Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10538gsingletonON27327313620.0
Kwal_56.229853.253ON346168860.018
Suva_4.3943.118ON351208790.17
KNAG0K01040singletonON391127790.18
TBLA0I011402.480ON377164780.20
TDEL0C015407.393ON412105760.43
KLLA0F00638gna 1ON382104750.54
NCAS0E008303.489ON67172750.59
KLTH0D05588g2.480ON38989730.80
KLLA0D19929gsingletonON386167730.85
Smik_2.2843.118ON351148730.95
Kpol_1049.187.2ON38695721.2
Skud_2.2723.118ON351148721.2
CAGL0J01441g2.480ON37289721.3
YBR145W (ADH5)3.118ON35181702.1
NDAI0F029602.133ON37596692.8
YBR046C (ZTA1)3.253ON334167692.9
NDAI0H020607.2ON39996683.9
KLTH0C07854g3.253ON358167675.0
Smik_2.1703.253ON334166658.7
KNAG0I022702.133ON397105659.3
NCAS0G01650singletonON37596659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10538g
         (273 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...   529   0.0  
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    38   0.018
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    35   0.17 
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    35   0.18 
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    35   0.20 
TDEL0C01540 Chr3 (265711..266949) [1239 bp, 412 aa] {ON} Anc_7.3...    34   0.43 
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    33   0.54 
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...    33   0.59 
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    33   0.80 
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    33   0.85 
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    33   0.95 
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    32   1.2  
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    32   1.2  
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    32   1.3  
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    32   2.1  
NDAI0F02960 Chr6 (723684..724811) [1128 bp, 375 aa] {ON} Anc_2.133     31   2.8  
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    31   2.9  
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    31   3.9  
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    30   5.0  
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    30   8.7  
KNAG0I02270 Chr9 (444948..446141) [1194 bp, 397 aa] {ON} Anc_2.1...    30   9.3  
NCAS0G01650 Chr7 (292924..294051) [1128 bp, 375 aa] {ON}               30   9.7  

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score =  529 bits (1362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/273 (94%), Positives = 258/273 (94%)

Query: 1   MNARGGFPYTVFPRIPGRDFAGTVVAGPRSGEEVFGTSGYTHAFTTNGFHAEYCVVSEDA 60
           MNARGGFPYTVFPRIPGRDFAGTVVAGPRSGEEVFGTSGYTHAFTTNGFHAEYCVVSEDA
Sbjct: 1   MNARGGFPYTVFPRIPGRDFAGTVVAGPRSGEEVFGTSGYTHAFTTNGFHAEYCVVSEDA 60

Query: 61  VALKPKNVTFAQAACLGVPLTTASLALQRAAVEPSDCXXXXXXXXXXXXXXXQLAQSMGC 120
           VALKPKNVTFAQAACLGVPLTTASLALQRAAVEPSDC               QLAQSMGC
Sbjct: 61  VALKPKNVTFAQAACLGVPLTTASLALQRAAVEPSDCVSVIGASGSVGSYVVQLAQSMGC 120

Query: 121 RVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMA 180
           RVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMA
Sbjct: 121 RVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMA 180

Query: 181 VISARYGAELAIHLKDFYRNEKSLVGCNTLSHSAPKLAKELAAMSQALEKGDITPEDEKV 240
           VISARYGAELAIHLKDFYRNEKSLVGCNTLSHSAPKLAKELAAMSQALEKGDITPEDEKV
Sbjct: 181 VISARYGAELAIHLKDFYRNEKSLVGCNTLSHSAPKLAKELAAMSQALEKGDITPEDEKV 240

Query: 241 WTKFSLGQAAEAYRKSEEGSGKYVLVMEEHCKV 273
           WTKFSLGQAAEAYRKSEEGSGKYVLVMEEHCKV
Sbjct: 241 WTKFSLGQAAEAYRKSEEGSGKYVLVMEEHCKV 273

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 72/168 (42%), Gaps = 24/168 (14%)

Query: 13  PRIPGRDFAGTVVAGPRSGEEVFGTSGYTHAFTTNGFHAEYCVVSEDA-VALKPKNVTFA 71
           P + GR+ +GTVVA  ++  + F  +    A+ + G  A+Y  ++E   ++  P+N T  
Sbjct: 75  PYVLGREASGTVVAKGKAVSK-FNLADKV-AYLSAGTFAQYTKIAETGHISKLPENTTDK 132

