQRAQTCPICRFPVFGSSNPRAGQNANS 403

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 479 VINDPPATQYQDIERLKRRISELENKVDELTKKARTE 515
           VI      Q +++ERLKRRISELEN V +L K+ +T+
Sbjct: 634 VIPTSRLEQTEELERLKRRISELENTVGDLLKRIKTD 670

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%)

Query: 326 EATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           E+ + KH P KLPC H     C++ W     TCPICR  +  + G
Sbjct: 218 ESIAYKHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 301 VTEAQLNASEDKM-CIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMER 354
           ++E    A+E+ + C +CM D+    E     HK  +      PC+H  H  CL++WM  
Sbjct: 685 ISEHGSGAAENTVDCTICMSDVPIYIEEIPETHKVDQHSYMVTPCDHVFHTSCLENWMSY 744

Query: 355 SQTCPICR 362
              CP+CR
Sbjct: 745 KLQCPVCR 752

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 18/113 (15%)

Query: 260 FSMPLMIAKDIIWDGIALF---HTGKSVWRTWK--SNRQIDEKLPDVTEAQLNASEDKMC 314
           F + ++ ++D++  G   F   HT    +  +K  SN  I E      E  ++      C
Sbjct: 648 FQISILYSQDVL--GSRWFLPKHTIPDGYSYFKPLSNEYISEHGGGTAEHTVD------C 699

Query: 315 IVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
            +CM D+    E     HK  +      PCNH  H  CL++WM     CP+CR
Sbjct: 700 AICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCR 752

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           C +CM D+    E     HK  +      PCNH  H  CL++WM     CP+CR
Sbjct: 699 CAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQCPVCR 752

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 301 VTEAQLNASEDKM-CIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMER 354
           ++E     +E+ + C +CM D+    E     HK  +      PCNH  H  CL++WM  
Sbjct: 686 ISEHGGGTAENTVDCAICMSDVPIYIEEVPETHKVDQHSYMVTPCNHVFHTPCLENWMSY 745

Query: 355 SQTCPICR 362
              CP+CR
Sbjct: 746 KLQCPVCR 753

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 9/108 (8%)

Query: 260 FSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCME 319
           F + ++  +DI+  G   F    ++   +  ++ I     D+ E   ++S    C +CM 
Sbjct: 641 FQIAVLYTQDIL--GARWFLPNYTIPEGYSYHKGISSG--DLLEHGSSSSYSVDCAICMS 696

Query: 320 DMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           ++    +     HK  K      PC+H  H  CL+SWM     CP+CR
Sbjct: 697 EVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQCPVCR 744

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 44/108 (40%), Gaps = 13/108 (12%)

Query: 271 IWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSA 330
           + DG A  H  K   RT     + ++   +V +    A++ +      E   P     S 
Sbjct: 156 VRDGEAGHHGCKHPKRT-----RYEQDESEVDDQNGPANDGETASSPPEQEQPKDNENSG 210

Query: 331 --------KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
                   KH P +LPC+H     C++ W     TCPICR ++  + G
Sbjct: 211 DDQGKVTYKHSPVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 36/80 (45%), Gaps = 7/80 (8%)

Query: 309 SEDKMCIVCMEDMLPPSEAT--SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVF 366
           +E     +  +   P  E T  S KH P KLPC H     C+  W +   +CP+CR  + 
Sbjct: 224 AEQSSTALADQPHAPNDEETNPSYKHSPIKLPCGHIFGRECIYKWSKLENSCPLCRHKIS 283

Query: 367 DSKGNVALPNQNAAQQPISE 386
           +S G      QN AQQ   E
Sbjct: 284 ESAG-----IQNTAQQDTDE 298

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 48/108 (44%), Gaps = 9/108 (8%)

Query: 260 FSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCME 319
           F + ++ ++DI+  G   F    ++   +  ++ I     D+ E   + +    C +CM 
Sbjct: 638 FQIVILYSQDIM--GARWFLPKYTIPEGYSYHKGISSA--DLLEHGSSPNYSIDCAICMN 693

Query: 320 DMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           D+    +     HK  K      PC+H  H  CL+SWM     CP+CR
Sbjct: 694 DVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCR 741

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHKPK-----KLPCNHCLHLGCLKSWMERSQTCPICR 362
           C +CM ++    E     HK         PC+H  H GCL++WM     CP+CR
Sbjct: 694 CAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCR 747

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 42.7 bits (99), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 25/99 (25%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-------CNHCLHLGCL 348
           + LP V + +L  +E   C +C              ++  K P       CNH   L C+
Sbjct: 19  DSLPRVEKGKLKDAE--ACSIC-----------CCNYRDDKYPLVVELPHCNHRFDLECV 65

Query: 349 KSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
             W+ +S+TCP+CR  V   K     PN + +Q  + +D
Sbjct: 66  AVWLSKSRTCPLCRDDVLSHK-----PNVDVSQVEMEDD 99

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           C +CM ++    E     HK  +      PCNH  H  CL++WM     CP+CR
Sbjct: 702 CSICMSEIPVYVEELPETHKVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCR 755

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 42/100 (42%), Gaps = 23/100 (23%)

Query: 285 WRTWKSNRQ-------IDEKLPDVTEAQLNASEDKMCIVC----MEDMLPPSEATSAKHK 333
           W  W S+ +         + LP V    L  S D  C +C    +ED  P          
Sbjct: 56  WLEWISDGEKRGVPEGFSDSLPRVATTHL--SPDDTCAICCCVYLEDSYP---------L 104

Query: 334 PKKLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNV 372
             KLP CNH   L C+  W+ +S TCP+CR  V  SK  +
Sbjct: 105 VVKLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKI 144

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 9/108 (8%)

Query: 260 FSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCME 319
           F + ++ ++DI+  G   F    S+   +  +R +   L  + E   + +    C +CM 
Sbjct: 648 FQISVLYSQDIL--GSRWFLPKHSIPEEYSYHRVV--SLQHLMEHGGSENHTVDCAICMA 703

Query: 320 DMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           +     E     H+  K      PC+H  H  CL+SWM     CP+CR
Sbjct: 704 EFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCR 751

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 39/88 (44%), Gaps = 15/88 (17%)

Query: 301 VTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPI 360
           V   Q ++ +D+        M PP+     KH P  LPCNH     CL  W +   +CP+
Sbjct: 184 VPTEQSSSQQDENTEQAPNVMEPPT----YKHSPVVLPCNHVFGRECLFKWSQLENSCPL 239

Query: 361 CRVSVF---------DSKGNVALPNQNA 379
           CR  +          DS G VA  NQNA
Sbjct: 240 CRHKIVEAAAGQSGEDSNGAVA--NQNA 265

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 5/65 (7%)

Query: 303 EAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQT 357
           E   N +    C +CM ++    +     H   K      PCNH  H  CL++WM     
Sbjct: 680 EHGTNKNHTVDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQ 739

Query: 358 CPICR 362
           CP+CR
Sbjct: 740 CPVCR 744

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 308 ASEDKM--CIVCMEDM------LPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCP 359
           ASE+    C +CM ++      +P + A   +      PCNH  H  CL++WM     CP
Sbjct: 690 ASENHTVDCAICMSEVPVYVKDIPETHAVD-QQSYMVTPCNHIFHTACLENWMGYKLQCP 748

Query: 360 ICR 362
           +CR
Sbjct: 749 VCR 751

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 5/57 (8%)

Query: 314 CIVCMEDMLPPSEATSAKHKPK-----KLPCNHCLHLGCLKSWMERSQTCPICRVSV 365
           C +CM  +    E     HK         PCNH  H  CL++WM     CP+CR S+
Sbjct: 703 CAICMSPVPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYKLQCPVCRSSL 759

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 313 MCIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           +C +CM D+    E T   HK         PC+H  H  CL++WM     CP+CR
Sbjct: 697 VCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCR 751

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 331 KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           KH P +LPC H     C+  W +   +CPICR  + + +G
Sbjct: 273 KHCPTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMER 354
           + LP V +  L  ++   C +C    L  +     K     LP C+H   L C+  W+ +
Sbjct: 67  DSLPRVNKCDLKGAD--ACSICCCGYLDDTHPLVVK-----LPHCSHRFDLECVAVWLSK 119

Query: 355 SQTCPICRVSVFDSKGNVALPN 376
           S+TCP+CR  V   K  V + N
Sbjct: 120 SRTCPLCRDDVLSHKPKVDISN 141

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 28/58 (48%), Gaps = 5/58 (8%)

