Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10582g6.46ON48148124640.0
Kwal_56.225276.46ON48148216130.0
SAKL0E01980g6.46ON4654859751e-127
ZYRO0C07172g6.46ON4504627961e-101
KLLA0C05852g6.46ON4825047931e-100
NCAS0H009006.46ON4954747868e-99
NDAI0D008906.46ON5394847682e-95
ACL020W6.46ON5394637612e-94
TDEL0G042406.46ON4444557429e-93
Ecym_30496.46ON5015157339e-91
Smik_13.1066.46ON5064787191e-88
CAGL0J11792g6.46ON5105017131e-87
YML043C (RRN11)6.46ON5074716903e-84
Suva_13.1176.46ON5134596808e-83
Skud_13.1056.46ON5124736703e-81
KAFR0L004206.46ON4604376192e-74
TBLA0B005706.46ON5174985657e-66
TPHA0J005106.46ON4374515353e-62
KNAG0E009106.46ON4864575296e-61
Kpol_1037.116.46ON4014254302e-47
AAL177W1.290ON119879790.43
NCAS0H035402.665ON760118732.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10582g
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   953   0.0  
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   625   0.0  
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   380   e-127
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   311   e-101
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   310   e-100
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   307   8e-99
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   300   2e-95
ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...   297   2e-94
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   290   9e-93
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   286   9e-91
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   281   1e-88
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   279   1e-87
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   270   3e-84
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   266   8e-83
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   262   3e-81
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   243   2e-74
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   222   7e-66
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   210   3e-62
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   208   6e-61
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   170   2e-47
AAL177W Chr1 (27774..31370) [3597 bp, 1198 aa] {ON} Syntenic hom...    35   0.43 
NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.6...    33   2.3  

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/481 (95%), Positives = 458/481 (95%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFELP               YQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120
           NSADATS        LLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET
Sbjct: 61  NSADATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120

Query: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180
           FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV
Sbjct: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180

Query: 181 AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILREL 240
           AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILREL
Sbjct: 181 AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILREL 240

Query: 241 ASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELLF 300
           ASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELLF
Sbjct: 241 ASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELLF 300

Query: 301 ASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQR 360
           ASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQR
Sbjct: 301 ASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQR 360

Query: 361 FISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLY 420
           FISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLY
Sbjct: 361 FISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLY 420

Query: 421 QNSGESTASDLGSGFELDNSPENLDTQNVLGPGMSPMIDEEENFFGSAEQVHFGFDSDSS 480
           QNSGESTASDLGSGFELDNSPENLDTQNVLGPGMSPMIDEEENFFGSAEQVHFGFDSDSS
Sbjct: 421 QNSGESTASDLGSGFELDNSPENLDTQNVLGPGMSPMIDEEENFFGSAEQVHFGFDSDSS 480

Query: 481 T 481
           T
Sbjct: 481 T 481

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/482 (62%), Positives = 368/482 (76%), Gaps = 2/482 (0%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFELP               YQYIN+L QE+R++Q  A A++TLPTPENSAAE+ASDGD 
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQDSAAAHATLPTPENSAAEDASDGDQ 60

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120
           +S DA S        +LSVLGH ++++ELSD++    SH ++  +SEKEFF+ HEKPQ+T
Sbjct: 61  DSEDAGSRRRRRKRRILSVLGHIDSESELSDVDMSTESHHSELQESEKEFFSHHEKPQDT 120

Query: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180
           +E WNTDR+KAV M TATLSY   K IE  AQ+RV   + H S+ A  HF ++K GYE  
Sbjct: 121 YETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIARSHFNSIKRGYEIY 180

Query: 181 AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILREL 240
           +   + H   HI  LNELLH N+M+G+W+TA+RCFS+LIRLPG+DIRS+WG G RILREL
Sbjct: 181 SRPSQVHQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDIRSMWGLGVRILREL 240

Query: 241 ASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELLF 300
           +S DK + +S+EFLGWLSGI++SRSNFN TMNFLMDPVFR GSK H AKFV AWLWE+LF
Sbjct: 241 SSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKHTAKFVSAWLWEMLF 300

Query: 301 ASCPDGTEHPSAEDAS-NRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQ 359
           A+CPD  E   A++ S NRKL  LLE+LSEMVLIPPYMEDPE+WFI+A+CHLVSAD+LSQ
Sbjct: 301 AACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPYMEDPEIWFIYALCHLVSADELSQ 360

Query: 360 RFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRL 419
           RF  T   ++ELERDISRNQVTQHITNAH CIRTCEAK ++F FPRRIIEEQLA FE+RL
Sbjct: 361 RFTFTYSESTELERDISRNQVTQHITNAHNCIRTCEAKGDDFFFPRRIIEEQLAFFERRL 420

Query: 420 YQNSGESTASDLGSGFELDNSPENLDTQNVLGPGMSPMIDEEENFFGSAEQVHFGFDSDS 479
           Y++ G+ST S+  S  E+   P N DTQ++  PGMS  + EEEN+FG+AE+VHFGFDSDS
Sbjct: 421 YEHVGDSTTSEQDSPHEMTFEPHNFDTQDLPSPGMSSFV-EEENYFGTAERVHFGFDSDS 479

Query: 480 ST 481
           S+
Sbjct: 480 SS 481

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  380 bits (975), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/485 (43%), Positives = 292/485 (60%), Gaps = 26/485 (5%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFELP               YQYINTL +++ ++         LPTPE+SAAE  SD D 
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLNP-KKQTVGLPTPESSAAE-TSDTDE 58

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120
                +         L S+LGHA + ++  D+  EE  ++ ++ D EK    ++ KPQET
Sbjct: 59  LEDSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEECDYEKHVKNKYYKPQET 118

Query: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180
           +E+W T  +  VP+NT +++Y   K+I K A +RV+  +++ SKN+   F A+ +GYE  
Sbjct: 119 YELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAAFFSAIYNGYEPY 178

Query: 181 AETP-ESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILRE 239
             +  E++   HI  L  LLH N+M+  W+ AYRCFS+LIRLPG+DIRS+WG G RIL+E
Sbjct: 179 ETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIRSIWGIGVRILKE 238

