Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C10516gna 1ON56156130160.0
Kwal_23.6537na 1ON55255316690.0
Suva_8.436na 1ON54554915750.0
Skud_15.546na 1ON54255415100.0
YOR380W (RDR1)na 1ON54655814920.0
Smik_15.561na 1ON54655614800.0
SAKL0D13464g2.565ON6874841601e-10
TPHA0F013802.231ON890481572e-10
KLTH0D07898g2.565ON6725601537e-10
KNAG0M021202.565ON6083711537e-10
NCAS0A127202.565ON7594641458e-09
SAKL0E08998g2.231ON823441332e-07
KLTH0E07854g4.113ON938841323e-07
YKL015W (PUT3)2.654ON979851314e-07
CAGL0G08844g2.231ON847461288e-07
TBLA0G026102.231ON1000391288e-07
SAKL0C03938g1.128ON780381271e-06
Kpol_1039.112.231ON992391271e-06
YJL206C1.128ON7583681261e-06
KAFR0J017102.231ON848391261e-06
NDAI0B038502.231ON930391262e-06
Smik_10.251.128ON7723661252e-06
Skud_10.101.128ON833371252e-06
KLTH0G09108g2.231ON782411252e-06
TDEL0C044802.231ON852411252e-06
Kwal_23.47542.231ON812411252e-06
NCAS0H034202.654ON902711252e-06
KAFR0F014901.128ON658421242e-06
KLLA0F04609g2.231ON916411242e-06
NCAS0B065502.231ON906381242e-06
YIL130W (ASG1)2.231ON964371233e-06
SAKL0A02860g6.279ON7453911233e-06
Smik_9.392.231ON1012371233e-06
Suva_9.592.231ON926371234e-06
Skud_9.372.231ON954371224e-06
KNAG0E017602.231ON902381224e-06
KNAG0I005601.128ON663451215e-06
TPHA0F008304.113ON1192381225e-06
Suva_6.2851.128ON7863661207e-06
ZYRO0E06270g2.565ON912381207e-06
KAFR0A021302.565ON707391207e-06
KLLA0A03443g7.17ON975501208e-06
NCAS0A035804.113ON11131021191e-05
NDAI0A034204.113ON1108461181e-05
YMR019W (STB4)2.565ON949481172e-05
KAFR0C03730singletonON791391162e-05
NDAI0B015402.565ON8031151162e-05
KAFR0C039002.654ON818691162e-05
Ecym_53972.231ON826391153e-05
AER370W2.231ON801391153e-05
TDEL0H007901.199ON827741153e-05
TBLA0E019007.56ON840501153e-05
KLLA0C03201g1.128ON650421143e-05
KLLA0C14212gna 2ON1040371144e-05
Suva_11.2132.654ON985841144e-05
Skud_2.1064.113ON1010571144e-05
ZYRO0G22550gsingletonON724501135e-05
KAFR0B028208.283ON664301127e-05
Skud_1.107.17ON1040551127e-05
YAL051W (OAF1)7.17ON1047551127e-05
KAFR0F034104.113ON995401118e-05
SAKL0G19470g2.654ON831401119e-05
Suva_13.1862.565ON894391119e-05
Kwal_47.175064.113ON924531111e-04
KLLA0F19602g8.283ON603801101e-04
Ecym_33922.654ON847401101e-04
NDAI0A010401.199ON995751101e-04
NCAS0A016304.113ON1043711101e-04
YGL013C (PDR1)4.113ON1068481101e-04
CAGL0B03421g1.380ON1355551092e-04
Suva_1.147.17ON1045551082e-04
KNAG0D035204.113ON1030481082e-04
Smik_11.2402.654ON9761161082e-04
CAGL0A00451g4.113ON1107401082e-04
ACR241C1.199ON795601073e-04
KNAG0H002502.654ON896461073e-04
YBL005W (PDR3)4.113ON976781073e-04
SAKL0D01100g4.113ON940651073e-04
KLTH0H01672gna 3ON701421063e-04
TBLA0A007302.654ON1037801063e-04
Smik_13.1832.565ON911391063e-04
Kwal_56.24566na 3ON755421063e-04
Ecym_72354.113ON943421064e-04
ZYRO0D02090g1.199ON842501054e-04
KLLA0A06039g1.199ON657471054e-04
Smik_1.137.17ON1046651055e-04
NCAS0D04860singletonON701661055e-04
KNAG0E041507.17ON1136681055e-04
Skud_13.1732.565ON920391055e-04
Kpol_1059.268.642ON420531045e-04
Suva_15.425singletonON644351045e-04
KLLA0E13993gsingletonON678561046e-04
Skud_5.331singletonON17041996e-04
TBLA0C062306.60ON795581046e-04
NDAI0H019907.17ON1161541047e-04
NDAI0C002602.654ON1041781047e-04
Suva_15.415na 4ON867691037e-04
Suva_2.1214.113ON971361038e-04
SAKL0H00660gsingletonON912451038e-04
YKR064W (OAF3)1.199ON863561038e-04
KLTH0B09262gsingletonON820381038e-04
Smik_7.2774.113ON1069481038e-04
KLTH0E14454gna 5ON902361020.001
KLLA0E18129g2.654ON865401020.001
Smik_26.8singletonON11739940.001
Smik_17.27singletonON6882151010.001
Smik_12.1578.283ON644641010.001
KAFR0B039508.845ON1246741020.001
TBLA0A012101.380ON1422481020.001
KLLA0D12672g6.279ON8652001010.001
NDAI0E038507.56ON768381010.001
TDEL0F023304.113ON1086381010.001
KLTH0E00440gsingletonON688281010.001
KLTH0B10076gsingletonON688281010.001
AFL160C6.279ON6482111010.001
Smik_2.1154.113ON971411010.001
TDEL0B005308.845ON1301681010.002
ZYRO0C18150g1.128ON571401000.002
CAGL0F07909g3.109ON1049431000.002
TBLA0C040504.113ON1207421000.002
Suva_16.25singletonON14357940.002
YOR337W (TEA1)7.56ON759501000.002
TBLA0C011201.380ON1486471000.002
KLTH0C03762g8.845ON1206761000.002
CAGL0L03377g1.277ON1209361000.002
SAKL0B10538g7.56ON70141990.002
TPHA0B036301.380ON1429451000.002
KAFR0G005701.199ON86248990.002
KLLA0D10153gsingletonON65573990.002
YBR297W (MAL33)na 6ON46884980.002
KLLA0F22990g1.380ON125352990.002
Skud_7.2744.113ON108038990.002
SAKL0F11616g7.360ON59194990.002
TDEL0H039507.56ON66237990.002
TPHA0C010808.283ON591343990.002
KLLA0F02750g3.109ON114854990.002
TBLA0C020601.199ON98450990.002
ZYRO0C00726g7.17ON103546990.003
TPHA0N004407.56ON75741990.003
KLTH0D02222gna 7ON84740990.003
NDAI0K003908.845ON149569990.003
Skud_7.638singletonON47333980.003
NDAI0D035504.113ON111853990.003
SAKL0D01342g8.845ON127068990.003
NDAI0B025208.283ON71040980.003
Kwal_14.16316.154ON44344970.003
Smik_3.209singletonON83246980.003
TDEL0B074902.654ON86584980.003
KLTH0E05786gna 8ON81732980.003
CAGL0L09691g2.654ON82432980.003
Skud_15.5027.56ON75942980.003
TDEL0B062601.380ON1247112980.003
KLLA0C19228gsingletonON59130970.003
KLTH0C00814g2.654ON83440980.003
SAKL0C00242gna 8ON83352980.003
SAKL0H00682gna 2ON92246980.003
NCAS0E023107.56ON71838970.004
CAGL0F09229gna 8ON83542970.004
SAKL0B04620gna 9ON36236960.004
KLTH0F03014gsingletonON61240970.004
ZYRO0G10252g4.113ON103638980.004
CAGL0F02519g1.128ON83239970.004
ZYRO0G14278g8.845ON125068980.004
Kwal_27.102328.845ON120968970.004
KLTH0H16170gna 10ON619117970.004
KLLA0A09119g4.113ON108238970.004
Kpol_1061.261.380ON127454970.004
Smik_16.15singletonON46333960.004
Kwal_14.9152.654ON822168970.004
Ecym_27321.380ON119844970.005
Ecym_46168.845ON157768970.005
KAFR0E024107.56ON69137960.005
Skud_3.181singletonON83146960.005
TBLA0F012003.109ON108648960.005
KAFR0I020301.380ON123345960.005
NCAS0C003908.845ON116468960.005
SAKL0B06732gna 5ON87836960.005
NDAI0G041403.109ON100168960.005
NDAI0G052601.380ON158153960.006
Suva_7.2684.113ON100038960.006
KNAG0C011601.199ON83554960.006
Kpol_467.11.380ON128944960.006
NCAS0B082001.199ON87579960.006
ZYRO0D06688g8.283ON59540950.006
KLLA0D01452g8.845ON144568960.006
YCR106W (RDS1)na 4ON83243950.007
Kpol_1061.424.113ON112936960.007
Ecym_7440na 5ON89836950.007
Skud_11.3001.199ON86530950.007
TBLA0A04280singletonON89282950.007
KNAG0C059804.113ON96840950.007
CAGL0I07755g3.109ON105346950.007
AFR117C1.380ON115244950.007
Smik_15.5477.17ON99547950.008
TPHA0N002307.17ON123240950.008
KNAG0I014501.380ON147644950.008
Kpol_2001.161.199ON80263950.008
SAKL0D08008gna 11ON122873950.008
Kpol_1061.113.264ON733172940.008
NDAI0I007406.279ON1033276940.009
ZYRO0E00572g2.654ON83889940.009
Skud_11.2142.654ON98176940.009
KLTH0C10098g6.60ON77141940.009
NCAS0A088401.380ON147853940.009
Suva_8.3877.56ON75937940.009
Ecym_4635na 12ON85648940.010
YOR162C (YRR1)6.60ON81053940.010
Smik_15.5157.56ON75937940.010
TPHA0A045403.109ON117852940.010
Suva_13.4688.845ON141868940.010
YMR280C (CAT8)8.845ON143368940.010
KNAG0M00120singletonON88139940.010
Suva_14.423na 13ON61650930.010
KLLA0A02585gna 9ON37036930.010
Smik_2.438na 6ON46935930.010
Kwal_26.7095na 7ON83858940.011
KLLA0E02663gna 12ON110947940.011
YNR063Wna 13ON60729930.011
KAFR0A066904.113ON99738940.011
CAGL0K05841g1.380ON137242930.012
AER183Cna 5ON87936930.012
SAKL0D07898g1.380ON124444930.012
TDEL0B063602.547ON98151930.012
Kwal_YGOB_0.1391.380ON124044930.012
Smik_13.4938.845ON143368930.013
Smik_11.3261.199ON86529930.013
TPHA0O006001.380ON137248930.013
CAGL0J07150g7.17ON102240930.013
Skud_13.4528.845ON143268930.013
NDAI0F020506.154ON44638920.014
Suva_15.773.109ON102945930.014
ZYRO0G00308gsingletonON64927920.014
TDEL0H043407.17ON98946930.014
NDAI0I021906.61ON73530920.014
CAGL0M03025g8.845ON125468930.014
Smik_25.2singletonON78539920.014
TDEL0B040006.154ON42138920.015
NCAS0A076107.17ON102254920.015
KLLA0F22880gna 11ON1164109930.015
NCAS0A03570na 14ON97838920.015
KLTH0H05720g6.154ON44441910.016
KNAG0E004507.56ON71036920.016
YLR256W (HAP1)1.380ON150244920.016
Smik_15.3426.60ON81043920.017
Skud_7.627na 15ON47437910.017
Suva_4.4996.154ON45046910.017
KLTH0H11572g1.380ON123744920.018
TPHA0E012905.322ON85288920.018
KLLA0C18953gna 16ON70326920.018
NCAS0G011006.279ON935248920.018
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C10516g
         (561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...  1166   0.0  
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...   647   0.0  
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...   611   0.0  
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...   586   0.0  
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...   579   0.0  
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...   574   0.0  
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    66   1e-10
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    65   2e-10
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    64   7e-10
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    64   7e-10
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    60   8e-09
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    56   2e-07
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    55   3e-07
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    55   4e-07
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    54   8e-07
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    54   8e-07
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    54   1e-06
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    54   1e-06
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    53   1e-06
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    53   1e-06
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    53   2e-06
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    53   2e-06
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    53   2e-06
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    53   2e-06
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    53   2e-06
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    53   2e-06
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    53   2e-06
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    52   2e-06
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    52   2e-06
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    52   2e-06
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    52   3e-06
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    52   3e-06
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    52   3e-06
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    52   4e-06
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    52   4e-06
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    52   4e-06
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    51   5e-06
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    52   5e-06
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    51   7e-06
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    51   7e-06
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    51   7e-06
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    51   8e-06
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    50   1e-05
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    50   1e-05
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    50   2e-05
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               49   2e-05
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    49   2e-05
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    49   2e-05
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    49   3e-05
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    49   3e-05
TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa] {O...    49   3e-05
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    49   3e-05
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    49   3e-05
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    49   4e-05
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    49   4e-05
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    49   4e-05
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    48   5e-05
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    48   7e-05
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    48   7e-05
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    48   7e-05
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    47   8e-05
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    47   9e-05
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    47   9e-05
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    47   1e-04
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    47   1e-04
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    47   1e-04
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    47   1e-04
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    47   1e-04
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    47   1e-04
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    47   2e-04
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    46   2e-04
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    46   2e-04
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    46   2e-04
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    46   2e-04
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    46   3e-04
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    46   3e-04
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    46   3e-04
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    46   3e-04
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    45   3e-04
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    45   3e-04
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    45   3e-04
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    45   3e-04
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    45   4e-04
ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa] {...    45   4e-04
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    45   4e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    45   5e-04
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               45   5e-04
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    45   5e-04
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    45   5e-04
Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa] {O...    45   5e-04
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    45   5e-04
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    45   6e-04
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    43   6e-04
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    45   6e-04
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    45   7e-04
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    45   7e-04
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    44   7e-04
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    44   8e-04
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    44   8e-04
YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}  OAF3Putat...    44   8e-04
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    44   8e-04
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    44   8e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    44   0.001
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    44   0.001
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      41   0.001
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    44   0.001
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    44   0.001
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...    44   0.001
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    44   0.001
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    44   0.001
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      44   0.001
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    44   0.001
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    44   0.001
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    44   0.001
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    44   0.001
Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W ...    44   0.001
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...    44   0.002
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    43   0.002
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    43   0.002
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    43   0.002
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    41   0.002
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    43   0.002
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    43   0.002
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...    43   0.002
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    43   0.002
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    43   0.002
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    43   0.002
KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa] {O...    43   0.002
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    43   0.002
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.002
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    43   0.002
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    43   0.002
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    43   0.002
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    43   0.002
TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.2...    43   0.002
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    43   0.002
TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON} Anc_1.1...    43   0.002
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    43   0.003
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    43   0.003
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    43   0.003
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845     43   0.003