Query: 329 SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISE 386
           S KH P KLPC H     C+  W     +CP+CR  + +S G      Q AAQQ   E
Sbjct: 247 SYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRQKISESVG-----VQRAAQQDTDE 299

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 12/73 (16%)

Query: 290 SNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLK 349
           +N +ID K P +        E + CI+CM  M+ PS A          PC H     CL 
Sbjct: 253 NNEKIDLKNPKILPYI--PEESRKCILCMSFMINPSCA----------PCGHIYCWNCLI 300

Query: 350 SWMERSQTCPICR 362
           +W +  + CP+CR
Sbjct: 301 NWCKEKEECPLCR 313

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 329 SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           S KH P +LPC H     CL  W     +CP+CR  + +S G
Sbjct: 265 SYKHSPIRLPCGHVFGRECLYKWSRLENSCPLCRHKISESAG 306

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 11/91 (12%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERSQ 356
           LP + +  L  S++  C +C  + L        +     LP C+H   L CL  W+ RS 
Sbjct: 65  LPRINKKMLKPSDN--CSICYTNYLEDKYPLVVE-----LPHCHHKFDLECLSVWLSRST 117

Query: 357 TCPICRVSVFDSKGNVALPNQNAAQQPISED 387
           TCP+CR  V    G+  +   +  +  + ED
Sbjct: 118 TCPLCRDDVM---GHRVINEIDTTEAELEED 145

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 321 MLPPSEAT--SAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           + P  E T  S KH P KLPC H     C+  W     +CP+CR  + ++ G
Sbjct: 247 LTPNDEETNPSYKHSPIKLPCGHIFGRECIYKWSRLENSCPLCRHKISENAG 298

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 41.6 bits (96), Expect = 0.001,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 21/97 (21%)

Query: 296 EKLPDVTEAQLNASEDKMCIVC----MEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKS 350
           + LP V + +L  +E   C +C    +ED  P            +LP C H   L C+  
Sbjct: 74  DTLPRVPKKRL--AEGDNCAICCCGYLEDEYPLV---------VELPNCGHTFDLQCVSV 122

Query: 351 WMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
           W+ RS TCP+CR  V   K     P  + +   + ED
Sbjct: 123 WLSRSTTCPMCRSDVLVRK-----PEIDGSAAELEED 154

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 46/108 (42%), Gaps = 9/108 (8%)

Query: 260 FSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCME 319
           F + ++ ++DI+  G   F +  ++   +  ++ I     D+ E   ++     C +CM 
Sbjct: 642 FQISILYSQDIL--GARWFLSKHAIPEGYSYHKSITSA--DLLEHGCSSDYCIDCAICMT 697

Query: 320 DMLPPSEATSAKHKPK-----KLPCNHCLHLGCLKSWMERSQTCPICR 362
           D+          HK         PC H  H  CL+SWM     CP+CR
Sbjct: 698 DVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCR 745

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 9/108 (8%)

Query: 260 FSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCME 319
           F + ++ ++DI+  G   F    S+   +  ++ +  +  D+ E    A     C +CM 
Sbjct: 656 FQIAVLYSQDIL--GSRWFLPKLSIPEGYSYHKAMPAQ--DLLEHGSTAGYTIDCAICMS 711

Query: 320 DMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPICR 362
           ++    E     HK  +      PC H  H  CL++WM     CP+CR
Sbjct: 712 EVPIRVEEVPETHKVDEQTYMVTPCAHIFHTQCLENWMSYKLQCPVCR 759

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERSQ 356
           LP +   +LN++++  C +C  + L        +     LP CNH   L CL  W+ RS 
Sbjct: 93  LPRINRKKLNSTDN--CSICYTNYLEDEYPLVVE-----LPHCNHRFDLECLSVWLSRST 145

Query: 357 TCPICRVSVFDSK 369
           TCP+CR  V   +
Sbjct: 146 TCPLCRDDVMGHR 158

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHKPK-----KLPCNHCLHLGCLKSWMERSQTCPICR 362
           C +CM ++    E     HK         PC H  H  CL++WM     CP+CR
Sbjct: 703 CAICMSEVPVYVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSYKLQCPVCR 756

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 308 ASEDKM--CIVCMEDMLPPSEATSAKHKPKK-----LPCNHCLHLGCLKSWMERSQTCPI 360
           AS D    C +CM ++    +     HK         PCNH  H  CL++WM     CP+
Sbjct: 687 ASSDHTVDCAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGYKLQCPV 746

Query: 361 CR 362
           CR
Sbjct: 747 CR 748

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 314 CIVCMEDM---LPPSEATSA--KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRV 363
           C +CM ++   +  +E T    +H     PC+H  H  CL++WM     CP+CR 
Sbjct: 702 CAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQCPVCRT 756

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 5/55 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKL-----PCNHCLHLGCLKSWMERSQTCPICRV 363
           C +CM  +    +     HK  +      PCNH  H  CL++WM     CP+CR 
Sbjct: 703 CSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLENWMSYKLQCPVCRT 757

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%)

Query: 331 KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           KH P +L C H     C+  W + + +CPICR ++   +G
Sbjct: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 314 CIVCMEDMLPPSEATSAKHK--PKKL---PCNHCLHLGCLKSWMERSQTCPICR 362
           C +CM ++    E     HK  P +    PC H  H  CL++WM     CP+CR
Sbjct: 699 CAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKLQCPVCR 752

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 332 HKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDS 368
           H P KLPC+H     CL  W +   +CP+CR  + +S
Sbjct: 239 HSPVKLPCDHIFGRECLYKWSKLENSCPLCRHKIIES 275

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 11/73 (15%)

Query: 291 NRQIDE-KLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLK 349
           N  ID  KL +  E     +E + CI+C+ +M  PS           LPC H     C+ 
Sbjct: 253 NFNIDHIKLSNGKELAFIPTESRNCILCLMEMTDPS----------CLPCGHVFCWDCIT 302

Query: 350 SWMERSQTCPICR 362
            W + +  CP+CR
Sbjct: 303 DWTKENPECPLCR 315

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 1/63 (1%)

Query: 300 DVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCP 359
           D T A    S +      +ED    +  T   H P KLPC H     CL  W +   TCP
Sbjct: 197 DATTASTPTSNEPEPTTTVEDNDEEAHPT-YNHSPTKLPCGHIFGRECLYRWCKLENTCP 255

Query: 360 ICR 362
           +CR
Sbjct: 256 LCR 258

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT 357
           L D  E     SE + CI+C+  M+ PS A          PC H     CL +W +    
Sbjct: 263 LQDPAELSFIPSESRKCILCLSLMVDPSCA----------PCGHLFCWDCLLNWSKERPE 312

Query: 358 CPICR 362
           CP+CR
Sbjct: 313 CPLCR 317

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 331 KHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG-NVALPNQ 377
           KH P +L C H     C+  W +   +CPICR  +   +G N  LP++
Sbjct: 239 KHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREGLNRDLPDE 286

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 36/89 (40%), Gaps = 26/89 (29%)

Query: 308 ASEDKMCIVCME-------DMLPPSEATSAKHK---PKK---------LPCNHCLHLGCL 348
           A++D+ C +C+E       D +   +    K K   P K         +PC H  H GCL
Sbjct: 135 ANDDETCCICLELLKTQEYDTITTQDGMRVKTKGGPPTKSIKDTDIVMIPCQHYFHAGCL 194

Query: 349 KSWM-------ERSQTCPICRVSVFDSKG 370
           K W         R   CP+CR+ +   K 
Sbjct: 195 KEWFSPQRRGKRRPLVCPLCRMDIVKCKA 223

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%)

Query: 325 SEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           +E  +  H P KLPC H     CL  W +   TCP+CR  + ++  N A
Sbjct: 290 NEVPTYSHSPLKLPCGHIFGRECLFKWSKVENTCPLCRHVIIENNQNEA 338

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 8/53 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVF 366
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR+S F
Sbjct: 247 CPVCLERM--DSETTGLI----TIPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 38.9 bits (89), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 16/57 (28%)

Query: 314 CIVCMEDMLPPSEATSAKHKP--KKLPCNHCLHLGCLKSWME------RSQTCPICR 362
           C +CME++ P        H+P  + LPC+H  H  C++ W        R   CP CR
Sbjct: 10  CPICMEEIGP--------HEPLGELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 8/63 (12%)

Query: 313 MCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNV 372
           MC VC+E +   SE T         PC H  H  CL  W  ++  CP+CR S      N 
Sbjct: 214 MCPVCLEKL--DSEVTGLV----TTPCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNNE 265