Query: 240 LASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWELL 299
           +         SEEFL W+S +FS+++NFNQ  N  MDPVFR GSKTH  KFV +WLWE L
Sbjct: 239 IDRK-----RSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVTSWLWETL 293

Query: 300 FASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQ 359
              C    E+    D +  KL  L E++SE+VL PPYM+DP++WFI+A+CH+V AD LSQ
Sbjct: 294 MG-CTSKDENNGNRDVN--KLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEADHLSQ 350

Query: 360 RFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRL 419
           +FI  +   +   RDI+RNQV QHITNA   ++TC+ +K  F FP++ IE+QL+ FE RL
Sbjct: 351 QFIENEHIKNGSRRDIARNQVIQHITNAKNFLQTCQ-EKGGFQFPKQHIEKQLSNFENRL 409

Query: 420 YQNSGESTASDLGSGFELDNSPEN----LDTQNVLGPGMSPMIDEEENFFGSAEQVHFGF 475
           YQ +      DL + F+ D+S  N     D Q+V     +P++ EEEN FG      F  
Sbjct: 410 YQRT-----EDLLNNFDSDSSASNEFNRQDFQDV-----NPIVYEEENVFGELGDAQFDI 459

Query: 476 DSDSS 480
           D+ SS
Sbjct: 460 DTYSS 464

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  311 bits (796), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/462 (37%), Positives = 248/462 (53%), Gaps = 33/462 (7%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFELP               YQYIN L ++Y  +   +N  + LPTPENSA E +     
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQTELPTPENSATETS----E 56

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQET 120
           N              L S++G +      SD+E++E     +  + E++F+ ++EKPQ T
Sbjct: 57  NEEVGQQKRRRIRKRLKSIIGES-----YSDLESDEEQPVEEVDNEERKFYRKYEKPQLT 111

Query: 121 FEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYETV 180
           FE W  D +K  P+    ++Y+   +I++H  +R+   +A  S+     F A   GY+  
Sbjct: 112 FEKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKTFFHATTQGYQLF 171

Query: 181 AET---PESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARIL 237
             T     +  L HI  L  LLH N++K KW+ AY+CF+LLIR+PG+D+R++WG G RIL
Sbjct: 172 DPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVDVRTLWGLGERIL 231

Query: 238 RELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWE 297
            E     +    S EFL W+S ++S++  F   +N+ M PVF  GSKTH  K+   WLWE
Sbjct: 232 AE-----RQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKYTTTWLWE 286

Query: 298 LL--FASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSAD 355
            L  +A+  +  E  S   A N     L++R+SEMVL PPYM+DPEVWFI+A+CH+V AD
Sbjct: 287 CLIRYANGLEDLEMDSKSAAEN--FQSLMDRISEMVLGPPYMDDPEVWFIYALCHMVKAD 344

Query: 356 QLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACF 415
            LSQ+F     R +   RDI+ NQV QHI N    ++ C +K   F+FP+R I  QLA F
Sbjct: 345 TLSQQF---DPRLTGSARDIASNQVIQHIQNTKSHLQQCSSKG-GFTFPKRYIARQLAAF 400

Query: 416 EKRLYQNSGESTASDLGSGFELDNS--------PENLDTQNV 449
           E RLY         +        +S        PENLDTQ +
Sbjct: 401 EARLYGKIDAYDMDEEEDEDNDAHSPSDESGMYPENLDTQLI 442

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  310 bits (793), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/504 (37%), Positives = 265/504 (52%), Gaps = 48/504 (9%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKV---QSFA-------NANSTLPTPENS 50
           MF+LP               YQYIN+L ++Y ++   QS A       N  + + TPENS
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 51  AAEEASDGDHNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEF 110
            + EA   D                L SVLG+A    + SD E +      D+ D E +F
Sbjct: 61  ESSEAEAAD------LEKKHRRKRRLQSVLGNA---LDSSDEELDGDEDGTDENDPETQF 111

Query: 111 FTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHF 170
           +  H KPQ TFEVWN +     P+    ++Y+  K++EK A K V+  + + +K  N +F
Sbjct: 112 YESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKKLNMYF 171

Query: 171 QAMKDGYETVAETPE--SHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRS 228
           QA+K G++ V   P+      +H+A LN+LL+TN++   W+ AYRCFS+LIRL  +D+RS
Sbjct: 172 QALKFGFD-VYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDVDVRS 230

Query: 229 VWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAA 288
           +W  G+ IL  L        ++E +L WL+ +F SR  FNQ  N+ +DPVFRCGS+TH  
Sbjct: 231 LWSIGSEILNSLGDTQ----SNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286

Query: 289 KFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAV 348
            FV+ WLW  LF      T   SA D   + L  L++RL EMVL PPYM+D E+W+IF +
Sbjct: 287 TFVLTWLWTRLFI----ATSGSSAVDKE-KFLQSLIDRLDEMVLSPPYMDDSEIWYIFGL 341

Query: 349 CHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRII 408
            HLV A +LS +F  +K        DI+RNQV QHI NA  C++ C+A    + FP  +I
Sbjct: 342 THLVMASELSSKFRQSKDILLGSRADIARNQVIQHINNAKNCLQMCKANS-NYEFPENVI 400

Query: 409 EEQLACFEKRLYQN------SGESTASDLGSGFELDNSPEN--------LDTQNVLGPGM 454
           E QL   E+ LY +      + ES  S    G E     E+        LDTQ      +
Sbjct: 401 EHQLVQLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENL 460

Query: 455 SPMIDEEENFFGSAEQVHFGFDSD 478
            P ++  E  F     + FG++SD
Sbjct: 461 IPEVESAE--FTVPAPIRFGYESD 482

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  307 bits (786), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 182/474 (38%), Positives = 267/474 (56%), Gaps = 26/474 (5%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEE-ASDGD 59
           MF+LP               Y YIN L ++Y +  +    +S+LPTPENSA+E   S G+
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDA---ESSSLPTPENSASESHESTGE 57