Query: 72  Q----AACLGVPLTTASLALQRAAVEPSDCXXXXXXXXXXXXXXXQLAQSMGCRVLRAAR 127
           Q    AA L   LT  + A +   V+  D                Q+ + +G   +  A 
Sbjct: 133 QLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLAFNQILKRLGAHTIAVAS 192

Query: 128 QSPTDVCIAEDEEFSA--------------LTSLTQGRGVDVVIDTVG 161
              TD  +   +EF A              +  +TQG+GVDV  D++G
Sbjct: 193 ---TDEKLQLAKEFGAEYLVNSSKEDVLARVLEITQGQGVDVAYDSIG 237

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 73/208 (35%), Gaps = 42/208 (20%)

Query: 4   RGGFPYTV-FPRIPGRDFAGTVVA------GPRSGE-----------------EVFGTSG 39
           RG +P+ + FP I G + AG VV       G + G+                 EV   S 
Sbjct: 55  RGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQ 114

Query: 40  YTH----AFTTNGFHAEYCVVSEDAVALKPKNVTFAQAACLGVPLTTASLALQRAAVEPS 95
             H     FT +G   EY        A  P+NV  A+ A +     T   AL+RA + P 
Sbjct: 115 CPHLDGTGFTHDGTFQEYATADAVQAAHLPENVDLAEVAPILCAGVTVYKALKRANLIPG 174

Query: 96  DCXXXXXXXXXXXXXXXQLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVDV 155
                            Q A +MG RV+               +E      L +G G +V
Sbjct: 175 QWVTISGACGGLGSLAIQYATAMGYRVIGI-------------DEGETKKQLFEGLGGEV 221

Query: 156 VIDTVGMPALMKAAAEKLAHGGRMAVIS 183
            ID      ++ A   K   GG   VI+
Sbjct: 222 FIDFTKEKDIVGAVI-KATDGGSHGVIN 248

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 51/127 (40%), Gaps = 17/127 (13%)

Query: 113 QLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQGR-GVDVVIDTVGMPALMKAAAE 171
            LA+ MG  V    + S        +E    L +L   + G D   D  G PA ++++ E
Sbjct: 228 DLAEKMGAVVYDPMQHS-------YEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE 280

Query: 172 KLAHGGRMAVISARY--GAELAIHLKDFYRNEKSLVGCNTLSHSAPKLAKELAAMSQALE 229
            L   G  AV  A +  G  +     D  + EKS  G    +H       +   +  ALE
Sbjct: 281 CLTFRG-TAVNVAMWATGKPIDFFPMDITQQEKSYTGSMCYTH------HDFEGVIDALE 333

Query: 230 KGDITPE 236
           KG I PE
Sbjct: 334 KGTIDPE 340

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 65/164 (39%), Gaps = 25/164 (15%)

Query: 38  SGYTHAFTTNGFHAEYCVVSEDAVALKPKNVTFAQAA---CLGVPLTTASLALQRAAVEP 94
           SGYTH    +G   +Y        A  PKNV  A+ A   C GV   T   AL+ A V+P
Sbjct: 147 SGYTH----DGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGV---TVYKALKTADVKP 199

Query: 95  SDCXXXXXXXXXXXXXXXQLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQGRGVD 154
                             Q A++MG RV+              DE+     SL    G D
Sbjct: 200 GQWVAISGACGGLGSLAVQYAKAMGLRVVGID---------GGDEKKKLFHSL----GGD 246

Query: 155 VVIDTVGMPALMKAAAEKLAHGGRMAVISARYGAELAIHLKDFY 198
           + +D     +++K   + + +GG   VI+    +ELA  +   Y
Sbjct: 247 IFVDFTKTHSIVK-DIQDVTNGGPHGVINVSV-SELATSMSTEY 288

>TDEL0C01540 Chr3 (265711..266949) [1239 bp, 412 aa] {ON} Anc_7.393
           YBL069W
          Length = 412

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 17/105 (16%)

Query: 1   MNARGGFPYTVFPRIP-GRDFAGTV-------VAGPRSGEEVFGTSGYTHAFTTNGFHAE 52
           M  R G+   V+  I  GR+++G V        +    G+EV G   Y H  + +G    
Sbjct: 78  MKIRNGYKNGVYGEIGLGREYSGVVNMVGENLQSQWHEGDEVCGI--YFHPHSGSGTLQS 135

Query: 53  YCVV--SEDAVALKPKNVTFAQAA----CLGVPLTTASLALQRAA 91
             +V  SED + LKP+N++  +AA    CLG         LQR+ 
Sbjct: 136 SILVDPSEDPILLKPENISSQEAAGSMYCLGTAFNILD-KLQRSG 179