Query: 373 ALP 375
            LP
Sbjct: 266 PLP 268

>KNAG0I02090 Chr9 complement(407893..409176) [1284 bp, 427 aa] {ON}
           Anc_2.157 YHR115C
          Length = 427

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 30/122 (24%)

Query: 264 LMIAKDIIWDGIALFHTGKSVWR----------TWKSN-----RQIDEKLPDVTEAQLNA 308
           L+   DII  GI    TG    R          +WK +     + ++E++ ++TE     
Sbjct: 278 LLEDGDIIQLGINTPTTGNKKNRYVRMKVELNDSWKHDPVKFGKVLEERMNNLTED---- 333

Query: 309 SEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ---TCPICRVSV 365
           +  ++C +C+E+          +H+    PC+HC H  C++ +M +     TCP CR  +
Sbjct: 334 TRHELCSICLEE-------CKLQHRLFFAPCSHCWHSACIQPYMNKDVPLFTCPNCRC-I 385

Query: 366 FD 367
           FD
Sbjct: 386 FD 387

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 16/67 (23%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERS 355
           ++LP + EA       + CI+C+ DM  PS            PC H     CL SW +  
Sbjct: 274 DQLPYIPEA------SRKCILCLMDMTDPSCT----------PCGHLFCWDCLMSWCKER 317

Query: 356 QTCPICR 362
             CP+CR
Sbjct: 318 PECPLCR 324

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 332 HKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPN 376
           H P +LPC H     CL  W     TCP+CR  + +S  N A PN
Sbjct: 274 HSPTELPCKHIFGRECLYKWTRVQNTCPLCRHIIAESPVN-APPN 317

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVF 366
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR S F
Sbjct: 241 CPVCLERM--DSETTGLI----TIPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 10/65 (15%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT 357
           L   +E     S+ + CI+C+  ML PS A          PC H     CL SW      
Sbjct: 86  LEQASEMSFIPSDSRKCILCLGFMLDPSCA----------PCGHVFCWKCLLSWCNERPE 135

Query: 358 CPICR 362
           CP+CR
Sbjct: 136 CPLCR 140

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 57/146 (39%), Gaps = 23/146 (15%)

Query: 283  SVWRTWKSNRQIDEKLPDVTEAQ------LNASEDKMCIVCMEDMLPPSEATSAKHKPKK 336
            SV R+ KSN++ D  L  + + +       N S     I   E +   S      H    
Sbjct: 1131 SVLRSLKSNKRYDHNLKRINQIESRIKYLTNLSNLNKAIES-EKVFNCSICLGIIHHGSI 1189

Query: 337  LPCNHCLHLGCLKSWMERSQTCPICRVSV---------FDSKGNVALPNQNAAQQPISED 387
            + C H     C+ SW++  +TCPIC+            F +  N+ +P  N     I+  
Sbjct: 1190 MKCGHFFCRDCIHSWLKNQRTCPICKREATSTELYNFKFKNHDNIDVPGPN-----INSK 1244

Query: 388  ASVAQQPLSAANESNST--SLASTHT 411
            A+    P S+  E  S    +A T T
Sbjct: 1245 AATVITPPSSTEEKESARGKIAGTDT 1270

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNV 372
           +LP CNH   L C+  W+ +S TCP+CR +V + K N+
Sbjct: 66  ELPRCNHRFDLECISVWLSKSVTCPLCRDNVLEHKLNI 103

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 27/65 (41%), Gaps = 10/65 (15%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT 357
           L D+ +        + CI+C+ DM  PS            PC H     CL SW +    
Sbjct: 270 LSDMNQLPYIPESSRKCILCLMDMTDPSCT----------PCGHLFCWNCLMSWCKERPE 319

Query: 358 CPICR 362
           CP+CR
Sbjct: 320 CPLCR 324

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 332 HKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV 365
           H P K+PC H     CL  W     +CP+CR  +
Sbjct: 288 HSPVKIPCGHIFGRSCLYEWTRLENSCPLCRKKI 321

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 319 EDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV 365
           ++  P  E  +  H P KLPC H     C+  W     +CP+CR ++
Sbjct: 320 QESSPEEEQPTYLHSPTKLPCGHIFGRDCIFKWSHLENSCPLCRKAI 366

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 8/73 (10%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERSQ 356
           LP + + +L A+++  C +C  + L        +     LP C+H   L CL  W+ RS 
Sbjct: 95  LPRINKKKLKATDN--CSICYTNYLEDEYPLVVE-----LPHCHHKFDLECLSVWLSRST 147

Query: 357 TCPICRVSVFDSK 369
           TCP+CR +V   +
Sbjct: 148 TCPLCRDNVMGHR 160

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVF 366
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR S F
Sbjct: 171 CPVCLERM--DSETTGLI----TIPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 296 EKLPDVTEAQLNASEDK--MCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWM 352
           E+LP    A+L+ S D+  +C +   D    +E T        LP C+H  H  C+K W+
Sbjct: 193 EQLPRTNCAELSNSSDECPICRIAYSDDFE-TEITC-------LPNCSHHFHFECIKLWL 244

Query: 353 ERSQTCPICRVSVFDSKG 370
           +++  CP+CR +V + K 
Sbjct: 245 QKNSLCPLCRDNVMECKA 262

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 29/73 (39%), Gaps = 10/73 (13%)

Query: 290 SNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLK 349
           + +   + L D+        + + C++C+  ML PS            PC H     C+ 
Sbjct: 231 AKKHTSKDLSDLEVLPFIKEDSRKCVLCLNYMLDPSAT----------PCGHLFCWDCIM 280

Query: 350 SWMERSQTCPICR 362
            W    Q CP+CR
Sbjct: 281 EWTLERQECPLCR 293

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 10/53 (18%)

Query: 310 EDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           E + CI+C+  M+ PS A          PC H     C+ +W +    CP+CR
Sbjct: 274 ESRNCILCLNSMVDPSAA----------PCGHIFCWDCIINWCKERPECPLCR 316

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 10/55 (18%)

Query: 308 ASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           + + + CI+C+ DM  PS           LPC H     C+  W      CP+CR
Sbjct: 260 SEQSRKCILCLADMTDPS----------CLPCGHMFCWACVMQWCNERNECPLCR 304

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 9/78 (11%)

Query: 289 KSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCL 348
           +S++++D +LPD   +  +  E +      ED        +  H    LPC H     CL
Sbjct: 178 ESDQRVDNELPDPESSAHHTGEQEGG---QEDTP------TYGHSATVLPCGHVFGRECL 228

Query: 349 KSWMERSQTCPICRVSVF 366
             W     +CPICR  + 
Sbjct: 229 YKWTTEHNSCPICRAPIL 246

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 16/67 (23%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERS 355
           ++LP + E+       + CI+C+ +M  PS A          PC H     CL SW +  
Sbjct: 274 KQLPYIPES------SRKCILCLTNMTDPSCA----------PCGHLFCWDCLMSWCKER 317

Query: 356 QTCPICR 362
             CP+CR
Sbjct: 318 PECPLCR 324

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 36/87 (41%), Gaps = 19/87 (21%)

Query: 305 QLNASEDKMCIVCMEDMLPPSEATSAKHK------------PKKLP-------CNHCLHL 345
           Q+++   K C     D LP  +A S K K              K P       C H   L
Sbjct: 72  QIDSKNRKSCSKEFIDSLPRIKANSIKDKNAECAICFCKFLEDKYPLVAELPHCGHRFDL 131

Query: 346 GCLKSWMERSQTCPICRVSVFDSKGNV 372
            C+  W+ +S TCP+CR SV   K ++
Sbjct: 132 ECISVWLSKSDTCPLCRDSVLSHKTDI 158

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 16/66 (24%)

Query: 297 KLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ 356
           +LP + EA       + CI+C+ +M  PS A          PC H     CL SW +   
Sbjct: 275 QLPFIPEA------SRKCILCLMNMSDPSCA----------PCGHLFCWSCLMSWCKERP 318

Query: 357 TCPICR 362
            CP+CR
Sbjct: 319 ECPLCR 324

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 8/54 (14%)

Query: 312 KMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRV 363
           K+C +C+ED+   S  +  K      PC H  H  C++ W   ++   CP+CR+
Sbjct: 4   KVCAICLEDICGKSSTSYLK------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERS 355
           + LP V  ++L A +   C +C  + L       AK  P+   CNH   L CL  W++ +
Sbjct: 55  DSLPRVPNSKLKAED--TCAICQCNFLDDPYPLVAK-VPR---CNHKFDLECLSIWLQNN 108