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    42   0.003
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    43   0.003
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...    43   0.003
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    42   0.003
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    42   0.003
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    42   0.003
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    42   0.003
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    42   0.003
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    42   0.003
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    42   0.003
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    42   0.003
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    42   0.003
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    42   0.003
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    42   0.003
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    42   0.003
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      42   0.004
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.004
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    42   0.004
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    42   0.004
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    42   0.004
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    42   0.004
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...    42   0.004
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...    42   0.004
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    42   0.004
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    42   0.004
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    42   0.004
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    42   0.004
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    42   0.004
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.005
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...    42   0.005
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    42   0.005
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    42   0.005
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    42   0.005
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    42   0.005
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845      42   0.005
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    42   0.005
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    42   0.005
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.006
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    42   0.006
KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa] {O...    42   0.006
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.006
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    42   0.006
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    41   0.006
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    42   0.006
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    41   0.007
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    42   0.007
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    41   0.007
Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064...    41   0.007
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    41   0.007
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    41   0.007
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    41   0.007
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    41   0.007
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    41   0.008
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    41   0.008
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              41   0.008
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    41   0.008
SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa] ...    41   0.008
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    41   0.008
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    41   0.009
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    41   0.009
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    41   0.009
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    41   0.009
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    41   0.009
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    41   0.009
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    41   0.010
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    41   0.010
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    41   0.010
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    41   0.010
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    41   0.010
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    41   0.010
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      41   0.010
Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063...    40   0.010
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    40   0.010
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    40   0.010
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    41   0.011
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    41   0.011
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    40   0.011
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    41   0.011
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    40   0.012
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    40   0.012
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    40   0.012
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    40   0.012
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    40   0.012
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    40   0.013
Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064...    40   0.013
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    40   0.013
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    40   0.013
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    40   0.013
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    40   0.014
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    40   0.014
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    40   0.014
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    40   0.014
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    40   0.014
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    40   0.014
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     40   0.014
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    40   0.015
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    40   0.015
KLLA0F22880g Chr6 (2123577..2127071) [3495 bp, 1164 aa] {ON} som...    40   0.015
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    40   0.015
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    40   0.016
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    40   0.016
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    40   0.016
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.017
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    40   0.017
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    40   0.017
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    40   0.018
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    40   0.018
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    40   0.018
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    40   0.018
Kwal_26.8200 s26 (688203..690161) [1959 bp, 652 aa] {ON} YMR019W...    40   0.018
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    40   0.019
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    40   0.019
Suva_11.299 Chr11 (546739..549408) [2670 bp, 889 aa] {ON} YKR064...    40   0.019
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    40   0.019
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    40   0.020
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    40   0.020
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    40   0.020
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    40   0.020
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    40   0.021
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    40   0.022
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    40   0.022
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    40   0.022
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    40   0.022
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    40   0.022
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    40   0.024
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    39   0.024
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    40   0.024
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    40   0.025
Skud_2.277 Chr2 complement(508677..511877) [3201 bp, 1066 aa] {O...    40   0.025
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    40   0.025
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    40   0.025
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    39   0.025
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...    39   0.027
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    39   0.027
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     39   0.029
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    39   0.029
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               39   0.029
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    39   0.030
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    39   0.030
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    39   0.030
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.031
Suva_15.245 Chr15 complement(416757..419414) [2658 bp, 885 aa] {...    39   0.031
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    39   0.031
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    39   0.033
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    39   0.034
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    39   0.034
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    39   0.035
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    39   0.035
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                39   0.035
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    39   0.035
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    39   0.035
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    39   0.036
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    39   0.036
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    39   0.037
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    39   0.038
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    39   0.041
Ecym_8327 Chr8 (663876..665114) [1239 bp, 412 aa] {ON} similar t...    39   0.041
NDAI0D03480 Chr4 complement(818292..820418) [2127 bp, 708 aa] {O...    39   0.043
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    39   0.044
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               39   0.044
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    39   0.045
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    39   0.046
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    39   0.046
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    39   0.047
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    39   0.048
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    38   0.049
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    39   0.049
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    39   0.050
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    39   0.050
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    39   0.050
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    39   0.051
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    39   0.052
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    38   0.052
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    38   0.052
AFL033W Chr6 (373485..374633) [1149 bp, 382 aa] {ON} Syntenic ho...    38   0.054
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    39   0.055
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    39   0.056
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.057
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    38   0.057
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.057
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    38   0.057
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    38   0.059
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    38   0.059
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    38   0.061
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    38   0.062
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    38   0.062
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    38   0.069
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    38   0.069
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    38   0.069
TBLA0C04000 Chr3 complement(961730..963748) [2019 bp, 672 aa] {O...    38   0.072
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    38   0.072
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    38   0.073
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    38   0.074
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    38   0.076
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    38   0.085
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    38   0.088
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.089
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    38   0.090
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    38   0.093
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    37   0.093
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    38   0.093
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    38   0.093
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    38   0.094
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    38   0.097
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    37   0.098
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     37   0.10 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    37   0.10 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    37   0.11 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    37   0.11 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    37   0.11 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    37   0.11 
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    37   0.12 
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    37   0.12 
Smik_5.9 Chr5 complement(10186..10212,10216..10227,10231..10359)...    33   0.12 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    37   0.12 
KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON} conser...    37   0.12 
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    37   0.12 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     37   0.13 
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    37   0.13 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    37   0.13 
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    37   0.13 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.13 
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    37   0.14 
NDAI0E02270 Chr5 (466651..468141) [1491 bp, 496 aa] {ON} Anc_8.642     37   0.14 
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    37   0.14 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    37   0.14 
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    37   0.14 
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    37   0.14 
TPHA0I00860 Chr9 complement(188725..190215) [1491 bp, 496 aa] {O...    37   0.14 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               37   0.15 
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    37   0.15 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.15 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    37   0.15 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    37   0.15 
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   37   0.15 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    37   0.16 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.16 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    37   0.16 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.16 
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    37   0.17 
TPHA0F03260 Chr6 (709472..710887) [1416 bp, 471 aa] {ON} Anc_8.6...    37   0.17 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    36   0.17 
KAFR0G01360 Chr7 complement(305620..308121) [2502 bp, 833 aa] {O...    37   0.17 
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    37   0.17 
Kpol_1043.23 s1043 complement(44809..46680) [1872 bp, 623 aa] {O...    37   0.17 
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    37   0.18 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    37   0.18 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    37   0.18 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    37   0.18 
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    37   0.19 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    37   0.19 
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    36   0.19 
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    37   0.19 
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    36   0.19 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    36   0.19 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.19 
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      37   0.20 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    37   0.20 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.20 