Query: 60  HNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQE 119
               D             +V+G A       D + EE   +    + E+ FF  HEKPQE
Sbjct: 58  ----DEEVRRRRLKRRWKNVIGEA-VSDTDEDEDGEEEREDEGPENQERRFFKTHEKPQE 112

Query: 120 TFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYET 179
           ++E+W+TD  K +P+    +S+    +IEK  ++R+   + H SK  N  F+++  G E 
Sbjct: 113 SYEIWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNICFESISQGQEL 172

Query: 180 VA--ETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARIL 237
           V    TPES  L HI  L  LLH N+MKGKW+ AY+ F+L++R+P +DIRS+WG G +IL
Sbjct: 173 VTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDIRSIWGIGVKIL 232

Query: 238 RELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWLWE 297
            + A+      T+ +FL W++ ++SSR N+ Q M   +DPVFR GSKTH++KF + WLW+
Sbjct: 233 SQRAAT-----TTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKFTITWLWK 287

Query: 298 -LLFASCPDGTEHPSAEDA--SNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSA 354
            L++ +  D  E   ++       KL  L+E++SE+VLIPP+MED EVWFI+A+CH+V A
Sbjct: 288 SLIYCTDTDNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIYALCHMVKA 347

Query: 355 DQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLAC 414
           DQLS  F   +   S   RDI+RN+V Q+I      ++T  +K   F +P R I  QL  
Sbjct: 348 DQLSLNFNLNQSNGS--ARDIARNEVIQNIQLVKTFLQTAMSKG-HFEYPERFITRQLNT 404

Query: 415 FEKRLYQNSGESTASDLGSGFELDNSPENLDTQNV-LGPGMSPMIDEEENFFGS 467
           FE+RLY  S + T S      E DN   ++D  N+ L P  +P+   E+ +  S
Sbjct: 405 FEERLY--SKDETNSKDKDNNESDNG-SSMDNGNIQLVPETNPIPPAEDEYVFS 455

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  300 bits (768), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 178/484 (36%), Positives = 262/484 (54%), Gaps = 52/484 (10%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQS----FANANSTLPTPENSAAEEAS 56
           MFELP               Y YIN L ++Y + Q+      N N  LPTPE+SA E   
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKYNRTQNRHNNNNNNNGILPTPESSATESHD 60

Query: 57  DGDHNSADATSXXXXXXXXLLSVLGHAETDTELSDM-----------------EAEEGSH 99
           D D  ++D             SV+G A +DT+L D                  +  E +H
Sbjct: 61  DDDATTSDDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDHHESAH 120

Query: 100 EADQADSEKEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGM 159
              + + E++FF ++EKPQETFE+W T+  K VP+N + ++Y   K+IEK A+++++  +
Sbjct: 121 HIHE-NEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKITVPL 179

Query: 160 AHISKNANFHFQAMKDGYETVAE--TPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSL 217
            H SK     F+AM +G E V    T E+  L HI +L  LL+ N+ +  WD AYR F+L
Sbjct: 180 LHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYRIFTL 239

Query: 218 LIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDP 277
           LIR+  +DIRS+WG G RIL E     K    + +FL W++ ++SSR NF Q +N+ MDP
Sbjct: 240 LIRIKKLDIRSIWGIGVRILSE-----KSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDP 294

Query: 278 VFRCGSKTHAAKFVVAWLWELLFASCP------DGTEHPSAEDASNRKLS---------- 321
           VF+ GS+TH  K+ + WLW+ L           +   + S ED S+ +L           
Sbjct: 295 VFKSGSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNL 354

Query: 322 -HLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQV 380
             L+E++SEMVLIPP+MED EVWFI+++CH+V AD LS +F    L ++    DI RNQV
Sbjct: 355 LDLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF--NPLISNGSRGDIERNQV 412

Query: 381 TQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQN---SGESTASDLGSGFEL 437
            QHI      ++T    K +F +P + I +QL+ +E+RLY +   S  +  +D     +L
Sbjct: 413 IQHIQKTKSYLQTS-MNKGDFEYPEKYILKQLSIYEQRLYASDPTSNNNNVTDEDVDMQL 471

Query: 438 DNSP 441
            + P
Sbjct: 472 QDIP 475

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score =  297 bits (761), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 260/463 (56%), Gaps = 37/463 (7%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANAN-------STLPTPENSAAE 53
           MFE P               Y+Y++ + ++Y ++   ++++       +  PTP+NSAAE
Sbjct: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105

Query: 54  EASDGDHNSAD---ATSXXXXXXXXLLSVLGHAETDTELSDMEAEE-----GSHEADQAD 105
            ASDGD    D   A          L S+LGHA  D E  D+ +EE     G   A   D
Sbjct: 106 -ASDGDALEGDVDTAARRLKRKRLRLQSILGHATLDAEEGDLGSEEEDDLNGGSTA--KD 162

Query: 106 SEKEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKN 165
            EK+FF R+ KP+ T+E+W T  +  VP+    LSY   KQIE ++ +R+ A ++  +K 
Sbjct: 163 YEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKK 222

Query: 166 ANFHFQAMKDGYETV-AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGI 224
           A  + + M+ GYET   E   ++  +H+  L  LL++NI+   W TAYRCF+LLIR+  +
Sbjct: 223 AAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSV 282

Query: 225 DIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSK 284
           D+RS+W  G+ IL  L          E+FL W+  +F+S S F+Q    L+DPVFR GS+
Sbjct: 283 DLRSIWNLGSHILSHL-----NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSR 337

Query: 285 THAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWF 344
            H   F++AWLW +L  +  D          S R ++ LLE++SE+VL PPYM+D E+WF
Sbjct: 338 AHTPNFMLAWLWLVLRGATADEVLD------STRSMAWLLEKVSELVLRPPYMDDAEIWF 391

Query: 345 IFAVCHLVSADQLSQRFIS---TKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEF 401
           ++A+C+ + AD+LS +  S    KL  S+L  DI++ QVTQ+I +   C+ +C  +K  F
Sbjct: 392 LYAMCYFIQADKLSAQLASHEGIKLHGSKL--DIAKTQVTQYICSVKNCLESCR-EKGNF 448