Query: 356 QTCPICR 362
            TCP+CR
Sbjct: 109 HTCPMCR 115

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 12/73 (16%)

Query: 290 SNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLK 349
           S R +D  L D  +        + CI+C+ +M  PS A          PC H     C+ 
Sbjct: 249 SIRHVD--LSDPAQMPFINESSRKCILCLTEMKDPSCA----------PCGHIFCWNCII 296

Query: 350 SWMERSQTCPICR 362
           +W +    CP+CR
Sbjct: 297 NWCKERSECPLCR 309

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 10/49 (20%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           CI+C+ DM+ PS +          PC H     CL  W +    CP+CR
Sbjct: 290 CILCLNDMVDPSCS----------PCGHIFCWRCLMDWCQERAECPLCR 328

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 10/51 (19%)

Query: 312 KMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           + CI+C+ DM+ PS           LPC H     C+  W      CP+CR
Sbjct: 268 RSCILCLVDMVDPS----------CLPCGHLFCWNCIMHWCTERSECPLCR 308

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 33/78 (42%), Gaps = 14/78 (17%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           C VC+E M   SE T        +PC H  H  CL  W      CP+CR S      N+ 
Sbjct: 268 CPVCLERM--DSETTGLI----TIPCQHTFHCSCLDKW--NDSRCPVCRYS------NLR 313

Query: 374 LPNQNAAQQPISEDASVA 391
           L  ++  +Q    +A  A
Sbjct: 314 LTRESLVKQAGDSNAPCA 331

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSK 369
           +LP C+H   L CL  W+ RS TCP+CR  V   +
Sbjct: 131 ELPHCHHKFDLECLSVWLSRSTTCPLCRDDVMGHR 165

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 10/65 (15%)

Query: 298 LPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT 357
           L D ++     S  + CI+C+ +M  PS            PC H     C+ +W +  + 
Sbjct: 302 LEDPSQLPFIPSASRNCILCLNEMTDPSCP----------PCGHLFCWACIMNWCKEREE 351

Query: 358 CPICR 362
           CP+CR
Sbjct: 352 CPLCR 356

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 37.0 bits (84), Expect = 0.040,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPN 376
           +LP C+H   L CL  W+ ++ TCP+CR  V +   ++ + N
Sbjct: 103 ELPHCSHRFDLECLTPWLLKNSTCPLCRDDVMEKVDSIDVSN 144

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 332 HKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFD 367
           H P +LPC H     CL  W +   +CP+CR  + +
Sbjct: 296 HSPVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVE 331

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR S
Sbjct: 240 CPVCLERM--DSETTGLV----TIPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 16/68 (23%)

Query: 295 DEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMER 354
           + +LP + +A       + CI+C+  M  PS A          PC H     C+ SW + 
Sbjct: 263 ESQLPYIPQA------SRSCILCLNAMTDPSCA----------PCGHIFCWDCILSWCKE 306

Query: 355 SQTCPICR 362
              CP+CR
Sbjct: 307 RPECPLCR 314

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 18/93 (19%)

Query: 309  SEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV--- 365
             E+  C VC  ++   S           + C H     C+ +W++   TCP+C+ +V   
Sbjct: 1159 GEELSCAVCFNEIFVGS----------VVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPS 1208

Query: 366  ----FDSKGNVALPNQNAAQQPISEDASVAQQP 394
                F  K    LP ++ A++   E    +Q+P
Sbjct: 1209 EVYNFRYKEGEELP-EDGAEEAAQESGPFSQKP 1240

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR S
Sbjct: 240 CPVCLERM--DSETTGLV----TIPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 18/93 (19%)

Query: 309  SEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSV--- 365
             E+  C VC  ++   S           + C H     C+ +W++   TCP+C+ +V   
Sbjct: 1159 GEELSCAVCFNEIFVGS----------VVKCGHFFCYSCIHTWLKEHNTCPLCKTNVTPS 1208

Query: 366  ----FDSKGNVALPNQNAAQQPISEDASVAQQP 394
                F  K    LP ++ A++   E    +Q+P
Sbjct: 1209 EVYNFRYKEGEELP-EDGAEEAAQESGPFSQKP 1240

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
           +LP CNH   L C+  W+ +S +CP+CR  V   K     P  + +Q  + ED
Sbjct: 120 ELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHK-----PGIDTSQVELEED 167

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   SE T        +PC H  H  CL  W  ++  CP+CR S
Sbjct: 240 CPVCLERM--DSETTGLV----TIPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
           +LP C H   L CL  W  +S +CP+CR  V   +  V     + +Q  + ED
Sbjct: 92  RLPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEV-----DTSQVELEED 139

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 332 HKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
             P +LPC+H     CL  W     TCP+CR
Sbjct: 257 ESPVELPCHHIFGRECLYKWTRHENTCPLCR 287

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%), Gaps = 8/53 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVF 366
           C VC+E M       S+      +PC H  H  CL  W  ++  CPICR S  
Sbjct: 283 CPVCLERM------DSSITGLITIPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 8/68 (11%)

Query: 297 KLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ 356
           K P   + ++  +E   C VC+E +   SE T        +PC H  H  CL  W +   
Sbjct: 210 KDPFTAKKEVQDTELPTCPVCLERL--DSEVTGLA----TIPCQHTFHCVCLNKWGD--N 261

Query: 357 TCPICRVS 364
            CP+CR S
Sbjct: 262 RCPVCRYS 269

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPI 384
           PC H +H  C   + + S  CP C+VSV + +    + ++   +QP+
Sbjct: 405 PCGHAIHQHCFDEYTKHSYKCPSCQVSVLNMEAQFRVLDKEIEEQPL 451

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   +           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 240 CPVCLERMDSETSGLVT------IPCQHTFHCQCLNKW--KNSRCPVCRHS 282

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 10/66 (15%)

Query: 297 KLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ 356
           +L D T+ +   SE + C +C+  +  PS            PC H     C+  W     
Sbjct: 211 RLSDETQFKFIPSESRDCALCLSKITDPSVG----------PCGHIFCWDCIVDWCRERP 260

Query: 357 TCPICR 362
            CP CR
Sbjct: 261 ECPFCR 266

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E +   SE T        +PC H  H  CL  W  +   CP+CR S
Sbjct: 247 CPVCLERL--DSEVTGLA----TIPCQHTFHCQCLNKW--KDSRCPVCRYS 289

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 37.7 bits (86), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   +           +PC H  H  CL  W  ++  CP+CR S
Sbjct: 234 CPVCLERMDSDTTGLIT------IPCQHTFHCQCLDKW--KNSKCPVCRYS 276

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 35.0 bits (79), Expect = 0.076,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSK 369
           KLP C H     CL  W+ +++TCP+CR  +   K
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCRDDITSHK 85

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISE 386
           PC H +H  C   + + S  CP C+V+V +      + +    +QP+ E
Sbjct: 399 PCGHAIHQHCFDEYTKHSYKCPHCQVTVLNMDAQFRVLDSEIEEQPLPE 447

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 37.0 bits (84), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 11/57 (19%)

Query: 312 KMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWME---RSQTCPICRVSV 365
           K C +C + M        A +  K +PC H  HL C++ W       +TCP CRV +
Sbjct: 7   KECPICWDSM--------ADNVAKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 35/78 (44%), Gaps = 13/78 (16%)

Query: 307 NASEDKM----CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           N S+D++    C VC+E +   +           +PC H  H  CL  W  ++  CP+CR
Sbjct: 224 NPSQDQVELPTCPVCLERLDDGTTGLIT------IPCQHTFHCQCLDKW--KNSKCPVCR 275

Query: 363 VSVFDSKGNVALPNQNAA 380
            S        AL  QNA+
Sbjct: 276 YSNL-KFSREALLRQNAS 292

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISE 386
           PC H +H  C   +   S  CP C+V+V +      + ++   +QP+ E
Sbjct: 350 PCGHAIHQHCFDEYTRHSYKCPHCQVTVLNMDAQFRVLDKEIEEQPLPE 398

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 311 DKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT--CPICR 362
           D +C +C +D L  ++    K KP    CNH  H  C++ W   S    CP+CR
Sbjct: 9   DNICPICFDD-LNDTDILQGKLKP----CNHKYHYDCIRRWHGYSDNSDCPLCR 57