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    37   0.21 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    37   0.21 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    37   0.21 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    37   0.21 
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    36   0.21 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    37   0.21 
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    37   0.21 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    37   0.21 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    36   0.22 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    36   0.22 
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    36   0.23 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    36   0.23 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    36   0.24 
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               36   0.24 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    36   0.24 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    36   0.24 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    36   0.24 
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    36   0.24 
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    36   0.25 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    36   0.25 
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    36   0.25 
KLTH0F05258g Chr6 complement(462417..464825) [2409 bp, 802 aa] {...    36   0.26 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.26 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    36   0.26 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    36   0.27 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    36   0.27 
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    36   0.27 
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    36   0.28 
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    36   0.28 
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    36   0.28 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    36   0.29 
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    36   0.29 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    36   0.30 
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    36   0.30 
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    36   0.30 
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    36   0.30 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    36   0.30 
Suva_4.400 Chr4 complement(710591..713704) [3114 bp, 1037 aa] {O...    36   0.30 
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    36   0.30 
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    36   0.31 
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    36   0.31 
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    36   0.31 
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    36   0.31 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.32 
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    36   0.33 
NCAS0D02720 Chr4 complement(520916..523189) [2274 bp, 757 aa] {O...    36   0.33 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    36   0.33 
KLTH0D00594g Chr4 (57414..59309) [1896 bp, 631 aa] {ON} conserve...    36   0.33 
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    36   0.34 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    36   0.34 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    36   0.34 
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    36   0.35 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    36   0.35 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    36   0.35 
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    36   0.36 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    36   0.36 
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    36   0.37 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    35   0.38 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    35   0.39 
Suva_2.469 Chr2 complement(833514..836180) [2667 bp, 888 aa] {ON...    35   0.39 
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    36   0.40 
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    35   0.40 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    35   0.41 
Skud_4.565 Chr4 complement(1011134..1013803) [2670 bp, 889 aa] {...    35   0.42 
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    35   0.42 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    35   0.42 
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    35   0.42 
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    35   0.42 
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    35   0.43 
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    35   0.43 
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    35   0.44 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    35   0.44 
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    35   0.44 
ABR174W Chr2 (728570..731164) [2595 bp, 864 aa] {ON} Syntenic ho...    35   0.44 
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    35   0.45 
YDR303C Chr4 complement(1068729..1071386) [2658 bp, 885 aa] {ON}...    35   0.46 
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    35   0.46 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    35   0.46 
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    35   0.47 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    35   0.47 
TDEL0F02240 Chr6 complement(409453..411393) [1941 bp, 646 aa] {O...    35   0.48 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    35   0.49 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    35   0.50 
KLTH0E08140g Chr5 (747649..749547) [1899 bp, 632 aa] {ON} conser...    35   0.50 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    35   0.51 
KNAG0M01040 Chr13 complement(183066..185591) [2526 bp, 841 aa] {...    35   0.51 
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    35   0.52 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    35   0.52 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    35   0.52 
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    35   0.54 
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    35   0.55 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    35   0.55 
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    35   0.60 
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    35   0.60 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    35   0.61 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    35   0.62 
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    35   0.62 
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    35   0.62 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    35   0.64 
TBLA0B07000 Chr2 complement(1655102..1656517) [1416 bp, 471 aa] ...    35   0.64 
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    35   0.64 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    35   0.65 
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   0.66 
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    35   0.67 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    35   0.67 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    35   0.67 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       35   0.67 
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    35   0.68 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    33   0.69 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    35   0.69 
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    35   0.69 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    35   0.72 
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    35   0.74 
SAKL0G09768g Chr7 (828604..830937) [2334 bp, 777 aa] {ON} simila...    35   0.75 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    35   0.75 
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               35   0.75 
ACR107W Chr3 (544402..545556) [1155 bp, 384 aa] {ON} Syntenic ho...    34   0.75 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    35   0.76 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   0.76 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    35   0.77 
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    34   0.78 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   0.78 
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    35   0.81 
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   0.81 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    35   0.82 
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    34   0.83 
NDAI0C04170 Chr3 complement(953071..955548) [2478 bp, 825 aa] {O...    35   0.84 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    35   0.84 
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    35   0.87 
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    34   0.87 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    34   0.88 
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    34   0.89 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     35   0.90 
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    34   0.91 
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    34   0.91 
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    34   0.91 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    34   0.91 
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...    34   0.92 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    34   0.93 
NCAS0F02700 Chr6 complement(547682..550189) [2508 bp, 835 aa] {O...    34   0.93 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    34   0.94 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    34   0.94 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    34   0.96 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    34   0.98 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    34   0.99 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    34   1.00 
Kwal_33.13934 s33 complement(456687..459080) [2394 bp, 797 aa] {...    34   1.0  
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    34   1.0  
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    34   1.0  
TBLA0J00370 Chr10 complement(67871..69286) [1416 bp, 471 aa] {ON...    34   1.0  
TBLA0A02950 Chr1 complement(709449..712349) [2901 bp, 966 aa] {O...    34   1.0  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    34   1.1  
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    34   1.1  
Ecym_5001 Chr5 (915..2738) [1824 bp, 607 aa] {ON} similar to Ash...    34   1.1  
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    34   1.1  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    34   1.1  
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    34   1.1  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    34   1.1  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    34   1.1  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    34   1.1  
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    34   1.1  
KAFR0B04830 Chr2 (1003592..1005487) [1896 bp, 631 aa] {ON} Anc_2...    34   1.1  
Kwal_26.8662 s26 (888487..889554) [1068 bp, 355 aa] {ON} YPL133C...    34   1.2  
KLTH0D10428g Chr4 (861135..862196) [1062 bp, 353 aa] {ON} simila...    33   1.2  
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    34   1.3  
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    34   1.3  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    34   1.3  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    34   1.3  
SAKL0H07370g Chr8 complement(641801..642982) [1182 bp, 393 aa] {...    33   1.3  
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    34   1.3  
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    33   1.4  
NCAS0C05100 Chr3 complement(1038084..1041143) [3060 bp, 1019 aa]...    34   1.4  
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    34   1.4  
KLTH0F09702g Chr6 (840760..842589) [1830 bp, 609 aa] {ON} simila...    33   1.4  
SAKL0D14916g Chr4 complement(1233415..1235313) [1899 bp, 632 aa]...    33   1.4  
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 33   1.4  
ZYRO0B14476g Chr2 complement(1175759..1177882) [2124 bp, 707 aa]...    33   1.5  
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    34   1.5  
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    34   1.5  
NDAI0H03240 Chr8 complement(775826..777718) [1893 bp, 630 aa] {O...    33   1.5  
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    33   1.5  
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    33   1.6  
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    33   1.7  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    33   1.7  
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    33   1.7  
KLLA0D15356g Chr4 (1301848..1303722) [1875 bp, 624 aa] {ON} some...    33   1.7  
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    33   1.7  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    33   1.7  
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    33   1.7  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    33   1.7  
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    33   1.8  
KNAG0M01560 Chr13 (276011..278863) [2853 bp, 950 aa] {ON} Anc_5....    33   1.8  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     33   1.8  
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    33   1.8  
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    33   1.9  
KAFR0H02600 Chr8 complement(496353..497432) [1080 bp, 359 aa] {O...    33   1.9  
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    33   1.9  
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    33   1.9  
Kwal_23.3514 s23 (324012..325751) [1740 bp, 579 aa] {ON} YMR168C...    33   2.0  
NCAS0C01530 Chr3 (281676..282899) [1224 bp, 407 aa] {ON} Anc_8.642     33   2.0  
KNAG0D03450 Chr4 (620486..622552) [2067 bp, 688 aa] {ON} Anc_4.121     33   2.0  
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    33   2.0  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    33   2.0  
TPHA0D01900 Chr4 complement(395128..397812) [2685 bp, 894 aa] {O...    33   2.1  
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    33   2.1  
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    33   2.2  
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    33   2.3  
KLTH0H11704g Chr8 complement(1003625..1007182) [3558 bp, 1185 aa...    33   2.3  
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    33   2.3  
ACR028C Chr3 complement(408701..410506) [1806 bp, 601 aa] {ON} N...    33   2.3  
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    33   2.3  
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    32   2.4  
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    33   2.5  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   2.5  
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    33   2.5  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...    33   2.6  
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    33   2.6  
Ecym_3200 Chr3 complement(384639..387116) [2478 bp, 825 aa] {ON}...    33   2.7  
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    33   2.8  
YPL133C Chr16 complement(299888..301228) [1341 bp, 446 aa] {ON} ...    33   2.9  
ZYRO0F06556g Chr6 (542397..543476) [1080 bp, 359 aa] {ON} simila...    32   2.9  
YNL136W Chr14 (370368..371645) [1278 bp, 425 aa] {ON}  EAF7Subun...    32   3.0  
TBLA0H00520 Chr8 complement(101556..102506) [951 bp, 316 aa] {ON}      32   3.0  
TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON} Anc_5.3...    33   3.1  
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    33   3.1  
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               33   3.1  
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    33   3.2  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    32   3.2  
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    33   3.3  
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    32   3.4  
TBLA0E05030 Chr5 complement(1294821..1297529) [2709 bp, 902 aa] ...    33   3.4  
Ecym_6355 Chr6 (689363..691132) [1770 bp, 589 aa] {ON} similar t...    32   3.5  
Kwal_47.17565 s47 (457523..459409) [1887 bp, 628 aa] {ON} [conti...    32   3.5  
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    32   3.6  
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     32   3.8  
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    32   3.8  
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    32   3.9  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    32   3.9  
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    32   4.0  
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    32   4.2  
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    32   4.4  
KNAG0J01530 Chr10 (281029..282111) [1083 bp, 360 aa] {ON} Anc_8....    32   4.8  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    32   5.2  
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    32   5.3  
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    32   5.9  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   6.0  
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    32   6.0  
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    32   6.2  
Skud_10.110 Chr10 complement(196907..198793) [1887 bp, 628 aa] {...    32   6.5  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    32   6.6  
Skud_9.204 Chr9 (367291..370320) [3030 bp, 1009 aa] {ON} YIR023W...    32   6.9  
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    32   7.1  
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    32   7.1  
CAGL0F05357g Chr6 (541830..543635) [1806 bp, 601 aa] {ON} some s...    31   7.8  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    31   8.2  
CAGL0K06985g Chr11 (681944..683734) [1791 bp, 596 aa] {ON} simil...    31   8.6  

>KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} similar
           to uniprot|P23172 Saccharomyces cerevisiae YOR380W RDR1
           Transcriptional repressor involved in the control of
           multidrug resistance negatively regulates expression of
           the PDR5 gene member of the Gal4p family of zinc cluster
           proteins
          Length = 561

 Score = 1166 bits (3016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/561 (100%), Positives = 561/561 (100%)

Query: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60
           MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP
Sbjct: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60

Query: 61  LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAF 120
           LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAF
Sbjct: 61  LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAF 120

Query: 121 ARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV 180
           ARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV
Sbjct: 121 ARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV 180

Query: 181 FDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVL 240
           FDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVL
Sbjct: 181 FDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVL 240

Query: 241 EDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTA 300
           EDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTA
Sbjct: 241 EDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTA 300

Query: 301 NDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQL 360
           NDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQL
Sbjct: 301 NDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQL 360

Query: 361 VDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNY 420
           VDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNY
Sbjct: 361 VDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNY 420

Query: 421 TLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKA 480
           TLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKA
Sbjct: 421 TLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKA 480

Query: 481 KNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEID 540
           KNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEID
Sbjct: 481 KNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEID 540

Query: 541 WDVLLDPSHALHLMQQDFSSF 561
           WDVLLDPSHALHLMQQDFSSF
Sbjct: 541 WDVLLDPSHALHLMQQDFSSF 561

>Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa]
           {ON} YOR380W (RDR1) - Transcriptional repressor (zinc
           cluster protein) [contig 358] FULL
          Length = 552

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/553 (56%), Positives = 400/553 (72%), Gaps = 11/553 (1%)

Query: 8   VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPD 67
           VP  KR R RKAC+PCRQRKR+CD   PCGMC SY Y C YD+   P +       + P 
Sbjct: 8   VPRNKRLRVRKACLPCRQRKRKCDSGFPCGMCTSYGYNCQYDDVDGPLSF----YEKRPS 63

Query: 68  STRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAFARSLGIE 127
             +S SP     + K    R  +L   + C++++G+FD +KSRYM L SAVAF R LG+E
Sbjct: 64  PKQSTSP---STIQKKEVERPSML---SPCSSERGIFDPSKSRYMSLHSAVAFPRYLGLE 117

Query: 128 LQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPVFDVVDPE 187
           LQS NPPHLHSFAWNCG+R EE S +H  L ++I+K++   FT +YF  +HP+FD++DP 
Sbjct: 118 LQSVNPPHLHSFAWNCGIRPEENSTSHPDLANIISKDDCNRFTDVYFEVVHPMFDIIDPS 177

Query: 188 HFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVLEDPTFSR 247
            F++S++SYW     VSAF AV+GG++ALGS FS   GH REL+IVQYAK++LEDPTFS 
Sbjct: 178 QFRQSLDSYWGGARNVSAFDAVIGGVVALGSFFSRNFGHARELDIVQYAKDILEDPTFSS 237

Query: 248 LPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVEL-TANDKALP 306
            PS EQ+SAWVLR++YLRAT RPH AWLASC+T+HL EA+ALHHEV+ VEL T ND  LP
Sbjct: 238 QPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLVEATALHHEVDKVELATRNDAPLP 297

Query: 307 PRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQLVDLALI 366
           PR   + ERARRLFWCAW IN+I+SY+YGRS  +L  ISCKL  +S  NYTA++V+LA +
Sbjct: 298 PRANSVCERARRLFWCAWCINTIISYEYGRSCVTLNKISCKLLKESTKNYTAEMVELARM 357

Query: 367 IPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNYTLDSEV 426
           IP  +  +   ++VA L++A+  VY+  D H FLSL KADLC+SFYRRLRL N+ LD  V
Sbjct: 358 IPTTSQCSDPASQVAALIEAIDRVYKAADVHPFLSLTKADLCHSFYRRLRLLNHVLDRSV 417

Query: 427 VFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKAKNIFDR 486
           V Q+  +   ALSAA DLV +   WWNVLS  F Y CVLLAI++ +SL+NVA AK+IFD 
Sbjct: 418 VLQIINIGTSALSAAEDLVRKNHTWWNVLSTVFHYFCVLLAIDSPDSLSNVAAAKSIFDS 477

Query: 487 IVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEIDWDVLLD 546
           IV  L+TH+A EAQ T KLLL+DS+KKK++E+  LE AD+ G A    ++ +IDWD LLD
Sbjct: 478 IVKILDTHIAKEAQATAKLLLRDSMKKKKREIAHLEIADKEGPAPNTNYSPDIDWDALLD 537

Query: 547 PSHALHLMQQDFS 559
           PS++L+LM Q++S
Sbjct: 538 PSNSLNLMHQEYS 550

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/549 (54%), Positives = 374/549 (68%), Gaps = 21/549 (3%)

Query: 12  KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDP-ATLPAPLIPEIPDSTR 70
           KRQR RKACVPCR+RKR+C+G +PC MCV+Y Y CHY E+  P A+     + E+P  T+
Sbjct: 12  KRQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYTEEDGPLASSRMNQVEELPHDTK 71

Query: 71  SISPPRTRMVAKPPSIRTKILLNSTQCAADQ-----GVFDAAKSRYMGLSSAVAFARSLG 125
           +            P +   I+ N T     Q      + D  KSRY    SAVAF RSLG
Sbjct: 72  N-----------RPYVPLDIIGNGTHSTDSQHVTNGNIIDRTKSRYTIQHSAVAFPRSLG 120

Query: 126 IELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPVFDVVD 185
           +EL+S NPP LH FAW+CG+R EEK + H  L D++TKEE +  +++YFS +HP+FD+VD
Sbjct: 121 LELRSTNPPRLHCFAWHCGIRPEEKPSFHVPLSDIVTKEEYYRISKVYFSVVHPIFDIVD 180

Query: 186 PEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVLEDPTF 245
           PE   K+VE YWN   + S +GAV+ G+IALGS F G  GHPRE++I+QYAK +L+DPTF
Sbjct: 181 PEQLGKNVEKYWNGDAETSEYGAVIAGVIALGSFFLGSLGHPREMDIIQYAKGILDDPTF 240

Query: 246 SRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKAL 305
           SR+PS EQ+SAWVLRT+YLRAT RPH AWLASC+TIHL+EA  LHHE++  +L   +   
Sbjct: 241 SRIPSVEQISAWVLRTIYLRATARPHVAWLASCLTIHLSEAIGLHHEIDREDLALTNNVP 300

Query: 306 PPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQLVDLAL 365
             RT +++E  RRLFW AWSIN+ILSYDYGRSS +L  I+CK   ++DGNYT  LV LA 
Sbjct: 301 LKRTTEVSEHTRRLFWSAWSINTILSYDYGRSSVTLNRITCKPVKETDGNYTVNLVSLAQ 360

Query: 366 IIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNYTLDSE 425
           ++P  +  A+    V  LLQAL  V+E+PD H FLSL KAD+C SFYRRLRL N+ LD  
Sbjct: 361 LVPQESVNAN----VTQLLQALAAVHESPDAHPFLSLTKADICLSFYRRLRLLNHILDKS 416

Query: 426 VVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKAKNIFD 485
           VV Q+  + N AL+AAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA A    D
Sbjct: 417 VVSQIIDIGNTALAAAYALVKIDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAAMRTLD 476