Query: 402 SFPRRIIEEQLACFEKRLYQNS-GESTASDLGSGFELDNSPEN 443
           ++P RII+EQL  FE+RLY  +  E T  +    +E D   +N
Sbjct: 449 TYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQN 491

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  290 bits (742), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 169/455 (37%), Positives = 250/455 (54%), Gaps = 24/455 (5%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFE P               YQY+N L  ++ +++   N N  LPTPENSAAE +     
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNTNG-LPTPENSAAESS----E 55

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEA--EEGSHEADQADSEKEFFTRHEKPQ 118
           N              L S  G + +D+E  +++   +    E ++ D E++F   +E PQ
Sbjct: 56  NEEALQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEEEDQERKFLNNYELPQ 115

Query: 119 ETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYE 178
           E+FE W  D  K VP+  + +S+   +++ +HA+++++  +   SK    +   + +G+E
Sbjct: 116 ESFEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKIYMDTISEGFE 175

Query: 179 TVAET---PESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGAR 235
            V      P++  + HI+ L  LLH ++ + +WD AY CF+LLIR+P +DIR++WG G  
Sbjct: 176 MVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVDIRNIWGIGDL 235

Query: 236 ILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAWL 295
           ILRE     +    S EFL W+S ++SSRS F + +N    PVF  GSKTH  KF   W+
Sbjct: 236 ILRE-----REPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKFATTWM 290

Query: 296 WELLFASCPDGTEHPSAEDA-SNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSA 354
           WE L     +  E    E   SN  L  L+ER+SEMVL PPYM+  EVWFI+ +CHL+ A
Sbjct: 291 WESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIYGLCHLIKA 350

Query: 355 DQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLAC 414
           D LS +F     R +   RDI+ NQV QHI     C++TC +K  +F +P+R IE QL  
Sbjct: 351 DILSNQFDG---RLAGSARDIASNQVIQHIQRTKSCLQTCLSKG-DFKYPKRYIERQLEE 406

Query: 415 FEKRLYQNSGESTASDLGSGFELDNSPENLDTQNV 449
           FEKRL  +  E T  D  S  E+++  + LDTQ++
Sbjct: 407 FEKRL--DRQEDTPDD--SDHEVESLHDKLDTQSI 437

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  286 bits (733), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 186/515 (36%), Positives = 272/515 (52%), Gaps = 52/515 (10%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKV-------QSFANANSTLPTPENSAAE 53
           MFE P               Y+YIN+L ++Y  +       +      S LPTP NSAAE
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAAE 60

Query: 54  EASDGDHNSADATSXXXXXXXXLL--SVLGHAETDTELSDM-------EAEEGSHEA--D 102
            ASDGD    D  S        +   S+LGHA  + E           E ++G  +   D
Sbjct: 61  -ASDGDGREEDELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGYLD 119

Query: 103 QADSEKEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHI 162
           + D EK F++++  P+ET+EVW T     +P+   ++SY   + IEK+A K+V+A +A  
Sbjct: 120 EKDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLALS 179

Query: 163 SKNANFHFQAMKDGYETVA-ETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRL 221
           SK     F+ ++ GYET   E   ++  VH+  L +LL+ NI++G +DTAYRCFSLLIR+
Sbjct: 180 SKKLTGFFEVIRSGYETCPRERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLIRM 239

Query: 222 PGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRC 281
             +D+RS+W  G++IL     +D+     E FL W+S + +S S F Q     +DPVFR 
Sbjct: 240 NFVDLRSMWNLGSKILEHYNLDDQ-----ERFLEWMSTVLTSNSAFPQNSKNQLDPVFRS 294

Query: 282 GSKTHAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPE 341
           GS+TH   FV++WLW +L  +  +         +S   ++ LL+++SE+VL PPYM+D E
Sbjct: 295 GSRTHIPNFVLSWLWLVLENAVKERVF------SSGHDINWLLDKISELVLRPPYMDDAE 348

Query: 342 VWFIFAVCHLVSAD----QLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAK 397
           VWFI+A+C+ + AD    QL Q      L+ S+L  DI+RNQV ++I +    +R CE +
Sbjct: 349 VWFIYAMCYFIKADKLSLQLKQEGSLNGLKGSQL--DIARNQVIENIHHVKNHLRICE-E 405

Query: 398 KEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFELDNS------------PENLD 445
           K  F +P+R+IE QL  FEKRLY  S           F L+ S             +  D
Sbjct: 406 KGGFQYPKRVIEAQLVEFEKRLYPESSTHINYPGYETFPLEESDTEDNLVSINFLQDRFD 465

Query: 446 TQNVLGPGMSPMIDEEENFFGSAEQVHFGFDSDSS 480
            Q +    +   IDE+  F    + VHFG  SD S
Sbjct: 466 AQVIQDFNVQQPIDEDGPFV--EQPVHFGMGSDYS 498

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  281 bits (719), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/478 (36%), Positives = 256/478 (53%), Gaps = 42/478 (8%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAE--EASDG 58
           MFE+P               YQYIN   + + K+   +    +LPTPENSAAE  E  DG
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTTALSLPTPENSAAENNEEDDG 60

Query: 59  DHNSADAT-------SXXXXXXXXLLSVLG--HAETDTELSDMEAEEGSHEAD------Q 103
           + N                       SV+G  ++ T+TE    E  E   E +       
Sbjct: 61  ERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECNTEGKEED 120

Query: 104 ADSEKEFFTRHEKPQETFEVWNT-DRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHI 162
            D E++F+ ++EKP+E+FEVW T   Q   P+N   ++Y T K+IEK++ +++   + H 
Sbjct: 121 IDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKMEVPLLHC 180

Query: 163 SKNANFHFQAMKDGYETVAETP---ESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLI 219
           +K +  HFQ++  G E +  +     ++   HI  L  LLH N+ +  W  AY+ F+ LI
Sbjct: 181 TKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAYKIFATLI 240

Query: 220 RLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFL-MDPV 278
           R+PG+ I+S+WG G  IL    +N   L TS +FL W+  I+SS+  F Q+ N+  + P 
Sbjct: 241 RIPGVQIKSIWGIGVEIL----NNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSIVPP 296