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 25/47 (53%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPI 384
           PC H +H  C   + + S  CP C+VS+ + +    + ++   +QP+
Sbjct: 404 PCGHAIHQHCFDEYTKHSYKCPSCQVSILNMEAQFRVLDKEIEEQPL 450

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   S+ T        +PC H  H  CL  W  ++  CP+CR S
Sbjct: 234 CPVCLERM--DSDTTGLI----TIPCQHTFHCQCLDKW--KNSRCPVCRYS 276

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSK 369
           +LP C H   L C+  W++++ +CPICR  V + K
Sbjct: 132 ELPNCKHYFDLECITLWLQKNSSCPICRNDVLEKK 166

>Skud_4.576 Chr4 complement(1031529..1032410) [882 bp, 293 aa] {ON}
           YDR313C (REAL)
          Length = 293

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 7/64 (10%)

Query: 291 NRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKS 350
           NR +  K+P +T    N S  K C +C EDM P         K  +L C    H  C+K 
Sbjct: 209 NRMLVYKIPPITSGDENGSVIKECPICFEDMEP-------GEKVGRLECLCVFHYKCIKD 261

Query: 351 WMER 354
           W  +
Sbjct: 262 WFHK 265

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFD-SKGNV 372
           C VC+E M   S+ T        +PC H  H  CL  W  +   CP+CR S    ++GN+
Sbjct: 237 CPVCLERM--DSDITGLI----TIPCQHTFHCQCLDKW--KDSRCPVCRYSNLKLTRGNL 288

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 5/73 (6%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           C +C E M      TS K      PC H +H  C       S  CP C+V+V + +    
Sbjct: 369 CPICGEYMF-----TSVKPVVYMSPCGHAIHQHCFNDHTRHSYKCPQCQVTVVNMEAQFR 423

Query: 374 LPNQNAAQQPISE 386
           + ++    QP+ E
Sbjct: 424 IMDREVDDQPLPE 436

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 10/55 (18%)

Query: 313 MCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRVSV 365
           +C +C+ D +  S A       K  PCNH  H+ C+++W   S    CP CR+  
Sbjct: 18  ICAICL-DAIDKSIA-------KLEPCNHKYHIDCIRTWHNYSNDLNCPTCRIET 64

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 14/78 (17%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVA 373
           C VC+E +    E T        +PC H  H  CL  W  ++  CP+CR S      N+ 
Sbjct: 238 CPVCLEQL--DCETTGLI----TIPCQHTFHCQCLDKW--KNSRCPVCRYS------NLR 283

Query: 374 LPNQNAAQQPISEDASVA 391
           L  ++  +Q    +A  A
Sbjct: 284 LTRESLLKQAGGSNAKCA 301

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 38/90 (42%), Gaps = 17/90 (18%)

Query: 273 DGIALFHTGKSVWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKH 332
           D  A+F   K V    K+N+ ID  L D T         + CI+C+  ++ PS A     
Sbjct: 243 DMKAIFGVPKQV----KTNK-ID--LNDDTLFTFIQGASRTCILCLSKIVDPSCA----- 290

Query: 333 KPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
                PC H     C+ +W      CP+CR
Sbjct: 291 -----PCGHLYCWDCILNWCNEKPECPLCR 315

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 14/57 (24%)

Query: 313 MCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQT----CPICRVSV 365
           MC +C + M  P              C H    GCLKSW   ++T    CP CR SV
Sbjct: 29  MCSICQDYMFVP----------MMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSV 75

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 7/53 (13%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRVS 364
           C +C++D     E+          PCNH  H  CL+ W   +    CPICRV 
Sbjct: 5   CPICLDDDRTNIESIGTLQ-----PCNHKFHRDCLRRWHLYAHDLVCPICRVE 52

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 15/95 (15%)

Query: 296 EKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLH---LGCLKSWM 352
           + LP + + +L +  D  C +C  + +       A   P  +   HC H     C+  W+
Sbjct: 88  DSLPRIPQKKLKS--DDTCPICCSNFI-------ADEYPLVVELPHCGHKFDFECVSMWL 138

Query: 353 ERSQTCPICRVSVFDSKGNVALPNQNAAQQPISED 387
            ++ TCP+CR  V   K    LP  + ++  + ED
Sbjct: 139 TKNTTCPMCRDDVTHKK---ELPELDTSKVELEED 170

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 33.9 bits (76), Expect = 0.39,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 339 CNHCLHLGCLKSWMERSQT---CPICR 362
           CNH  H+ C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 33.1 bits (74), Expect = 0.41,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 314 CIVCMEDMLPP-----SEAT-SAKHKPKKL--PCNHCLHLGCLKSWMERSQTCPI 360
           C +C   ++ P      EAT +++H+       CNH  HL C+  W++    CP+
Sbjct: 44  CAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPL 98

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 11/53 (20%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWME---RSQTCPICRV 363
           C +C E M  PS         + +PC H  HL C++ W      +++CP+CR 
Sbjct: 18  CSICWESM--PSGV------GRLMPCGHEYHLACIRKWFHLHSGNRSCPVCRT 62

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           C VC+E M       S       +PC+H  H  CL  W  ++  CP+CR
Sbjct: 241 CPVCLEKM------DSLVTGLITIPCSHTFHCQCLDKW--KNSKCPVCR 281

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 13/66 (19%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRVS---VFDS 368
           C +C+E +         ++  + + C H  HL C++ W   SQ   CP CRV    + D 
Sbjct: 6   CSICLEAL--------GQNIGRLVTCQHEYHLECIREWHNHSQDFKCPTCRVESNKLLDV 57

Query: 369 KGNVAL 374
           + NV +
Sbjct: 58  ENNVTI 63

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 33.1 bits (74), Expect = 0.61,   Method: Composition-based stats.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 105 CNHAFHLHCINKWLQTRNACPL 126

>Suva_2.481 Chr2 complement(853097..853960) [864 bp, 287 aa] {ON}
           YDR313C (REAL)
          Length = 287

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 7/64 (10%)

Query: 291 NRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKS 350
           NR +  K+P ++    N  E K C +C EDM P         K  +L C    H  C+K+
Sbjct: 203 NRMLVYKIPPISTNDENHVEIKECPICFEDMEP-------GEKVGRLECLCVFHYKCIKN 255

Query: 351 WMER 354
           W  +
Sbjct: 256 WFHK 259

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%)

Query: 334 PKKLPCNHCLHLGCLKSWMERSQ----TCPICRVSV 365
           P   PC H    GCL SW   S     +CP CR S+
Sbjct: 40  PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSI 75

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
           Anc_3.405 YPR093C
          Length = 93

 Score = 32.0 bits (71), Expect = 0.67,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 10/60 (16%)

Query: 306 LNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERS--QTCPICRV 363
           ++ S   MC +C+E+     E     H     PC H  H  C++ W   +    CP CR+
Sbjct: 1   MSESPQFMCAICLEE---GHEEFGELH-----PCRHKFHKECIRRWHTGAIDLKCPTCRI 52

>CAGL0L06336g Chr12 (715056..716858) [1803 bp, 600 aa] {ON} some
           similarities with uniprot|P32917 Saccharomyces
           cerevisiae YDR103w STE5 pheromone signal transduction
           pathway protein
          Length = 600

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 311 DKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRV-SVFDSK 369
           + +C +C E    P    S   K  +L C H  H+ CL  ++  S   PIC+    F+++
Sbjct: 37  NHICTLCDE----PIAYKSGGEKVIELECGHMCHMDCLMLFV-NSTALPICKYCKKFNNR 91

Query: 370 GNVALPNQNAAQQPISEDASVAQQPLSAANESNSTSLASTHTGSLGAVSSSN 421
               +P +N  +  +     V  +  S  +E++  S+         + +S N
Sbjct: 92  AKECIPKENCLKDTLISQYLVNNKMNSPVHETSHKSIDKHSNQKYTSSTSQN 143

>KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 965

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 14/24 (58%)

Query: 337 LPCNHCLHLGCLKSWMERSQTCPI 360
           L CNH +H G  + W ER   CP+
Sbjct: 933 LKCNHGMHAGHAEEWFERHSICPV 956

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 14/63 (22%)

Query: 310 EDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWM----ERSQTCPICRVSV 365
           E  +C +C E M  P   TS  H       N+C   GCLKSW+    ++   CP CR  +
Sbjct: 26  ESAICTICSEYMFVPM-MTSCGH-------NYCY--GCLKSWISTNSKKELACPQCRSDI 75