Query: 486 RIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEIDWDVLL 545
            I   L TH+A EAQ T KLLL+DS+KKKRQE+  LE A    +A E     +IDWD LL
Sbjct: 477 NITQVLGTHIAFEAQKTAKLLLEDSVKKKRQEIQQLEQATHQRSAPETTHLLDIDWDALL 536

Query: 546 DPSHALHLM 554
           DPS  L  M
Sbjct: 537 DPSDTLSFM 545

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/554 (53%), Positives = 378/554 (68%), Gaps = 13/554 (2%)

Query: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60
           +S+G  S P+K RQR RKACVPCR+RKR+C+G +PC MC++Y Y CHY +    +T  +P
Sbjct: 2   VSSGSNSQPYK-RQRVRKACVPCRERKRKCNGKSPCEMCIAYGYACHYTDVDGSST--SP 58

Query: 61  LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAF 120
            + E P  T +      R  + P  +R +      Q   +Q + D  KSRY    SAVAF
Sbjct: 59  RVDETPYGTDN------RPYSLPNILRNEARSVDAQNVTNQNIIDPIKSRYTIQHSAVAF 112

Query: 121 ARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV 180
            R LG+EL+S NPP LHSFAW+CG+R EE  N+H  L  L+TKEE +  +++YFS +HP+
Sbjct: 113 PRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHILLSGLVTKEEYYRISKVYFSVVHPI 172

Query: 181 FDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVL 240
           FDVVDPE   K+VE YW+   K+  +GAV+ G+IALGS F G  GHPRE+++VQYAK +L
Sbjct: 173 FDVVDPEQLAKNVERYWDGDVKMLEYGAVIAGVIALGSFFLGSLGHPREMDVVQYAKGIL 232

Query: 241 EDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTA 300
           +DPTF R+P+ EQVSAWVLRT+YLRAT+RPH AWLASC+TIHL+EA  LHHE++  +L  
Sbjct: 233 DDPTFCRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCITIHLSEAIGLHHEIDREDLVM 292

Query: 301 NDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTAQL 360
                  RT +++E  RRLFWCAWSIN+ILSYDYGRSS +L  I+CK   +++GN+T  L
Sbjct: 293 TSNVPLRRTTEVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKSVKETEGNHTVHL 352

Query: 361 VDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLFNY 420
           V LA +IP     A+       LLQAL  V+++P+ H FLSL K+D+C S YRRLRL N+
Sbjct: 353 VALAQLIPQDCVNAN----ATQLLQALAAVHKSPNAHPFLSLTKSDICLSLYRRLRLLNH 408

Query: 421 TLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVAKA 480
            LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA A
Sbjct: 409 ILDKSVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSHVAAA 468

Query: 481 KNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAEID 540
               D I   L TH+A EAQ T KLLL+DS+KKKRQE+  LE A    +  E     +ID
Sbjct: 469 MRTLDNITQVLGTHIAYEAQKTAKLLLEDSMKKKRQEIQQLERATHQRSTVETTHLLDID 528

Query: 541 WDVLLDPSHALHLM 554
           WDVLLDPS  L+ M
Sbjct: 529 WDVLLDPSDTLNFM 542

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/558 (53%), Positives = 381/558 (68%), Gaps = 19/558 (3%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPL 61
           S G  ++PHK RQR RKACVPCR+RKR+C+G +PC MCV+Y Y CHY +   P+   +P 
Sbjct: 3   SPGSTALPHK-RQRVRKACVPCRERKRKCNGKSPCEMCVAYGYVCHYIDGRVPSA--SPQ 59

Query: 62  IPEI----PDS-TRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSS 116
           + ++    PD+ +R    P      +P  I       +TQ    Q + D  KSRY    S
Sbjct: 60  VQQVGETSPDTESRPFVLPGIHRNEQPQPI-------NTQNVTSQNIVDPTKSRYTIQHS 112

Query: 117 AVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSA 176
           AVAF R LG+EL+S NPP LHSFAW+CG+R EE  N+H  L DL+TKEE +  +++YFS 
Sbjct: 113 AVAFPRCLGLELRSTNPPRLHSFAWHCGIRPEENPNSHVLLSDLVTKEEYYRISKVYFSV 172

Query: 177 IHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYA 236
           +HP+FDVV+PE   K+VE YW+   K   +GAV+ G+IALGS F G  GHPRE++IVQYA
Sbjct: 173 VHPIFDVVNPEQLAKNVEKYWDGDVKTLEYGAVIAGVIALGSFFMGSLGHPREMDIVQYA 232

Query: 237 KNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENV 296
           K +L+DPTFSR+P+ EQVSAWVLRT+YLRAT+RPH AWLASCVTIHL+EA  LHHE++  
Sbjct: 233 KGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHHEIDRE 292

Query: 297 ELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNY 356
           ++  ++   P RT  ++E  RRLFWCAWSIN+ILSYDYGRSS +L  I+CK   ++DGN+
Sbjct: 293 DIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGRSSVTLNRITCKPVKETDGNF 352

Query: 357 TAQLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLR 416
           TA LV LA +IP    + S     A LLQAL  V+E+P+ H FLSL K D+C S YRRLR
Sbjct: 353 TAHLVALAHLIP----QDSVNANAAQLLQALAAVHESPNAHPFLSLTKGDICLSLYRRLR 408

Query: 417 LFNYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLAN 476
           L N+ LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++
Sbjct: 409 LLNHILDKNVVLQIIDIGNTALSAAYALVKLDQAWWNVLSTSFQYVCVLLAIDTPESLSH 468

Query: 477 VAKAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFT 536
           VA A    D I   L T +A EAQ T KLLL+DS+KKKRQE+  LE A    +  E    
Sbjct: 469 VATAMKTLDNITQILGTRIAFEAQKTAKLLLEDSMKKKRQEIQQLEQATHQRSNLETTHL 528

Query: 537 AEIDWDVLLDPSHALHLM 554
            +IDWD LLDPS  L+ M
Sbjct: 529 LDIDWDALLDPSDTLNFM 546

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/556 (51%), Positives = 373/556 (67%), Gaps = 12/556 (2%)

Query: 1   MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY--DEQGDPATLP 58
           M++ +P++P  KRQR RKACVPCR+RKR+C+G +PC MC+SY Y CHY   ++   ++ P
Sbjct: 1   MASSVPNIPSYKRQRVRKACVPCRERKRKCNGKSPCEMCISYGYVCHYMDKDRSSSSSFP 60

Query: 59  APLIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAV 118
              + E+P +      P ++  A       ++    TQ   +Q + D  KSRY    SAV
Sbjct: 61  VQKLDELPHA------PESKPFAASNIHGNEVSSVDTQTVTNQSITDPVKSRYTIQHSAV 114

Query: 119 AFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIH 178
           AF R LG+EL+SANPP LHSFAW+CG+R EE  ++H  L +LITKEE +  +++YFS +H
Sbjct: 115 AFPRCLGLELRSANPPRLHSFAWHCGIRPEENPSSHVLLSELITKEEYYRVSKVYFSVVH 174

Query: 179 PVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPRELEIVQYAKN 238
           P+FDVVDP+   K+VE YW        +GAV+ G++ALGS F G  GHPRE+++VQYAK 
Sbjct: 175 PIFDVVDPKQLAKNVEEYWAGNISNFEYGAVIAGVVALGSFFLGSIGHPREMDVVQYAKG 234

Query: 239 VLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVEL 298
           +L+DPTFSR+P+ E VSAWVLRT+YLRAT+RPH AWLASCVTIHL+EA  LH +++  E 
Sbjct: 235 ILDDPTFSRIPTVEHVSAWVLRTIYLRATSRPHVAWLASCVTIHLSEAIGLHQDIDKGEF 294

Query: 299 TANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSSASLGGISCKLPTKSDGNYTA 358
           +        RT    E  +RLFWCAWSIN+ILSYDYGRSS +L  I+CK   +++G+YT 
Sbjct: 295 SMTSGVTLRRTAGFNEHTKRLFWCAWSINTILSYDYGRSSVALNRITCKPVEETEGSYTI 354

Query: 359 QLVDLALIIPPANTEASKETRVADLLQALTLVYETPDEHNFLSLVKADLCNSFYRRLRLF 418
            LV LA  IP    + +  T +  LL ALT ++++P+ H FL L K D+C S YRRLRL 
Sbjct: 355 HLVALAQTIP----QGTVNTDLTQLLNALTAIHKSPNAHPFLLLTKCDICLSLYRRLRLL 410

Query: 419 NYTLDSEVVFQLTTVCNHALSAAYDLVERKLPWWNVLSAPFQYICVLLAINTSESLANVA 478
           N+ LD  VV Q+  + N ALSAAY LV+    WWNVLS  FQY+CVLLAI+T ESL++VA
Sbjct: 411 NHVLDKSVVLQIIDIGNAALSAAYALVKLGQSWWNVLSTSFQYVCVLLAIDTPESLSHVA 470

Query: 479 KAKNIFDRIVSNLNTHMAIEAQNTIKLLLQDSIKKKRQELTDLEAADQAGTASEAPFTAE 538
            A    D I   L TH+A+EAQ T KLLL+DS+KKKRQE+  LE A    +  E   + +
Sbjct: 471 AAMKTLDNITEVLGTHIALEAQKTAKLLLEDSMKKKRQEIQQLEQATHDRSTFENTNSLD 530

Query: 539 IDWDVLLDPSHALHLM 554
           IDWD L DPS  L  M
Sbjct: 531 IDWDALFDPSGTLGFM 546

>SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 687

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 108/484 (22%), Positives = 186/484 (38%), Gaps = 90/484 (18%)

Query: 11  KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD--EQGDPATLPAPLIPEIPDS 68
           K+R R RKAC  C++RK +CDG  PC  C   + +C Y   +   P + P P      +S
Sbjct: 19  KQRLRVRKACEICKKRKIKCDGHQPCTSCTKNSVQCVYKFTDTASPISKPKPGRSLDKES 78