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 33.5 bits (75), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 43/104 (41%), Gaps = 18/104 (17%)

Query: 7   FPYTVFPRIPGRDFAGTVVAGPRSGE-----------EVFGTSGYTHAFTTNGFHAEYCV 55
           F    FP + GR+ +G VV   R GE           EVF  S       T+ F  EY V
Sbjct: 97  FSIYSFPWVNGRESSGIVV---RRGEKVDEEKFPLGGEVFIASTTYRDLRTSTFQ-EYTV 152

Query: 56  VSEDAVALKPKNVTFAQAACLGVPLTTASLAL---QRAAVEPSD 96
                V   P+ +    A+ +GV L TA  AL   +   V+P +
Sbjct: 153 FDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEE 196

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 155 VVIDTVGMPALMKAAAEKLAHGGRMAVISARYGAELAIHLKDF-----YRNEKSLVGCNT 209
           +V+D++G+ AL  A  E+L+      V  A+   EL  HL D+     Y+N+K +   + 
Sbjct: 590 LVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELW-HLLDYSNVLAYKNDKFVTSTSK 648

Query: 210 LSHSAPKLAKEL 221
            S+++ KL +E+
Sbjct: 649 DSNTSLKLQEEV 660

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 34/89 (38%), Gaps = 10/89 (11%)

Query: 38  SGYTHAFTTNGFHAEYCVVSEDAVALKPKNVTFAQAA---CLGVPLTTASLALQRAAVEP 94
           SGYTH    +G   +Y        A  PK    AQ A   C GV   T   AL+ A V P
Sbjct: 159 SGYTH----DGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGV---TVYKALKTADVRP 211

Query: 95  SDCXXXXXXXXXXXXXXXQLAQSMGCRVL 123
                             Q A++MG RVL
Sbjct: 212 GQWVAISGAAGGLGSLAVQYAKAMGLRVL 240

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 63/167 (37%), Gaps = 36/167 (21%)

Query: 39  GYTHAFTTNGFHAEYCVV--SEDAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPS 95
           G+   +  +G  AEY     ++ ++   P+N++   A  L   L TA  + +Q   V+P 
Sbjct: 149 GWILGYMIDGTQAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPG 208

Query: 96  DCXXXXXXXXXXXXXXXQLAQSMGCRVLRAARQSPTDVCI-------------------- 135
           D                     MGC VL +   SP+ + +                    
Sbjct: 209 DTVAIVGAGPV----------GMGC-VLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTI 257

Query: 136 --AEDEEFSALTSLTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMA 180
             A+++  S +   T GRGVD V++ VG  A        +  GG +A
Sbjct: 258 NSAKEDAVSKILEYTNGRGVDCVMEAVGAQATWDICQRVIKEGGHLA 304

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 53/148 (35%), Gaps = 28/148 (18%)

Query: 4   RGGFPYTV-FPRIPGRDFAGTVVA------GPRSGE-----------------EVFGTSG 39
            G +P+ + FP I G + AG VV       G + G+                 EV   S 
Sbjct: 55  HGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQ 114

Query: 40  YTH----AFTTNGFHAEYCVVSEDAVALKPKNVTFAQAACLGVPLTTASLALQRAAVEPS 95
             H     FT +G   EY        A  P+NV  A+ A +     T   AL+RA + P 
Sbjct: 115 CPHLDGTGFTHDGTFQEYATADAVQAAHIPQNVNLAEVAPILCAGITVYKALKRANLMPG 174

Query: 96  DCXXXXXXXXXXXXXXXQLAQSMGCRVL 123
                            Q A +MG RV+
Sbjct: 175 QWVTISGACGGLGSLAIQYALAMGFRVI 202

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 35/95 (36%), Gaps = 8/95 (8%)

Query: 113 QLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQG-RGVDVVIDTVGMPALMKAAAE 171
           +LA+ MG RV   +  S        D     LT +  G +G D   D  G+PA +K A E
Sbjct: 228 ELAEKMGARVFDPSNMS-------LDNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 172 KLAHGGRMAVISARYGAELAIHLKDFYRNEKSLVG 206
                G    I+      +     D    EK   G
Sbjct: 281 CCTFRGTAVNIAVWGHKPVEFFPMDITSQEKRYTG 315

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 53/148 (35%), Gaps = 28/148 (18%)