Query: 366 FDS 368
            D+
Sbjct: 76  TDT 78

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPN 376
           +LP C H     C+  W+ +++TCPICR ++   K  +   N
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICRDNLTSHKEVIDTSN 164

>KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.405
           YPR093C
          Length = 228

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 10/68 (14%)

Query: 314 CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRVSVFDSKGN 371
           C +C+ED+      +  K      PCNH  HL C++ W   S    CP C+      K N
Sbjct: 3   CPICLEDLAANDIISELK------PCNHKYHLVCIRKWQLDSNQLKCPYCQCKT--GKMN 54

Query: 372 VALPNQNA 379
           + L   N+
Sbjct: 55  LKLNKLNS 62

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 22/46 (47%)

Query: 325 SEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKG 370
           +E +  KH P +LPC H     C+  W +   +   C   + +++G
Sbjct: 212 AEQSHYKHSPTELPCGHVFGRDCIFRWTQEHNSLSYCWARIVENEG 257

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISE 386
           PC H +H  C +     S  CP C+V+V +      + +    +QP+ E
Sbjct: 239 PCGHAIHQHCFEEHTRHSYKCPHCQVTVLNMDAQFRVLDVEIEEQPLPE 287

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 32.3 bits (72), Expect = 0.95,   Method: Composition-based stats.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 76  CNHAFHLHCINKWIKTRDACPL 97

>Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON}
            YBL104C (REAL)
          Length = 1038

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 337  LPCNHCLHLGCLKSWMERSQTCP 359
            L CNH +H G  + W ER   CP
Sbjct: 1006 LSCNHGMHAGHAEEWFERHNVCP 1028

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 32.0 bits (71), Expect = 1.1,   Method: Composition-based stats.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 85  CNHAFHLHCINKWIKTRDACPL 106

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 47/120 (39%), Gaps = 20/120 (16%)

Query: 259  PFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQ-----IDEKLPDVTE-----AQLNA 308
            P + PL   + I   GI+     +  W+ W  + Q     ++  + D  E      +L  
Sbjct: 1452 PINYPLTNIEAI---GISRVGISEQKWKQWIMSTQRVITGMNGSVIDCLELFTKNVRLQF 1508

Query: 309  SEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPICRVSV 365
            S  + C +C   +     A   K   K  P CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1509 SGFEECAICYSIL----HAVDRKLPSKTCPTCNNKYHGACLYKWFRSSGNNTCPMCRSEI 1564

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 18/32 (56%)

Query: 332  HKPKKLPCNHCLHLGCLKSWMERSQTCPICRV 363
            H    + C H     C+ SW++ +Q+CP+C+ 
Sbjct: 1209 HTGSIIKCGHFFCRKCIHSWLKNNQSCPLCKT 1240

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 20/120 (16%)

Query: 259  PFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQ-----IDEKLPDVTE-----AQLNA 308
            P + PL    +I   G++     +  W++W  + Q     ++  + D  E       L+ 
Sbjct: 1458 PLNYPL---NNIQVHGVSRVGINEQKWKSWILSAQRVIVGMNGSVMDSLELFTKNVNLHF 1514

Query: 309  SEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPICRVSV 365
            S  + C +C   +     A   K   K  P CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1515 SGFEECAICYSIL----HAVDRKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1570

>NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_7.440
            YBL104C
          Length = 1034

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 337  LPCNHCLHLGCLKSWMERSQTCP 359
            L CNH +H G    W E+  TCP
Sbjct: 999  LSCNHGMHAGHSDEWFEKHSTCP 1021

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 338 PCNHCLHLGCLKSWMERSQTCPICRVSVFD 367
           PC H +H  C   +++ S  CP C VSV +
Sbjct: 390 PCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score = 32.3 bits (72), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKG 370
           CNH  H+ C+  W++ + +   CP+CR +    KG
Sbjct: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101

>TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7.440
           YBL104C
          Length = 1005

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 13/23 (56%)

Query: 337 LPCNHCLHLGCLKSWMERSQTCP 359
           L CNH +H G  + W ER   CP
Sbjct: 973 LSCNHGMHAGHAEEWFERHDVCP 995

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 48/114 (42%), Gaps = 35/114 (30%)

Query: 287 TWKSNRQIDEKLPDVTEAQLNASEDKM-----CIVCMEDM-LPPSEATSAKH-------- 332
           T K +  +D+K+P     +++  +D++     CI+C+E + + PS     K         
Sbjct: 117 TRKVSIDMDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVPSTNDLEKQQNGTEQTT 176

Query: 333 -----KPKKLPCNHCLHLGCLKSWME------RSQT----------CPICRVSV 365
                K  KLPC H  H  C+K W        +S T          CP+CR+ +
Sbjct: 177 DMIPSKVVKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRLDL 230

>Kwal_26.8362 s26 (754563..754934) [372 bp, 123 aa] {OFF} [contig
           59] FULL
          Length = 123

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 253 RVASLAPFSMPLMIAK-------DIIWDGIALFHTGKSVWRTWKSNR 292
             A+L  F +PLMIA        ++I DG A+  T +S   TWKSN 
Sbjct: 34  ETAALFGFPVPLMIASRPHFCNVEMITDGAAVPFTARSFSGTWKSNE 80

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 41/105 (39%), Gaps = 17/105 (16%)

Query: 274  GIALFHTGKSVWRTWKSNRQ-----IDEKLPDVTE-----AQLNASEDKMCIVCMEDMLP 323
            G++     +  W++W  + Q     ++  + D  E       L  S  + C +C   +  
Sbjct: 1453 GVSRVGINEQKWKSWILSTQRVITGMNGSVMDSLELFTKNVNLQFSGFEECAICYSIL-- 1510

Query: 324  PSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPICRVSV 365
               A   K   K  P CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1511 --HAVDRKLPTKTCPTCNNKFHGACLYKWFRSSGNNTCPMCRSEI 1553

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 337  LPCNHCLHLGCLKSWMERSQTCPICRVSVFDSKGNVALPNQNAAQQPISEDASVAQQ 393
            + C H     C+ SW++   +CP+C++    S+   +   Q+A  +  SE  S AQQ
Sbjct: 1236 IKCGHFFCQSCIFSWLKNHASCPLCKMQTSMSEV-YSFKFQDAQPEADSEQDSAAQQ 1291

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 10/51 (19%)

Query: 312 KMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
           + CI+C+  M  PS +          PC H     C+  W +    CP+CR
Sbjct: 278 RKCILCLAYMTDPSCS----------PCGHIFCWECILDWCKERPECPLCR 318

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSV 365
           +LP C+H   L C+  W+  + TCP+CR  V
Sbjct: 104 ELPHCSHKFDLQCISVWLSSNSTCPVCRDKV 134

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 312 KMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICR 362
           ++C +C+E M    +        + LPC H  H+ C++ W   S    CP CR
Sbjct: 3   EICGICLESMNETDQG-------ELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 31.2 bits (69), Expect = 1.9,   Method: Composition-based stats.
 Identities = 9/22 (40%), Positives = 12/22 (54%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W+     CP+
Sbjct: 75  CNHAFHLHCINKWLLTRNACPL 96

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 20/122 (16%)

Query: 254  VASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTW--KSNRQIDEKLPDVTEA------- 304
            VA   P + PL   +++   G++     +  W++W   + R I      V ++       
Sbjct: 1397 VAFKLPSNFPL---QNVQVHGVSRVGITEQQWKSWIISTQRIISNMNGSVVDSLELLSKN 1453

Query: 305  -QLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPI 360
             +L  S  + C +C   +     A   K   K  P CN+  H  CL  W + S   TCP+
Sbjct: 1454 VKLQFSGFEECAICYYVL----HAIDRKLPTKVCPTCNNRFHGACLYKWFKSSGNNTCPL 1509

Query: 361  CR 362
            CR
Sbjct: 1510 CR 1511

>Kpol_1064.26 s1064 (46349..47392) [1044 bp, 347 aa] {ON}
           (46349..47392) [1044 nt, 348 aa]
          Length = 347

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 165 VRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIE 213
           +RFC+ N + + +  SPS  V +L     SML++D+ +V + S I+L++
Sbjct: 133 MRFCVVNLIDSYYITSPSQYVSVLLLALRSMLMMDLPQVNVLSKIDLVK 181

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 24/50 (48%), Gaps = 10/50 (20%)

Query: 314  CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRV 363
            C +C++D+   S           L C H     C+ SW++  + CP+C++
Sbjct: 1191 CSICLQDISLGS----------MLKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 8/39 (20%)