Query: 69  -TRSISPPRTRMVAKPPS--------IRTKILLNSTQCAADQGVFDAAKSR--------- 110
              ++    + ++AK  S            ++  S+   +    F   K R         
Sbjct: 79  IANALLQLESSLLAKIDSKPTPTPTPTPPNLVHFSSSLPSPWQTFSLDKYRFHRRYQNLL 138

Query: 111 --YMGLSSAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKEETFH 168
             Y+G S   +      I+  +   P + ++ WN       K+ +  +L D+I  ++   
Sbjct: 139 PYYLGQSLMQSLPPQ-TIQHHNLKTPRVQNYGWNMSGGHYLKNGSDSSL-DIINFDDPVQ 196

Query: 169 FT------QIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSA--FGAVVGGIIALGSLF 220
                   + YF  ++PVF +V  + F +   + + +  + S+  F +++  I+A    F
Sbjct: 197 LDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGFLNKRRNSSKLFISMLYLILATSLRF 256

Query: 221 SGRPGHPRELEIVQY-------AKNVLEDPTF-------SRL----PSAEQVSAWVLRTL 262
                  + +   Q+         + LE+  F       SRL     S E + +W+L   
Sbjct: 257 YEGYSQSQPVAFSQHQLDWLFKTNSSLEERLFHFAHEIVSRLSFEWESFELIQSWLLIAF 316

Query: 263 YLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITE-RARRLFW 321
           YLR   R  + W A    I + +  AL+               P R     E + +  FW
Sbjct: 317 YLRTCHRQTSCWNALGSAIRMCKGMALYL-----------NRFPQRHTLYEETKVKNCFW 365

Query: 322 CAWSINSILSYDYGR-SSASLGGISCKLPTKS-DGNY---TAQLVDLALIIPPANTEASK 376
             + ++ ++S+  GR    SL       P ++ DG +   T Q+  L+LII        +
Sbjct: 366 SCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFHEETIQMYRLSLIISDCQKRDGE 425

Query: 377 ETRVAD---LLQALT--LVYETPDEHNFLSLVKADLCNSFYRRLRLFNY-----TLDSEV 426
           +  V +   L Q LT    + TP E             + Y +  LF Y     TL    
Sbjct: 426 DLSVNEVQILKQRLTNWFRFFTPHE-------------TLYSKQVLFTYLDISLTLGIRG 472

Query: 427 VFQL 430
           +FQL
Sbjct: 473 LFQL 476

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 3   TGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
           + + SV  KKR+R  +AC  CR++K +CDG NPC  C  Y+YKC YD+
Sbjct: 55  SNVASVTQKKRRRVTRACDECRKKKVKCDGQNPCIHCTVYSYKCSYDQ 102

>KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 672

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 125/560 (22%), Positives = 202/560 (36%), Gaps = 112/560 (20%)

Query: 11  KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTR 70
           + R R RKAC  C++RK +C+G  PC  C  +   CHY  + +P T PA    +      
Sbjct: 23  RPRIRVRKACGTCKRRKVKCNGQQPCAGCAKHGSVCHY--KVEPVTRPASAALKAGAPGP 80

Query: 71  SISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSR-----------YMGLSSAVA 119
           + + P    V  P    T         A+    F   K R           Y+G +   +
Sbjct: 81  AGTLPALSQVPAPSDFAT-----GPAPASPWQRFSPGKYRFHRRHQNLVPYYLGQALISS 135

Query: 120 FARSLGIELQSANPPHLHSFAWNC-GLRSEEKSNTHCALHDLITKEETFHFTQ------- 171
              +L ++  +   P L  + WN  G    ++ +T  A    + + +     Q       
Sbjct: 136 LPPAL-VQKYALRAPRLQFYGWNMSGGHYLKQGSTFGAPQGTVWRWDLAVELQRQILEKC 194

Query: 172 --IYFSAIHPVFDVVDPEHFKKSVESYWNDGC-----KVSAFGAVVGGI--IALGSLFSG 222
              +F  ++    +V  + F +     + DG          F A++  I  IAL   +SG
Sbjct: 195 ASFFFQHVNRFVSIVHEQAFWQQFRGGFLDGSDGKNGSSDLFEAILNLIAAIALRFSYSG 254

Query: 223 RPGHPRE-----------LEIVQYAKNVLEDPTFSR-----------LPSAEQVSAWVLR 260
                 E           L + ++ ++ LE+  F R             S E + AW+L 
Sbjct: 255 AGASVCEALTAAEVTWLDLHLTRHGRH-LEETLFERAYAVTTRLSFEWESFELIQAWLLA 313

Query: 261 TLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLF 320
            +YLR   R  + W A    + +    +L+      + TA D+           RAR  +
Sbjct: 314 AVYLRTCHRQVSCWQALSRAVQMCNGMSLYLNRFPEKHTAYDEC----------RARNCY 363

Query: 321 WCAWSINSILSYDYGRSSASLG-GISCKLP-TKSDGNYTAQ---LVDLALIIPPANTEAS 375
           W  + ++ ++S+  GR     G G     P T  D  ++A+   L  LA I+        
Sbjct: 364 WACFVLDRLISFQMGRFPELAGPGPDMGSPDTAVDTWFSAESVALYKLAAIVTTCQRRYG 423

Query: 376 KETRVADLLQALTLVYETPDEHNFLSLVKAD--LCNSFYRRLRLFNY-----TLDSEVVF 428
           +E   A+  +   L     + H     V AD  LC     R  L  Y      L+   +F
Sbjct: 424 QELTAAETQE---LGARLDEWHGDCEEVLADPGLCA----RQVLLTYLDVRIALEIRGLF 476

Query: 429 QLTTV----CNHALS----AAYDLVERKL--------------PWWNVLSAPFQYICVLL 466
           QL  V      HAL        DL  R L              PWW  LS  F   C ++
Sbjct: 477 QLLDVGSDTVRHALPLDAVTLVDLASRVLDQFEAIVESGLFFRPWWLNLSLLF--TCSVI 534

Query: 467 AINTSESLANVAKAKNIFDR 486
            +   +    +A+A+ +  R
Sbjct: 535 CLTLVQGGLQLARAQALLSR 554

>KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2.565
           YMR019W
          Length = 608

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/371 (21%), Positives = 147/371 (39%), Gaps = 46/371 (12%)

Query: 14  QRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPA--PLIPE--IPDST 69
           +R R AC  C++RK +CDG  PC  C      C Y +      +PA   ++P   +P   
Sbjct: 7   RRVRAACAVCQRRKLKCDGKQPCSRCARTDRICRYAKVQVQTQMPARASVVPRANVPVGL 66

Query: 70  RSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAFARSLGIELQ 129
              SP      +K             +   D   F   +S    L  +V  A  L +   
Sbjct: 67  GRGSPWLGFSFSK---------FRFHRRYQDVLPFYFCESVLAQLPESVVAAEDLQL--- 114

Query: 130 SANPPHLHSFAWNCGLRSEEKSNTHCALHDLITK---EETFHFTQIYFSAIHPVFDVVDP 186
               P + ++ WN        +    AL    T+    E     Q YF  ++P+F +V+ 
Sbjct: 115 ----PSVQNYGWNLA----GGAFLAFALQPSATRPPLRELRPLVQHYFDHVNPLFSIVNE 166

Query: 187 EHFKKSVESYWNDGCKVSAFGAVVGGIIALGS--LFSGRPGHPRELEIVQYAKNVLEDPT 244
             F     S W+     ++    +G ++A+ +     G P    E  +  ++  V+ + +
Sbjct: 167 RVFW----SQWDSAADANSLFNAIGYLMAITAERYRCGPPPRVDETALFNHSYAVVSEFS 222

Query: 245 FSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKA 304
           F    S E + +W+L   YLR   R  + + A    + +    +L+ E +  ++ A  + 
Sbjct: 223 FE-WESVELIQSWLLIAAYLRCCYRQTSCYAALARAVAMCRGMSLNLEAKPEQVDAEGE- 280

Query: 305 LPPRTKKI--TERARRLFWCAWSINSILSYDYGRSSA---SLGGISCKLPTKSDGNYTA- 358
              +T  +  T +    FW  ++++ I S+  G+  +   S+  +    P + D  +   
Sbjct: 281 ---QTGALHSTGKYYHCFWTVYTVDKIFSHQLGKVGSCPISITKLKPPGPQQQDEWFQGG 337

Query: 359 --QLVDLALII 367
             +++ LALII
Sbjct: 338 SLEMLQLALII 348

>NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON}
           Anc_2.565
          Length = 759

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 93/464 (20%), Positives = 170/464 (36%), Gaps = 101/464 (21%)

Query: 9   PHKKRQRAR--KACVPCRQRKRRCDGANPCGMCVSYAYKCHYD--------EQGDP---- 54
           P +K+QR R  +AC  C++RK +CDG  PC  C+     C Y+        E  DP    
Sbjct: 21  PERKKQRIRVQRACNICKRRKVKCDGNKPCLNCIKKEIDCEYNNSSNTTKKEPNDPPADI 80

Query: 55  -----ATLPAP--LIPEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGV---- 103
                +T+  P  L P++       +     +       + K + ++T    D  +    
Sbjct: 81  DAAESSTMSPPNLLHPQLNKEQSEDNMAVLLLDLAKKLKQKKNIKDTTSLGNDDTIPPRV 140

Query: 104 ----------FDAAKSRYMGLSSAVAFARSLGIELQSANPPHL-----------HSFAWN 142
                     F   K R+      V      G  L SA PP L            ++AWN
Sbjct: 141 TKDTNSPWQSFSYDKYRFHRRYQNV-LPNKFGKSLLSALPPQLIQENNLETPRIQNYAWN 199

Query: 143 CG----LRSEEKSNTHCALHDLITKEETFHFTQI------YFSAIHPVFDVVDPEHFKKS 192
                 L+ E+    + +L      +   H + +      YF  I+  + ++  E F   
Sbjct: 200 MSGGHYLKFEQMHENNSSLL-FFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQ 258