Query: 279 FRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAEDA----SNRKLSHLLERLSEMVLIP 334
           F+ GS+TH +KF   +LW  L  +C    E P   D      N  L  L++R+SE VL P
Sbjct: 297 FQTGSRTHTSKFATTYLWSSLI-TCQKSMELPDINDKRYDMENDLLQDLIDRISEWVLTP 355

Query: 335 PYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSE---LERDISRNQVTQHITNAHMCI 391
           P+MED EVWFI+A CHL+ AD LS++F +   +TS+   L+RDI  NQV +HI    + +
Sbjct: 356 PFMEDAEVWFIYASCHLLKADILSRQFANDN-KTSDLIGLDRDIKINQVIKHIHYVKVFL 414

Query: 392 RTCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFELDNSPENLDTQNV 449
           +TC + K  F+ P R+IE QL  FE RLY   GE  A DL    E+D+   ++D  +V
Sbjct: 415 QTC-SDKGGFTVPNRLIESQLKGFESRLY---GE--AQDLRER-EMDDDYNSIDDNSV 465

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  279 bits (713), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 172/501 (34%), Positives = 262/501 (52%), Gaps = 59/501 (11%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEY---RKVQSFANANSTLPTPENSAAEEASD 57
           MFE+P               YQYIN L ++Y   R+ +    ANS LPTPENSA E    
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKYHAKRRSKRRRQANS-LPTPENSAVE---- 55

Query: 58  GDHNSADATSXXXXXXXXLLSVLGH------AETDTELSDMEAEEGSHEADQADSEKEFF 111
            D + +   S        +   LG       AET +E  D   ++     D    EK F+
Sbjct: 56  NDQSESQLPSREQIKEKKM--KLGEDYSDSEAETSSEGEDTTKDDNEFANDMNKFEKLFY 113

Query: 112 TRHEKPQETFEVW----NTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNAN 167
            ++EKP+ +FEVW    + + +K   +    + Y    ++E+ A+KRV   + H+     
Sbjct: 114 RKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVHMPLVNK 173

Query: 168 FHFQAMKDGYETVAETPE--SHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGID 225
            +F    +GYE +    +  S+ L HI  L ++L +++ +G WD AYR FSLLIR+P +D
Sbjct: 174 RYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLIRIPEVD 233

Query: 226 IRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKT 285
           IR++WG G RIL E     + L    EFL W+S ++SS+ NF Q+      PVFR GS+T
Sbjct: 234 IRNIWGLGTRILMERGQTTRSL----EFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGSRT 289

Query: 286 HAAKFVVAWLW-------ELLFASCPDGTEHPSAED------ASNRKLSHLLERLSEMVL 332
           H  K+ + WLW       EL+      G      E+      ++  KL+ L++++SEMVL
Sbjct: 290 HTPKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEMVL 349

Query: 333 IPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIR 392
           +PPY++DPE+WFI+++CH+V AD LS +F   +L  S   RDI+RNQVTQHI      ++
Sbjct: 350 VPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQRLSGS--RRDIARNQVTQHIHYVKTYLQ 407

Query: 393 TCEAKKEEFSFPRRIIEEQLACFEKRLYQ---------------NSGESTASDLGSGFEL 437
            C ++K  F +P++ I+ +L  FEKR+Y+               N+  S   D  + F++
Sbjct: 408 NC-SQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPFQI 466

Query: 438 DNSPENLDTQNVLGPGMSPMI 458
           D S   L   N++  G+ P+I
Sbjct: 467 DESNSFLG--NLVEEGIDPVI 485

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  270 bits (690), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/471 (33%), Positives = 253/471 (53%), Gaps = 38/471 (8%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFE+P               YQYIN + + + ++   +    +LPTPENSAAE   + + 
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKKSTTTDSLPTPENSAAENNDEEEG 60

Query: 61  NSADATSXXXXXXXX--------LLSVLGH------AETDTELSDMEAE---EGSHEADQ 103
            +++A +                  SV+G       +ETD++  + E     +   + + 
Sbjct: 61  QNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGEHDTGIDKED 120

Query: 104 ADSEKEFFTRHEKPQETFEVWNT-DRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHI 162
           +D E++F+ ++EKP+++FE+W T   Q   P+N   ++Y   K+IEK   +++   + H 
Sbjct: 121 SDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLRKMEIPLLHC 180

Query: 163 SKNANFHFQAMKDGYE---TVAETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLI 219
           +K    +FQ++  G E   T      ++   HI  L +LLH N+ +  W  AY+ F+ LI
Sbjct: 181 TKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLI 240

Query: 220 RLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFL-MDPV 278
           R+PG+ I+S+WG G  IL  L+++  GL    +FL W+  I+SS+S F Q +N+  + P 
Sbjct: 241 RIPGVQIKSLWGIGVEILDNLSNSSSGL----DFLQWMCQIYSSKSRFVQNINYRSIVPP 296

Query: 279 FRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAE------DASNRKLSHLLERLSEMVL 332
           F+ GS+TH AKF + +LW  L  +C    E PS+       D  N  L  L++++SE VL
Sbjct: 297 FQTGSRTHTAKFAITYLWSSLI-NCQKSME-PSSNIIDKPFDTENDLLQELIDKISEWVL 354

Query: 333 IPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTS--ELERDISRNQVTQHITNAHMC 390
            PP+MED EVWFI+A CHL+ AD LS++F++         L+RDI  NQV +HI      
Sbjct: 355 TPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHYVRTF 414

Query: 391 IRTCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFE-LDNS 440
           ++ C   K  F+ P R+IE QL  FE RLY  + +    D+ + ++ +DNS
Sbjct: 415 LKIC-LDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNS 464

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  266 bits (680), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 158/459 (34%), Positives = 243/459 (52%), Gaps = 49/459 (10%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAE------- 53
           MFE+P               YQYIN + + + ++   +N   +LPTPENSAAE       
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNTTDSLPTPENSAAENNDEDYD 60

Query: 54  --------EASDGDHNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQA- 104
                   E+  G+ +    T           SV+G   + TE      EE   E DQ  
Sbjct: 61  DDEEERNYESDAGESSIRQQTKRRRERHWK--SVIGELYSSTETESDSQEEDDQEGDQVE 118