Query: 335  KKLP------CNHCLHLGCLKSWMERS--QTCPICRVSV 365
            +KLP      CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1517 RKLPTKTCPTCNNKFHGACLYKWFRSSGNNTCPLCRSEI 1555

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 22/54 (40%), Gaps = 5/54 (9%)

Query: 314  CIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERS--QTCPICRVSV 365
            C +C   + P       K  P    CN+  H  CL  W   S   +CP+CR  +
Sbjct: 1493 CAICYSILHPVDRKLPTKVCP---TCNNRFHGACLYKWFRSSGNNSCPLCRSEI 1543

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 23/55 (41%), Gaps = 7/55 (12%)

Query: 314  CIVCMEDMLPPSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPICRVSV 365
            C +C   +     A   K   K  P CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1537 CAICYSTL----HAVDRKLPTKVCPTCNNKFHGSCLYKWFRSSNNNTCPLCRSEI 1587

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 8/59 (13%)

Query: 307 NASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMER-SQTCPICRVS 364
            A     C +C ED        +  +    L CNH  H  C+  W+ R S  CP+C+ S
Sbjct: 113 GADSRTTCAICQEDF-------NKLNNVCLLGCNHVFHTYCIDQWICRNSACCPLCKRS 164

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 40/105 (38%), Gaps = 17/105 (16%)

Query: 274  GIALFHTGKSVWRTWKSNRQ-----IDEKLPDVTE-----AQLNASEDKMCIVCMEDMLP 323
            G++     +  W+ W  + Q     ++  + D  E       L  S  + C +C   +  
Sbjct: 1451 GVSRVGISEQKWKQWIMSTQRVITGMNGSVADSLELFTKNVNLQFSGFEECAICYSIL-- 1508

Query: 324  PSEATSAKHKPKKLP-CNHCLHLGCLKSWMERS--QTCPICRVSV 365
               A   K   K  P CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1509 --HAVDRKLPTKTCPTCNNKFHGSCLYKWFRSSGNNTCPLCRGEI 1551

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 4/39 (10%)

Query: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKGNVAL 374
           CNH  H+ C++ W+E +     CP+CR   F  K  VA+
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR-QQFSLKRGVAI 99

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 77  CNHAFHLHCINKWLQTRNACPL 98

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 308 ASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMER-SQTCPICRVS 364
           + E++ C++C E         +  +  + L C+H  H  C+  W+ R S  CP+C+ S
Sbjct: 104 SDEEESCVICQEQF-------NELNNIRVLGCSHIFHSHCIDRWICRNSACCPLCKRS 154

>TDEL0E04390 Chr5 (819719..825592) [5874 bp, 1957 aa] {ON} Anc_5.190
            YGR184C
          Length = 1957

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 27/112 (24%)

Query: 337  LPCNHCLHLGCLKSWMERSQ------TCPICRVSVFDSKGNVALPNQNAAQQPIS----- 385
            + CNH +H  C K ++++ +       CP+C+     +  N  LP +  ++Q        
Sbjct: 1284 VSCNHSVHHSCFKRYVQKKRFSSNAFICPLCQ-----TYSNCVLPIRRTSKQNTGLSVDS 1338

Query: 386  --------EDASVAQQPLSAANESNSTS---LASTHTGSLGAVSSSNPNFPT 426
                    ++ S   +  SAA+  N  S   L + H+ S    + S P F +
Sbjct: 1339 LVNVRVSVDELSRLFESFSAADFKNVYSTFNLVTLHSHSYDKAARSTPGFES 1390

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 78  CNHAFHLHCINKWLQTRNACPL 99

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 16/29 (55%)

Query: 337  LPCNHCLHLGCLKSWMERSQTCPICRVSV 365
            + C H     C+ SW++   +CP+C+ S 
Sbjct: 1167 IKCGHFFCRSCIHSWLKNHNSCPMCKTST 1195

>ZYRO0B10692g Chr2 (848105..853921) [5817 bp, 1938 aa] {ON} similar to
            uniprot|P19812 Saccharomyces cerevisiae YGR184C UBR1
            Ubiquitin-protein ligase (E3) that interacts with
            Rad6p/Ubc2p to ubiquitinate substrates of the N-end rule
            pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
            the 19S particle of the 26S proteasome
          Length = 1938

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 17/103 (16%)

Query: 339  CNHCLHLGCLKSWMERSQ------TCPICRVSV-------FDSKGNVALPNQNAAQQPIS 385
            CNH +H GC K ++++ +       CP+C+            SK N  L  +    + +S
Sbjct: 1275 CNHSIHHGCFKRYVQKKRFSTNSFICPLCQTFSNCVLPIRHVSKVNTGLSTEGLLSEEVS 1334

Query: 386  EDA-SVAQQPLSAANESNSTS---LASTHTGSLGAVSSSNPNF 424
             D  +   +  SA++  N  S   L + H+ S    + + P F
Sbjct: 1335 VDVLARLLETFSASDFKNVYSTFNLVALHSHSYDKNARNMPGF 1377

>KLTH0C05500g Chr3 complement(475687..478644) [2958 bp, 985 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 985

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 14/24 (58%)

Query: 337 LPCNHCLHLGCLKSWMERSQTCPI 360
           L CNH +H G  + W E+   CP+
Sbjct: 953 LSCNHGMHAGHAEEWFEKHYICPV 976

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 8/39 (20%)

Query: 335  KKLP------CNHCLHLGCLKSWMERS--QTCPICRVSV 365
            +KLP      CN+  H  CL  W   S   TCP+CR  +
Sbjct: 1508 RKLPSKVCPTCNNRFHGACLYKWFRSSGNNTCPLCRSEI 1546

>CAGL0H07315g Chr8 (715930..716766) [837 bp, 278 aa] {ON} similar to
           uniprot|Q06651 Saccharomyces cerevisiae YDR313c PIB1
          Length = 278

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 7/66 (10%)

Query: 291 NRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKS 350
           NR +  K+P  T  +      + C +C E+M+P         K  +L C    H  C+KS
Sbjct: 200 NRMLVYKIPTTTAPENEPQGYQECPICFEEMVP-------GEKVGRLECLCVYHYSCIKS 252

Query: 351 WMERSQ 356
           W  + +
Sbjct: 253 WFRKKR 258

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 11/48 (22%)

Query: 337  LPCNHCLHLGCLKSWMERS--QTCPICRVSV---------FDSKGNVA 373
            L C H     C+ +W+E+S  + CPIC++           FDS  N A
Sbjct: 1150 LKCGHYYCQDCIWNWLEKSKKKNCPICKIETNINDTYNFKFDSTNNEA 1197

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 27/70 (38%), Gaps = 12/70 (17%)

Query: 293 QIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWM 352
           +I  + P+V       S D  C +C+  M  PS A          PC H     CL  W 
Sbjct: 239 KISLRDPEVMPFISGPSRD--CTLCLLPMTNPSCA----------PCGHTYCWDCLFKWC 286

Query: 353 ERSQTCPICR 362
                CP+CR
Sbjct: 287 NERPECPLCR 296

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 2/27 (7%)

Query: 339 CNHCLHLGCLKSWMERS--QTCPICRV 363
           C H  HL C++ W + S    CPICRV
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 10/55 (18%)

Query: 311 DKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ--TCPICRV 363
           D  C +C E+      A +        PC+H  HL C++ W   +    CP CR 
Sbjct: 3   DLECAICFEEFKEDRCALN--------PCHHTFHLECIRIWHSYADDLKCPTCRT 49

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 334 PKKLPCNHCLHLGCLKSWM---ERSQTCPICRVSV 365
           P   PC H    GCL +W+    +   CP CR ++
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCRSTI 74

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 336 KLP-CNHCLHLGCLKSWMERSQTCPICRVSVFDSK 369
           +LP C H   L C+  W+    TCP+CR  V   K
Sbjct: 109 QLPHCGHIFDLQCISMWLSNQVTCPMCRDVVNGHK 143

>KAFR0B04600 Chr2 complement(956458..957684) [1227 bp, 408 aa] {ON}
           Anc_2.157 YHR115C
          Length = 408

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 11/74 (14%)

Query: 307 NASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ---TCPICRV 363
           N+ + ++C +C+E M P      +       PC H  H  C++  + +      CP CR 
Sbjct: 339 NSQDKELCSICLEKMSPYQGVFVS-------PCCHLWHYNCIRRVITQHYPQFVCPNCRY 391