Query: 193 VESYW-----NDGCKVSAFGAVVGGIIALG-SLFSGRPGH-------PRELEIVQ----- 234
             + +      +      F +++  ++ +    + G P         P+E E+V      
Sbjct: 259 FNNGFLQQGKQNNKSAKLFTSMLYLVLTISIRFYEGLPASSLDQLFTPQEQELVHRQRIL 318

Query: 235 --------YAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEA 286
                   +A +++   TF    S E + +W+L   YLR   R  + W A    I++   
Sbjct: 319 RNEEYMFGHAYSIVSKLTF-EWESFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNG 377

Query: 287 SALH-HEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGR-SSASLGGI 344
            +L+ +    V  T ++            +A   FW  + ++ ++S+  GR    S+   
Sbjct: 378 MSLYLNRFPEVHSTYDEV-----------KAWHCFWSCFIMDKLISFQLGRLYQLSMPVT 426

Query: 345 SCKLPTKSDGNY---TAQLVDLALIIPPANTEASKETRVADLLQ 385
           +   PT  D  +   T QL  L+ I+     + ++E  + + LQ
Sbjct: 427 NMNQPTNPDTWFHDETIQLFQLSKIVMDFQKKEAQELDIQESLQ 470

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (65%)

Query: 7  SVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          S P  KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 2  SEPQSKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 938

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 43/84 (51%), Gaps = 7/84 (8%)

Query: 7  SVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPA------TLPAP 60
           V  KKR +  +AC  CR+RK +C GANPC  C +Y  +C Y+ Q  P       +L   
Sbjct: 10 GVIKKKRSKVSRACNNCRRRKIKCTGANPCLNCQTYKCECTYNLQSPPTIGTGDFSLNTR 69

Query: 61 LIPEIPDSTRSISPPRTRMVAKPP 84
           +P +  +   IS P+  + AK P
Sbjct: 70 GVP-LKTAASGISAPKPTIAAKAP 92

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
           PUT3Transcriptional activator of proline utilization
           genes, constitutively binds PUT1 and PUT2 promoter
           sequences as a dimer and undergoes a conformational
           change to form the active state; differentially
           phosphorylated in the presence of different nitrogen
           sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 9   PHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP----LIPE 64
           P K++QR+  AC+ CR+R  +C G NPC  CV+    C Y E      +       L  +
Sbjct: 23  PQKRQQRSSVACLSCRKRHIKCPGGNPCQKCVTSNAICEYLEPSKKIVVSTKYLQQLQKD 82

Query: 65  IPDSTRSISPPRTRMVAKPPSIRTK 89
           + D T   +  +  ++ +P S+R K
Sbjct: 83  LNDKTEENNRLKALLLERPVSVRGK 107

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 3/46 (6%)

Query: 7  SVPHK---KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          +VPH+   KR++  +AC  CR++K +CDG  PC  C  Y+Y+C Y+
Sbjct: 4  TVPHRQEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSYECTYN 49

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 58 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 96

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa]
          {ON} weakly similar to uniprot|P40467 Saccharomyces
          cerevisiae YIL130W ASG1 Proposed transcriptional
          activator member of the Gal4p family of zinc cluster
          proteins and to YJL206C uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 780

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          KR R  +AC  CRQRK RCDG  PC  C  Y+Y C Y+
Sbjct: 24 KRLRVSRACDVCRQRKVRCDGRQPCIHCTVYSYNCTYN 61

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y C Y++
Sbjct: 28 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYNCTYNQ 66

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/368 (22%), Positives = 135/368 (36%), Gaps = 88/368 (23%)

Query: 13  RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD-----------EQGDPATLPAPL 61
           + RA +AC+ CR+RK RC G  PC +C + +Y+C YD           E  D ++L A  
Sbjct: 40  KGRAHRACIACRKRKVRCSGNIPCRLCQTNSYECKYDRPPRNSSVFDREVSDDSSLYAQR 99

Query: 62  IP-EIPDSTRSIS------------PPRT-RMVAKPPSIRTKILLNSTQCAADQGVFDAA 107
              E  DS   IS            PP T R +    S  ++  L++ +    QG  +  
Sbjct: 100 ASHEREDSKGPISSIDYKKVVETIFPPETLRQILASSSFNSQNFLDTIKTCLLQGQLNVN 159

Query: 108 KSRYMGLSSAVAFARSLGIELQSANPPHLHSF-----AWNCGLRSEEKSNTHCALHDLIT 162
           +     L     +     + L    PP   +       W+C           C L     
Sbjct: 160 QVIRQSLPKDTPWHMQTSVPL----PPREIALKFIQKTWDCA----------CVLF---- 201

Query: 163 KEETFHFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSG 222
               F+      S +  +++       +K  + Y  +  K      ++  ++A+G+LFS 
Sbjct: 202 ---RFYHRPTIISILDSIYEA------EKHGKQYTPEQVKTQ---PLIYSVLAVGALFSK 249

Query: 223 R-----PGHPREL---EIVQY---AKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPH 271
                     RE    E  +Y   AKN L+   FS +     + A  + T++L+ +    
Sbjct: 250 EDLSKDSKATREFYTDEGYRYFLEAKNSLD---FSNITDIYSIQAIFMMTIFLQCSANLK 306

Query: 272 AAWLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSI----N 327
           A +    + +  A    LH     V  T     +   TKK      RLFW  + +    N
Sbjct: 307 ACYSFIGIALRAALKEGLHRRSSIVGPT----PIQDETKK------RLFWSVYKLDLYMN 356

Query: 328 SILSYDYG 335
            IL +  G
Sbjct: 357 CILGFPSG 364

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 10 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 48

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 31 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 69

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 73/366 (19%), Positives = 127/366 (34%), Gaps = 83/366 (22%)

Query: 13  RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE------------QGDPATLPAP 60
           R RA +ACV CR+RK RC G  PC +C + +++C YD               D ++ P  
Sbjct: 51  RGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKYDRPPRNSSVFDREVSDDSSSYPQS 110

Query: 61  LIPEIPDSTRS-------------ISPPRT-RMVAKPPSIRTKILLNSTQCAADQGVFDA 106
           +  +  +  RS             I PP     +   PS   +  L++ +    QG  + 
Sbjct: 111 IPHQEGEDKRSSTCTINYKNIVETIFPPEILHQIVTSPSFNNQFFLDTIKTYLLQGQLNV 170

Query: 107 AKSRYMGLSSAVAFARSLGIELQSANPPHLHSF-----AWNCGLRSEEKSNTHCALHDLI 161
                  L     +     + L    PP   +       W+C           C L    
Sbjct: 171 NHVIRQSLPKDAPWHMKTSVPL----PPREIALKFIQKTWDCA----------CVLF--- 213

Query: 162 TKEETFHFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFS 221
                F+      S +  +++       +K  + Y  +  K      ++  ++A+G+LFS
Sbjct: 214 ----RFYHRPTIISILDSIYEA------EKLGKKYTPEQVKTQ---PLIYSVLAVGALFS 260

Query: 222 GR-----PGHPREL---EIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAA 273
                      RE    E  +Y     +   FS +     + A  + T++L+ +    A 
Sbjct: 261 KEDLSKDSRATREFYTDEGYRYFLEAKKSLDFSNITDIYSIQAIFMMTIFLQCSANLKAC 320

Query: 274 WLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSI----NSI 329
           +    + +  A    LH +   V  T  +           E  +RLFW  + +    N I
Sbjct: 321 YSFIGIALRAALKDGLHRKSSIVGPTPIED----------ETKKRLFWSVYKLDLYMNCI 370

Query: 330 LSYDYG 335
           L +  G
Sbjct: 371 LGFPSG 376

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
          YJL206C (REAL)
          Length = 833

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          R RA +ACV CR+RK RC G  PC +C + +++C YD
Sbjct: 27 RGRAHRACVACRKRKVRCSGQTPCRLCQNNSFECKYD 63

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
            KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 5  QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
            KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 10 QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 50

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
            KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y++
Sbjct: 5  QNKRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYNQ 45

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDS 68
          P  KR+    AC+ CR+R  +C G NPC  C+ +  KC Y E      +    + ++ DS
Sbjct: 18 PSSKRRPKSLACILCRKRHIKCSGGNPCARCIKHDLKCEYIEPSKKIVVSLKYLQQLQDS 77

Query: 69 TRSISPPRTRM 79
            ++     R+
Sbjct: 78 LANMKRENVRL 88

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDP 54
          R R  KAC+ CR++KRRCDG +PC  C   +  C Y     P
Sbjct: 25 RLRVFKACIACRKKKRRCDGKSPCSHCARTSIICEYTNTARP 66

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
            KR+R  +AC  CR++K +CDG  PC  C  Y Y+C Y++
Sbjct: 4  QNKRRRVTRACDECRKKKVKCDGKQPCIHCTVYNYECTYNQ 44

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y+
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 66

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 81/391 (20%), Positives = 143/391 (36%), Gaps = 77/391 (19%)

Query: 16  ARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSISP 74
            ++AC  CR+RK RC    P C  C+ + ++C Y     P  + +PL     +       
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCY----SPKAVRSPLTRVHLNYVEKKLA 60

Query: 75  PRTRMVAKP-PSIRTKILLNSTQCAADQGVFDAAKSRYM-GLSSAVAFARSLGIELQSAN 132
              R+  +  P I  +  L        + +  +A S  + G    +  A++L   +    
Sbjct: 61  TLERLFHELFPGIDPEKALQGKSSQNLRELIGSATSNSIPGNKDEITTAKTLVKPMHQPQ 120

Query: 133 PPH-------LHSFAWNCGLRSEEKSNTHCAL------------------------HDLI 161
            P        L+ F W     S  K +  CAL                        +D+ 
Sbjct: 121 LPQDEIPDDPLYGFDWIEEDDSVHKDDGMCALNINPNHKGYFGLGSSTVLLRSLKVNDIA 180