Query: 105 ----------DSEKEFFTRHEKPQETFEVWNT-DRQKAVPMNTATLSYDTCKQIEKHAQK 153
                     D E++F+ ++EKP+++FEVW T       P+N   ++Y   K+IEK++ +
Sbjct: 119 HETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKKIEKNSLR 178

Query: 154 RVSAGMAHISKNANFHFQAMKDGYETVAETPES----HHLVHIAQLNELLHTNIMKGKWD 209
           ++   + H +K    +FQ +  G E + ++P S    +   HI  L  LLH N+ +  W 
Sbjct: 179 KMEIPLLHCTKENKLYFQLLAKGLEPL-QSPTSAARNYQTRHIITLTNLLHLNVSRHNWP 237

Query: 210 TAYRCFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQ 269
            AY+ F+ LIR+P + I+S+WG G +IL     N   L +S +FL W+  ++SS+S F Q
Sbjct: 238 LAYKIFATLIRIPNVQIKSIWGIGVKIL----DNSPNLSSSLDFLQWMCQVYSSKSRFVQ 293

Query: 270 TMNFL-MDPVFRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAED----ASNRKLSHLL 324
            +N+  + P F+ GS+TH +KF + +LW  L  SC    E  +A D      N +L  L+
Sbjct: 294 NVNYRSVVPPFQTGSRTHTSKFAITYLWSCLI-SCQKSIESSNATDNQYDMENSRLEELI 352

Query: 325 ERLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSE---LERDISRNQVT 381
           +++SE VLIPP+MED EV+FI+A CHL+ AD LS++F++   R ++   L +DI  NQV 
Sbjct: 353 DQISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDN-RNNDLVGLNKDIKINQVI 411

Query: 382 QHITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLY 420
           ++I    + ++TC   K  F+ P R+IE QL  FE RLY
Sbjct: 412 KNIHYVKVFLQTC-LDKGGFTIPNRLIENQLKSFESRLY 449

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  262 bits (670), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 247/473 (52%), Gaps = 46/473 (9%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAE------- 53
           MFE+P               YQYIN L + + KV    N   +LPTPENSA E       
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNTTDSLPTPENSAVENNDDDYD 60

Query: 54  ------EASDGD-HNSADATSXXXXXXXXLLSVLG--HAETDTELSDMEAEE-------- 96
                 +  + D +  +              SV+G  ++ T+TE SD + EE        
Sbjct: 61  YDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETE-SDSQQEEIQENDGRE 119

Query: 97  -GSHEADQADSEKEFFTRHEKPQETFEVWNT-DRQKAVPMNTATLSYDTCKQIEKHAQKR 154
            G    D  D E++F+ +HEKP+ +FE+W T   Q   P+N   ++Y   ++I+K++ ++
Sbjct: 120 TGRKNGD-TDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQKNSLRK 178

Query: 155 VSAGMAHISKNANFHFQAMKDGYE---TVAETPESHHLVHIAQLNELLHTNIMKGKWDTA 211
           V   + H +K    +F+++  G E   T   T  ++   HI  L  LLH N+ +  W  A
Sbjct: 179 VQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRHNWSLA 238

Query: 212 YRCFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTM 271
           YR F+ LIR+P + ++S+WG G +IL  L  +   L    +FL W+  I+SS++ F Q +
Sbjct: 239 YRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSL----DFLQWMCQIYSSKARFVQNI 294

Query: 272 NFL-MDPVFRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSA-----EDASNRKLSHLLE 325
           N   + P F+ GS+TH AKF   +LW  L  +C    E PS       D  N +L  L++
Sbjct: 295 NHRSIVPPFQTGSRTHTAKFATTYLWASLI-NCQKSIE-PSTINDKHYDMENDRLQELID 352

Query: 326 RLSEMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFIS--TKLRTSELERDISRNQVTQH 383
           ++SE VL PP+MED EVWFI+A CHL+ AD LS++F++  TK     L+RDI  NQV +H
Sbjct: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVNDGTKGDLIGLDRDIKINQVIKH 412

Query: 384 ITNAHMCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFE 436
           I    + ++TC   K  F+ P R+IE QL  FE RLY  + +    ++  G++
Sbjct: 413 IHYVKVFLQTC-LDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDGYD 464

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  243 bits (619), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/437 (32%), Positives = 223/437 (51%), Gaps = 53/437 (12%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGDH 60
           MFE+P               Y+YIN   + + +     +  + + TPE S  E       
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFER----KDDRNGMITPETSEDE------- 49

Query: 61  NSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQA------------DSEK 108
                           L V+G   +D    D E   G  + ++             + E+
Sbjct: 50  -------LQQRKKRDWLHVIGEYGSD----DDERSGGQQDDEEEEEEVIDEDYNLNNEER 98

Query: 109 EFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANF 168
           +FF + +KPQET+E W + R+K   +    L+Y    ++ ++ +++++  + H+S    +
Sbjct: 99  KFFKKIDKPQETYEHWPSHRKKT-RIQRDILTYHRYNKVSRYVERKMANSLVHVSSKNRY 157

Query: 169 HFQAMKDGYETVA---ETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGID 225
           HF+   DG E V    +   +  L  I  L  LL+ N+ +G W+ AY+ F++LIR+P +D
Sbjct: 158 HFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIRIPKVD 217

Query: 226 IRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKT 285
           IRSVW  G RIL E     K    S EFL W+S ++S+R  F Q +N+  DPVFR GSK 
Sbjct: 218 IRSVWNVGNRILYE-----KDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKN 272

Query: 286 HAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFI 345
           H  K+ + WLW  L     + TE     D  N  +  L+++++EMVLIPP+M+DPE+WFI
Sbjct: 273 HTPKYTLQWLWNSLL----EYTEQLFENDDEN--IDKLIDKIAEMVLIPPFMDDPEIWFI 326