Query: 364 SVFDSKGNVALPNQ 377
           +  D +  + LP++
Sbjct: 392 TS-DLESPIGLPDE 404

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 12/53 (22%)

Query: 314 CIVCMEDMLPPSEA--TSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   +    T+A        C H  H  CL  W  +   CP+CR S
Sbjct: 235 CPVCLERMDSDTTGLITTA--------CQHTFHCQCLDQW--KGGRCPVCRYS 277

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 12/60 (20%)

Query: 303  EAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICR 362
            EAQ N + +  C +C++   P +             C H     C+ SW++  +TCP+C+
Sbjct: 1155 EAQKNTTME--CSICLQ---PITNGAMVN-------CGHLFCTSCIFSWLKNRKTCPLCK 1202

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%), Gaps = 6/58 (10%)

Query: 317 CMEDMLPPSEA--TSAKHK----PKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDS 368
            M+  +P S     + KH+    P +L C H     CL  W +   +CP+CR  + ++
Sbjct: 309 SMDSTIPTSSTPDENKKHEYHNSPVQLSCKHIFCRSCLYEWSKLKNSCPLCRKKIVET 366

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 14/22 (63%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++  + CP+
Sbjct: 89  CNHAFHLHCINKWIKTREACPL 110

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 90  CNHAFHLHCINKWIQTRDACPL 111

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 12/53 (22%)

Query: 314 CIVCMEDMLPPSEA--TSAKHKPKKLPCNHCLHLGCLKSWMERSQTCPICRVS 364
           C VC+E M   +    T+A        C H  H  CL  W  +   CP+CR S
Sbjct: 212 CPVCLERMDSDTTGLITTA--------CQHTFHCQCLDKW--KDGRCPVCRYS 254

>Skud_7.210 Chr7 (375191..377248) [2058 bp, 685 aa] {ON} YGL071W
           (REAL)
          Length = 685

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 324 PSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQTCP 359
           PSEAT   H+P+KL  N+ +HL  + ++ ++S   P
Sbjct: 79  PSEATGHIHQPEKLNQNNLIHLDPVPNFKDKSDIKP 114

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 12/21 (57%)

Query: 339  CNHCLHLGCLKSWMERSQTCP 359
            C H LHL C K W   S+ CP
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECP 1106

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>ZYRO0B14388g Chr2 complement(1169054..1170436) [1383 bp, 460 aa]
           {ON} similar to uniprot|Q04638 Saccharomyces cerevisiae
           YML068W ITT1 Protein that modulates the efficiency of
           translation termination interacts with translation
           release factors eRF1 (Sup45p) and eRF3 (Sup35p) in vitro
           contains a zinc finger domain characteristic of the
           TRIAD class of proteins
          Length = 460

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 8/44 (18%)

Query: 308 ASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCLHLGCLKSW 351
           AS++  C +CME        T    K  KLPC+H L L C KS+
Sbjct: 173 ASQNFNCSICME--------TKKGDKMIKLPCHHALCLDCTKSY 208

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 31.2 bits (69), Expect = 8.1,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 32/75 (42%), Gaps = 4/75 (5%)

Query: 332  HKPKKLPCNHCLHLGCLKSWMERSQTCPICRVSVFDSK-GNVALPNQNAAQQPISEDAS- 389
            H    + C H     C+ SW++ +  CP+C+     S+  N    N+   +   +E+ S 
Sbjct: 1279 HTGSMISCGHFFCNNCIFSWLKLNSNCPLCKRDTTQSQLYNFKFKNEITEESTNNEELSD 1338

Query: 390  --VAQQPLSAANESN 402
                Q+P     ESN
Sbjct: 1339 IRAPQKPNHPNIESN 1353

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%)

Query: 339 CNHCLHLGCLKSWMERS--QTCPICRVS 364
           C H  HL C++ W + S    CPICR+ 
Sbjct: 23  CRHQFHLNCIREWHKYSIDLKCPICRIE 50

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 9/75 (12%)

Query: 339 CNHCLHLGCLKSWMERSQT---CPICRVSVFDSKGNVALPNQNAAQQPI--SEDASVAQQ 393
           C H  H+ C+  W++ + +   CP+CR   F  K  VAL   N +Q+ +  S +   A+Q
Sbjct: 78  CFHNFHVHCIYKWLDTTTSKGLCPMCRQE-FKLKEGVAL---NKSQEDVFKSLELKQARQ 133

Query: 394 PLSAANESNSTSLAS 408
              A +E     L+ 
Sbjct: 134 RFGAFDEDVDVDLSG 148

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 74  CNHAFHLHCINKWIKTRDACPL 95

>KAFR0D04640 Chr4 complement(911653..912561) [909 bp, 302 aa] {ON}
           Anc_5.339 YDR313C
          Length = 302

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 30/73 (41%), Gaps = 20/73 (27%)

Query: 284 VWRTWKSNRQIDEKLPDVTEAQLNASEDKMCIVCMEDMLPPSEATSAKHKPKKLPCNHCL 343
           V++  K N +  E+ P+             C +C E+M+P         K  +L C    
Sbjct: 227 VYKVAKDNTKTTEEYPE-------------CPICFEEMIPGD-------KVGRLECLCVF 266

Query: 344 HLGCLKSWMERSQ 356
           H  C+KSW  + Q
Sbjct: 267 HYKCIKSWFNKRQ 279

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 88  CNHAFHLHCINKWIKTRDACPL 109

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 89  CNHAFHLHCINKWIKTRDACPL 110

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 347  CLKSWMERSQTCPICRVSVFDSK 369
            C+ SW+E  Q+CP+C+     S+
Sbjct: 1242 CISSWLETKQSCPLCKTQTKSSE 1264

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 31.2 bits (69), Expect = 8.8,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 337  LPCNHCLHLGCLKSWMERSQTCPICR 362
            + C H     C++SW++   +CP+C+
Sbjct: 1239 IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 29.3 bits (64), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 85  CNHAFHLHCINKWIKTRDACPL 106

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 83  CNHAFHLHCINKWIKTRDACPL 104

>SAKL0H16148g Chr8 (1409423..1411015) [1593 bp, 530 aa] {ON} similar
           to uniprot|Q03899 Saccharomyces cerevisiae YDR131C
           Hypothetical ORF
          Length = 530

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%)

Query: 81  HIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLKDRLEYVFQH 135
           H++E L FT +  F + S FP   F        L+  I+ FH + + +L+Y+F H
Sbjct: 263 HLYELLEFTNIKEFSLLSLFPNDHF--------LVQCIKKFHALERLKLDYMFDH 309

>NDAI0E01000 Chr5 complement(202491..203534) [1044 bp, 347 aa] {ON}
           Anc_8.712
          Length = 347

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 156 IFAVVDYQM-VRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIE 213
           IF  ++ Q+ +RFC+ N +   +  SPS  V IL     SML++D+ ++ + S I++++
Sbjct: 123 IFKKLEKQLSMRFCVVNLIDCYYITSPSQYVSILLLALRSMLMMDLPQINVFSKIDMLK 181

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 339 CNHCLHLGCLKSWMERSQTCPI 360
           CNH  HL C+  W++    CP+
Sbjct: 69  CNHAFHLHCINKWIKTRDACPL 90

>NCAS0B00370 Chr2 (48637..49680) [1044 bp, 347 aa] {ON} Anc_8.712
          Length = 347

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 31/49 (63%)

Query: 165 VRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIE 213
           +RFC+ N + + +  SPS  V IL     SML++D+ ++ + S I++++
Sbjct: 133 MRFCVVNLIDSFYITSPSQYVSILLLALRSMLMMDLPQINVFSKIDMLK 181

>TBLA0D01210 Chr4 complement(305406..306464) [1059 bp, 352 aa] {ON}
           Anc_8.712 YOR262W
          Length = 352

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 156 IFAVVDYQM-VRFCLRNSLTNKHDPSPSAPVYILFCVDFSMLLVDVAEVAMKSVINLIEL 214
           IF +++ ++ +RFC+ N + + +  SPS  V IL     SML++D+ ++ + S I+ ++ 
Sbjct: 125 IFKILESKLDMRFCVVNLVDSIYITSPSQYVSILLLTLRSMLMMDLPQINVFSKIDKLKS 184

Query: 215 IQCKRAFERD 224
              +  F+ D
Sbjct: 185 YNPELPFKLD 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,476,003
Number of extensions: 1971588
Number of successful extensions: 11447
Number of sequences better than 10.0: 293
Number of HSP's gapped: 11705
Number of HSP's successfully gapped: 300
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)