Query: 4   RGGFPYTV-FPRIPGRDFAGTVVA------GPRSGE-----------------EVFGTSG 39
            G +P+ + FP I G + AG VV       G + G+                 EV   S 
Sbjct: 55  HGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQ 114

Query: 40  YTH----AFTTNGFHAEYCVVSEDAVALKPKNVTFAQAACLGVPLTTASLALQRAAVEPS 95
             H     FT +G   EY        A  P+NV  A+ A +     T   AL+RA + P 
Sbjct: 115 CPHLDGTGFTHDGTFQEYATADAVQAAHIPQNVDLAEVAPILCAGITVYKALKRANLMPG 174

Query: 96  DCXXXXXXXXXXXXXXXQLAQSMGCRVL 123
                            Q A +MG RV+
Sbjct: 175 QWVTISGACGGLGSLAVQYALAMGYRVI 202

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 10/89 (11%)

Query: 38  SGYTHAFTTNGFHAEYCVVSEDAVALKPKNVTFAQAA---CLGVPLTTASLALQRAAVEP 94
           SGYTH    +G   +Y        A  PK    AQ A   C GV   T   AL+ + V+P
Sbjct: 142 SGYTH----DGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGV---TVYKALKDSDVKP 194

Query: 95  SDCXXXXXXXXXXXXXXXQLAQSMGCRVL 123
                             Q A++MG RVL
Sbjct: 195 GQWVAISGAAGGLGSLAVQYAKAMGMRVL 223

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 30/81 (37%)

Query: 43  AFTTNGFHAEYCVVSEDAVALKPKNVTFAQAACLGVPLTTASLALQRAAVEPSDCXXXXX 102
            FT +G   EY        A  P NV  A+ A +     T   AL+RA V P        
Sbjct: 122 GFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVYKALKRANVIPGQWVTISG 181

Query: 103 XXXXXXXXXXQLAQSMGCRVL 123
                     Q A +MG RV+
Sbjct: 182 ACGGLGSLAIQYALAMGYRVI 202

>NDAI0F02960 Chr6 (723684..724811) [1128 bp, 375 aa] {ON} Anc_2.133
          Length = 375

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 40/96 (41%), Gaps = 23/96 (23%)

Query: 15  IPGRDFAGTVVA-GPR--SGEEVFGTS--GYTHA----FTTNGFHAEYCVVSEDAVALKP 65
           I G D AG +V  GP   S E   G S  G+ H     F TNG  AEY  +        P
Sbjct: 60  IVGCDVAGKIVKLGPNVDSNEFHIGDSVYGFVHGSSVRFPTNGAFAEYVGMDSKIAYKAP 119

Query: 66  KNVT--------------FAQAACLGVPLTTASLAL 87
           K++T              F  A  L V LTTA +AL
Sbjct: 120 KDMTVTGLDNVPEGPVKSFEGAVSLPVSLTTAGVAL 155

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 65/167 (38%), Gaps = 22/167 (13%)

Query: 13  PRIPGRDFAGTVVAGPR--SGEEVFGTSGYTHAFTTNGFHAEYCVVSEDAVALK-PKNVT 69
           P + GR+ +GTVVA  +  +  EV    G   A+ +N   A+Y  +S     +K PK  +
Sbjct: 64  PYVLGREASGTVVAKGKGVTNFEV----GDQVAYISNSTFAQYSKISSQGPVMKLPKGTS 119

Query: 70  FAQ----AACLGVPLTTASLALQRAAVEPSDCXXXXXXXXXXXXXXXQLAQSMGCRV--- 122
             +    AA L   LT  S   +   V+  D                QL +  G      
Sbjct: 120 DEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAV 179

Query: 123 ------LRAARQSPTDVCIAEDEE--FSALTSLTQGRGVDVVIDTVG 161
                 L+ A++   +  I   +E     +   T G+GVD   D+VG
Sbjct: 180 ASTDEKLKIAKEYGAEYLINASKEDILRQVLKFTNGKGVDASFDSVG 226

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 37/96 (38%), Gaps = 10/96 (10%)

Query: 113 QLAQSMGCRVLRAARQSPTDVCIAEDEEFSALTSLTQG-RGVDVVIDTVGMPALMKAAAE 171
            LA+ MG  V     +         DE    L S+  G  G D   D  G PA +KAA E
Sbjct: 228 DLAEKMGAVVYDPMTRD-------HDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE 280

Query: 172 KLAHGGRMAVISARYGAELAIHLK-DFYRNEKSLVG 206
            L   G  AV  A +G      L  D    EKS  G
Sbjct: 281 CLTFRG-TAVNVAIWGKNPVSFLPMDLTHQEKSYTG 315