Query: 346 FAVCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKE-EFSFP 404
           +++CH+V AD LS +F +  + +    RDIS NQV QHI +    +  C+ K + ++   
Sbjct: 327 YSMCHMVKADFLSSKFDTHSVGSM---RDISMNQVIQHINDVKRYLNVCKEKSQGQYESN 383

Query: 405 RRIIEEQLACFEKRLYQ 421
             II +QL  FE RLY+
Sbjct: 384 EMIITKQLKAFEVRLYK 400

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  222 bits (565), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 241/498 (48%), Gaps = 70/498 (14%)

Query: 1   MFELPXXXXXXXXXXXXXXXYQYINTLYQEYRKV-------QSFANANS----TLPTPEN 49
           MFE P               YQYINT  + Y ++        S  +  S    TLPTPE 
Sbjct: 1   MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQLYGDTIPSSSLESNRSRTPITLPTPE- 59

Query: 50  SAAEEASDGDHNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKE 109
           ++A E SD + N  D +                + T+T LSD   E  S      + E +
Sbjct: 60  ASAHEHSDSNTNYNDDSDSI-------------SNTNT-LSD--DEYNSDSTGTTNEETK 103

Query: 110 FFTRHEKPQETFEVWNTD-----------RQKAVPMNTATLSYDTCKQIEKHAQKRVSAG 158
           FF R+++PQE+FEVWNT                +P+N   +S++   +++K   K++ A 
Sbjct: 104 FFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKFTNKKLEAR 163

Query: 159 MAHISKNANFHFQAMKDGYETVAETPE--SHHLVHIAQLNELLHTNIMKGKWDTAYRCFS 216
           + H +K    H +A+ +GYET     +  S + +HI  L  LL+ NI +  ++ AY  FS
Sbjct: 164 LQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNFNQAYHIFS 223

Query: 217 LLIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMD 276
           L+IRLP IDIR+ W  G+ IL +  S  + L     FL W+  I+SS   +N ++N+   
Sbjct: 224 LIIRLPNIDIRNFWNLGSIILLKKVSIQESLN----FLNWIHSIYSSNQKYNNSINYKTA 279

Query: 277 PVFRCGSKTHAAKFVVAWLW---ELLFASCPDGTEHPSAE-----DASNRKLSHLLERLS 328
           P F   S+ H  KF  ++LW    L+     D T     E     +   +KL   +E+LS
Sbjct: 280 PAFTQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKFVEKLS 339

Query: 329 EMVLIPPYMEDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELERDISRNQVTQHITNAH 388
           EMVL PP++ED E+W+I+++ HL+ A  L     +  +  + +E+DI++N++  +I +  
Sbjct: 340 EMVLAPPFIEDSEIWYIYSLSHLILARMLMFETRNNDISQTSVEKDITKNEIISNIQHCK 399

Query: 389 MCIRTCEAKKEEFSFPRRIIEEQLACFEKRLYQNSGESTASDLGSGFELDNSPENLDTQN 448
             ++     + +++F  + IE +L   EK+LY         D  S  E+ N  E LD ++
Sbjct: 400 SHLQKVRENQNDYNFKFQKIEIELKDMEKKLY---------DTSSDEEILNEEEFLDNED 450

Query: 449 VLGPGMSPMIDEEENFFG 466
           VL        D EEN F 
Sbjct: 451 VL--------DNEENNFN 460

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  210 bits (535), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 143/451 (31%), Positives = 226/451 (50%), Gaps = 52/451 (11%)

Query: 1   MFELPXXXXXXXXX-XXXXXXYQYINTLYQEYRKVQSFANANSTLPTP---ENSAAEEAS 56
           MFELP                YQYIN +  ++ ++     + + LPTP   EN    E  
Sbjct: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKHNEL-----SKNELPTPVTSENDTGGEDL 55

Query: 57  DGD--HN--SADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQ---ADSEKE 109
           DGD  HN  S DA            S++G A  D E  +   ++  +E +     D EK+
Sbjct: 56  DGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDNGPTDEEKK 115

Query: 110 FFTRHEKPQETFEVW---NTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNA 166
           +F R++KPQE+FE W   N  RQ+ V  N   ++Y   K+  K   K+      H++KN 
Sbjct: 116 YFLRYDKPQESFEKWESNNLKRQRHV--NKNFITYYRFKKTRKQIDKKYKVKTMHLNKNV 173

Query: 167 NFHFQAMKDGYETVAETP-------ESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLI 219
             +F+ M DG+E + +         ++++  H++ L +L+++NI K KWD AY+CF+ L+
Sbjct: 174 KNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYKCFTFLL 233

Query: 220 RLPGIDIRSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRS-NFNQTMNFLMDPV 278
           R+P +DIR VW  G+ IL+ + +         +FL WLS ++S+++ +F Q +N+  D  
Sbjct: 234 RIPDVDIRRVWNLGSIILQNIDT-----TKLIDFLQWLSNVYSNKNRSFVQGINYRNDQT 288

Query: 279 -FRCGSKTHAAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYM 337
            F  GS+     +    LW  L  S        S  +    ++  L+E+++EMV+IPPY 
Sbjct: 289 NFNGGSRRLTPLYTKTLLWHKLTLS--------SDSETCESEIDSLIEQIAEMVVIPPYS 340

Query: 338 EDPEVWFIFAVCHLVSADQLSQRFISTKLRTSELER--------DISRNQVTQHITNAHM 389
           ED E+W+IFA+CHLV AD LS++      R  E++         +I  N++T  I N   
Sbjct: 341 EDNEIWYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKK 400

Query: 390 CIRTCEAKKEEFSFPRRIIEEQLACFEKRLY 420
            +R     K  F +P R IE +L   E R +
Sbjct: 401 YLRKATQDK-NFDYPARTIETKLKTIETRTF 430

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  208 bits (529), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 145/457 (31%), Positives = 223/457 (48%), Gaps = 40/457 (8%)

Query: 1   MFELPXXX---XXXXXXXXXXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASD 57
           MFELP                  Y+Y N +  +Y++++   + N  L TPE+S  E    
Sbjct: 1   MFELPVLLGSFSESQSLVRKKLRYRYRNEIKNQYKRIK-IHDENGQL-TPESSHTEL--- 55

Query: 58  GDHNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGS----HEADQADSEKEFFTR 113
            DH S              L        +++ S+ + E G      E +    E+++F  
Sbjct: 56  DDHESRSRVCRGRKRRLYDLRDREEHGFESDSSEAQDEVGDLPEKEEEEIGHEERKYFKN 115

Query: 114 HEKPQETFEVWN--TDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQ 171
           HEKP++ +EVW+  T+R+K VP+    +SY+  + IE+ A++++   + H+S+  +  F 
Sbjct: 116 HEKPEDLYEVWHVATERRK-VPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVRSSEFS 174

Query: 172 AMKDGYETVAETPESHHL--VHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSV 229
           A  DGY+ V+   E+ H    HI  L  LLH +I    W+ AY+ F+LLIR+P +DIR+V
Sbjct: 175 AEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRVDIRAV 234

Query: 230 WGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTHAAK 289
           W  G  IL    S      T+ +FL W+  ++S++  F Q +N  + P FR GS+TH A+
Sbjct: 235 WNLGVAILARRDST-----TAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289

Query: 290 FVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVC 349
           +   WLW  L A+     E       +   L  L ++ SE++L PPYM+D EVWFI+  C
Sbjct: 290 YTTTWLWLSLRAATEQAQE---GAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSC 346

Query: 350 HLVSADQLSQRFISTKLRT----SELERDISRNQVTQHITNAHMCIRTCEAKKEE----- 400
           + V AD LS+   S         S    D+ RN+V Q IT     + T E K ++     
Sbjct: 347 YFVKADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRA 406

Query: 401 ---FSFPRRIIEEQLACFEKRLYQNSGESTASDLGSG 434
              +  P   I+ QL   EKRL   + +ST  D  S 
Sbjct: 407 HAYWELPTGYIKRQLQQIEKRL---TAQSTPRDQPSS 440

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  170 bits (430), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/425 (27%), Positives = 206/425 (48%), Gaps = 32/425 (7%)

Query: 1   MFELPXXXXXXXXXXX-XXXXYQYINTLYQEYRKVQSFANANSTLPTPENSAAEEASDGD 59
           MFE+P                YQY+N +Y+  R    +      LPTP +S  E  +  D
Sbjct: 1   MFEVPTIDSTKRSVVNFKKLRYQYMNHMYERNR----YNKNGQGLPTPVSSENEMNASED 56

Query: 60  HNSADATSXXXXXXXXLLSVLGHAETDTELSDMEAEEGSHEADQADSEKEFFTRHEKPQE 119
             S                     E+ +   + E EE   +  + D EK++F+R++KP++
Sbjct: 57  EVSHKRVRKRWRRIV--------GESVSSDEEEEEEEEDEQEQEGDEEKKYFSRYDKPED 108

Query: 120 TFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNANFHFQAMKDGYET 179
           +FE W ++ +    +N   +SY    ++ K+++K++   +   ++    +F ++ DGYE 
Sbjct: 109 SFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQENFLSVIDGYEL 168

Query: 180 VAET---PESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARI 236
           + +     E+  +V++  L +L++ +I K  W  AYRCF+LLIRLP   IR +W  G+ I
Sbjct: 169 IDDNINLKENFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRLPKTSIRKIWNLGSMI 228

Query: 237 LRELASNDKGLGTSEEFLGWLSGIFS--SRSNFNQTMNFLMDPVFRCGSKTHAAKFVVAW 294
           +  L    +G+  + EFL   + I S   +  FNQT+N+   PVF  GS+     ++   
Sbjct: 229 IENL----EGINKTIEFLKLFNNIHSRYKKKIFNQTVNYREAPVFNDGSRNKTPIYIKTL 284

Query: 295 LWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIFAVCHLVSA 354
           LW+ +  +        +  +        L+E LSE+ LIPP+MED E+W+I+ + HL  A
Sbjct: 285 LWKEITTTSTSSRTSSNYNE--------LIEYLSELTLIPPFMEDSEIWYIYGIVHLQRA 336

Query: 355 DQLSQRFISTKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSFPRRIIEEQLAC 414
           ++LS   +   +  S   +DI+ N+V Q+I  A   ++  + +  +   P R I   +  
Sbjct: 337 NELSMN-LEHYIDNSSSSKDIANNEVVQNIKLAQKFLKKAK-ELSKIEVPERQITLMIKN 394

Query: 415 FEKRL 419
            E R+
Sbjct: 395 IEGRM 399

>AAL177W Chr1 (27774..31370) [3597 bp, 1198 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL080C (SCP160)
          Length = 1198

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 180 VAETPESHHLVHIAQLNELLHTNIMKGKWDTAY-----------RCFSLLIRLPGIDIRS 228
           V    +SH +   + L++L  T ++ G     Y           R  +++I++P   + S
Sbjct: 130 VVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAKRELVKKLTRPVTVVIQVPSKTVSS 189

Query: 229 VWGPGARILRELASNDKGL 247
           + GPG R++RE+ +   G+
Sbjct: 190 IIGPGGRMIREITNAAGGI 208

>NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.665
           YKL022C
          Length = 760

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 10/118 (8%)

Query: 138 TLSYDTCKQIEKHAQKRVSAGMAHISKN-ANFHFQAMKDGYETVAETPESHHLVHIAQLN 196
           TL+YDTC+       +    G+ +  KN      + +K   E V  +  +  +V   Q+N
Sbjct: 561 TLAYDTCRYDPLLLNE---MGVMYFKKNELEKSKRYLKKALEAVRNSSGTSTIVISIQMN 617

Query: 197 ELLHTNIMKGKWDTAYRCFSLLIRLPGIDIRSVWGPGARILRELASNDKGLGTSEEFL 254
            L HT    G+++ A +CF L++   G D       G   L+      K LG + ++L
Sbjct: 618 -LAHTYRKLGEYERAIKCFKLVLEEAGKDAEVYCALGFLYLKT-----KRLGKAIDYL 669

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,671,617
Number of extensions: 2029638
Number of successful extensions: 6712
Number of sequences better than 10.0: 38
Number of HSP's gapped: 6803
Number of HSP's successfully gapped: 38
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)