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 68/167 (40%), Gaps = 22/167 (13%)

Query: 13  PRIPGRDFAGTVVAGPRSGEEV--FGTSGYTHAFTTNGFHAEYCVVSEDAVALK-PKNVT 69
           P + GR+ +G VVA    G+ V  F  +      ++N F A+Y  +SE     K P++ T
Sbjct: 87  PYVLGREASGVVVA---KGDAVTKFDVNDKVAYLSSNTF-AQYTKISEAGTVSKVPQDST 142

Query: 70  FAQAACLGVPLTTA--SLALQRAA--VEPSDCXXXXXXXXXXXXXXXQLAQSMGCRV--- 122
             Q       L  A  SLA  R A  V+  D                Q  +  G      
Sbjct: 143 DEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLAFNQFLKKAGAHTIAV 202

Query: 123 ------LRAARQSPTDVCI--AEDEEFSALTSLTQGRGVDVVIDTVG 161
                 L+ A++   +  I  ++D+  + +  +T G+GV+   D+VG
Sbjct: 203 ASTDEKLQLAKEYGAEFLINSSKDDVLARVLEITNGQGVEAAFDSVG 249

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 60/166 (36%), Gaps = 20/166 (12%)

Query: 13  PRIPGRDFAGTVVAGPRSGEEVFGTS-GYTHAFTTNGFHAEYCVVSEDAVALKPKNVTFA 71
           P I GR+ AGT+VA    G++V     G   A+ +N   A+Y     +   +K    T  
Sbjct: 64  PYILGREAAGTIVA---KGKDVTNFEIGDKVAYISNSTFAQYTKFPSEGTVMKLSKETND 120

Query: 72  Q-----AACLGVPLTTASLALQRAAVEPSDCXXXXXXXXXXXXXXXQLAQSMGCRV---- 122
           +     AA L   LT  S   +   V   D                QL +  G       
Sbjct: 121 EELKLYAAGLLQALTALSFTNEAYHVRKGDYILLFAAAGGVGLILNQLLRMKGAHAIAVA 180

Query: 123 -----LRAARQSPTDVCIAEDEE--FSALTSLTQGRGVDVVIDTVG 161
                L  A++   +  I   +E     +  +T G GVD   D+VG
Sbjct: 181 STDEKLEIAKEYGAEYLINSSKEDILKKVLEITNGEGVDASFDSVG 226

>KNAG0I02270 Chr9 (444948..446141) [1194 bp, 397 aa] {ON} Anc_2.133
           YNL134C
          Length = 397

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 42/105 (40%), Gaps = 26/105 (24%)

Query: 9   YTVFPR--IPGRDFAGTVVA-GPRS-------GEEVFG-TSGYTHAFTTNGFHAEYCVVS 57
           Y + P+  I G D AG +V  GP         G+ ++G   G +  F TNG  AEY  +S
Sbjct: 75  YGIGPQGAILGCDVAGDIVKLGPNVDPAQFHIGDTLYGFVHGASVRFPTNGAFAEYVAIS 134

Query: 58  EDAVALKPKN---------------VTFAQAACLGVPLTTASLAL 87
                  PK                 T   AA L V LTTA + L
Sbjct: 135 SKIAYRTPKQGLPASGADSLPEGAVTTLEGAATLPVSLTTAGIVL 179

>NCAS0G01650 Chr7 (292924..294051) [1128 bp, 375 aa] {ON} 
          Length = 375

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 40/96 (41%), Gaps = 23/96 (23%)

Query: 15  IPGRDFAGTVVA-GPRS-------GEEVFGT-SGYTHAFTTNGFHAEYCVVSEDAVALKP 65
           I G D AG +V  GP         G++V+G   G +  F TNG  AEY  +         
Sbjct: 60  ILGCDAAGEIVKLGPNVDTNEFHIGDKVYGVIHGASIRFPTNGAFAEYVALDSKIAYHAD 119

Query: 66  KNV--------------TFAQAACLGVPLTTASLAL 87
           KN+              TF   A   + LTTA++AL
Sbjct: 120 KNMQNSTTETRPEGKATTFEDVASFPISLTTAAIAL 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,035,498
Number of extensions: 849106
Number of successful extensions: 1974
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2019
Number of HSP's successfully gapped: 25
Length of query: 273
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 165
Effective length of database: 41,097,471
Effective search space: 6781082715
Effective search space used: 6781082715
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)