Query: 162 TK--------EETF---------HFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVS 204
            K        +ET+          F   YFS  H  +  +  E F     + + D  + S
Sbjct: 181 PKLQRVPSIVKETYSLSAKYVTSKFIDAYFSQYHTTYPFIHKETFM----AQYKDQLRPS 236

Query: 205 A---FGAVVGGIIALGSLFSGRPGHPRELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRT 261
           +   +  ++  ++ALG           ++   Q AK+ L    F    S   V A  L +
Sbjct: 237 SMDIWQILLNTVLALGCWCINGESSDIDIYYYQNAKSYLSSVVF-ETGSVSLVVALTLLS 295

Query: 262 LYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFW 321
            Y++   +P++ W    +   +A +  LHHE   +E T            + E+ RR++W
Sbjct: 296 SYVQKRNKPNSGWNYLGLATRMAISLGLHHEFPKMEET------------LLEQRRRVWW 343

Query: 322 CAWSINSILSYDYGR--SSASLGGISCKLPT 350
             ++++  +S  YGR  +   L  I   LP+
Sbjct: 344 GTYTLDCAVSITYGRPINLPPLNNIDVGLPS 374

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTY 49

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          KR+R  +AC  CR++K +CDG  PC  C  Y+Y+C Y+
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYN 66

>KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}
          Anc_1.128 YJL206C
          Length = 663

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPAT 56
          K QR R AC  CR++KR+CDG  PC  C    Y+C Y      +T
Sbjct: 27 KEQRVRTACSMCRRKKRKCDGRVPCSFCTKNHYQCIYKNASHGST 71

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1192

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K+R +  KAC  CR+RK +C+G NPC  C +Y  +C Y
Sbjct: 19 KQRNKVSKACQSCRRRKIKCNGINPCSNCTTYECECIY 56

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 76/366 (20%), Positives = 122/366 (33%), Gaps = 83/366 (22%)

Query: 13  RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD----------------------- 49
           R RA +AC+ CR+RK RC G  PC  C +   +C YD                       
Sbjct: 60  RGRAHRACMACRKRKVRCSGQIPCRFCHTNKLECTYDRPPRKPPVFGRELSDDNSLYSQG 119

Query: 50  --EQGDPATLPAPLIPEIPDSTRSISPPRT-RMVAKPPSIRTKILLNSTQCAADQGVFDA 106
             +QGD  T  +    +      +I PP     +   PS   +I L + +  + QG  D 
Sbjct: 120 TSQQGDVRTTSSQSTIDYRSIVEAIIPPEALHQIVTSPSFNNEIFLETVKAYSLQGQLDV 179

Query: 107 AKSRYMGLSSAVAFARSLGIELQSANPPHLHSF-----AWNCGLRSEEKSNTHCALHDLI 161
                  L     +     I L    PP   +       W+C           C L    
Sbjct: 180 NSIIRESLPKNTPWRIKTNIPL----PPRDIALKFIQKTWDCA----------CVLF--- 222

Query: 162 TKEETFHFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLF- 220
                F+      S +  ++        +K  + Y  +  K      ++  ++A+G+LF 
Sbjct: 223 ----RFYHRPTIISILDSIYAA------EKLGKEYTPEQVKTK---PLIYSVLAVGALFS 269

Query: 221 ----SGRPGHPREL---EIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAA 273
               S      RE    E  +Y         FS +     + A  + T++L+ +    A 
Sbjct: 270 KDDLSKDSNATREFYTDEGYRYFLEAKRSLDFSNITDIYSIQAIFMMTIFLQCSANLKAC 329

Query: 274 WLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSI----NSI 329
           +    + +  A    LH +           A+   TKK      RLFW  + +    N I
Sbjct: 330 YSFIGIALRAALKEGLHRKSS----ITGPTAIQDETKK------RLFWSVYKLDLYMNCI 379

Query: 330 LSYDYG 335
           L +  G
Sbjct: 380 LGFPSG 385

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
          similar to uniprot|P50104 Saccharomyces cerevisiae
          YMR019W STB4 Protein that binds Sin3p in a two- hybrid
          assay
          Length = 912

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          + R R RKAC  C++RK +CDG+ PC  CV +  +C Y
Sbjct: 8  RNRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECKY 45

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 228 RELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEAS 287
           RE  + +YA +V+   TF    S E + +W+L T Y R   R  A W A    I++    
Sbjct: 342 REEAMFKYAYSVITQLTF-EWESFELIQSWLLITFYFRTCYRQTACWNALGQAINMCNGM 400

Query: 288 ALHHEVENVELTANDKALPPRTKKITE-RARRLFWCAWSINSILSYDYGR 336
           +L+               P    K  E RA   FW  + ++ ++S+  GR
Sbjct: 401 SLYL-----------NRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGR 439

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON}
          Anc_2.565 YMR019W
          Length = 707

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          K+R R +KAC  C++RK +CDG +PC  C+ +   C YD
Sbjct: 7  KQRLRVQKACDICKRRKVKCDGLSPCSNCIRHNVDCTYD 45

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 55/113 (48%), Gaps = 13/113 (11%)

Query: 226 HPRELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAE 285
           H +E ++  Y+ +++   TF    S E + +W+L T YLR   R  A W A    + + +
Sbjct: 311 HDKEGKLFNYSYSIVSKLTF-EWESFELLQSWLLITFYLRTCHRQIACWSALGKAVTMCK 369

Query: 286 ASALH-HEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRS 337
             +LH +++  +  + ND+           +A   FW  + ++ ++S+  GR+
Sbjct: 370 GMSLHLNQLPEIH-SENDRI----------KAWNCFWAVFIMDKLISFQIGRA 411

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
          to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
          weakly similar to YAL051W uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 975

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD-EQGDPATLPA 59
          KRQR    C  CR+ K +CD   P CG CV Y  KC YD EQ  P  +P+
Sbjct: 27 KRQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVYDVEQQKPPRVPS 76

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 51/102 (50%), Gaps = 13/102 (12%)

Query: 13  RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSI 72
           R++  KAC  CR+RK +C G  PC  C +Y  +C +D+  + ++ P+     +  +T+ +
Sbjct: 30  RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDLKEDSSNPST----VGGTTQKV 85

Query: 73  SPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGL 114
           +  + +   K          ++ + A+ Q  FD   S ++G+
Sbjct: 86  TKTKRKSHTKK---------HNEEAASQQLKFDETNSVHVGI 118

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGD 53
          +  + R++  KAC+ CR+RK +C G  PC  C +Y  +C +DE  D
Sbjct: 5  IVKRPRKKVVKACLNCRRRKIKCTGTFPCSNCAAYQCECVFDETKD 50

>YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putative
           transcription factor; contains a Zn(II)2Cys6 zinc finger
           domain characteristic of DNA-binding proteins;
           computational analysis suggests a role in regulation of
           expression of genes encoding transporters; binds Sin3p
           in a two-hybrid assay;
          Length = 949

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 27/48 (56%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
           ST       K R R +KAC  C++RK +CDG NPC  C  +  +C YD
Sbjct: 69  STAASKENGKGRLRVQKACELCKKRKVKCDGNNPCLNCSKHQKECRYD 116

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/260 (18%), Positives = 95/260 (36%), Gaps = 63/260 (24%)

Query: 126 IELQSANPPHLHSFAWNCG----------LRSEEKSNTHCALHDLITKEETFHFTQI--- 172
           IE      P + ++ WN             RS+EK+  H +       ++  H + I   
Sbjct: 343 IEYAKLKRPRVQNYGWNLSGGHYLKYKGDFRSQEKNIRHES--KFFDFDDPVHLSLINKL 400

Query: 173 ---YFSAIHPVFDVVDPEHF-KKSVESYWNDGCKVSAFGAVVGGII--ALGSLFSGRPGH 226
              YF  I+PVF ++    F ++    +   G + ++   +   ++   L +    R GH
Sbjct: 401 LRYYFDEINPVFSIIHEATFWQQYNNKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGH 460

Query: 227 -----------------------------PRELEIVQYAKNVLEDPTFSRLPSAEQVSAW 257
                                          E  + +YA  ++   TF    S E + +W
Sbjct: 461 LDGQKGQGTYSNTSLNITFEEKSILIKKPSIEENLFKYAYLIINTLTF-EWESFELIQSW 519

Query: 258 VLRTLYLRATTRPHAAWLASCVTIHLAEASALH-HEVENVELTANDKALPPRTKKITERA 316
           +L T Y R   R  A W A    +++    +L+ ++   +  T ++            +A
Sbjct: 520 LLITFYFRTCYRQTACWNALSQAVNMCNGMSLYLNKFPEIHSTYDES-----------KA 568

Query: 317 RRLFWCAWSINSILSYDYGR 336
              FWC + ++ ++S+  GR
Sbjct: 569 WHCFWCCFIMDKLISFQMGR 588

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          +   R  +AC  CR+RK +C+G  PC  C++   +CHYD
Sbjct: 15 RSSHRVSRACNSCRKRKVKCNGVQPCSKCITSNLRCHYD 53

>NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {ON}
           Anc_2.565
          Length = 803

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 52/115 (45%), Gaps = 22/115 (19%)

Query: 8   VPHKKRQRAR--KACVPCRQRKRRCDGANPCGMCVSYAYKCHY-------DEQGDPATLP 58
           V +K RQR R  +AC  C++RK +CDG  PC  C+  +  C Y       + +  P+  P
Sbjct: 11  VTNKNRQRLRVQRACAICKKRKVKCDGMKPCSNCIKRSKDCTYTTAYKIPNMKYSPSLSP 70

Query: 59  APLI--------PEIPDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFD 105
           +           P  PD++  I     R+  K  +  TKIL N+ +   +  V D
Sbjct: 71  SSKTHSVSIENSPAAPDASLDI-----RLHQKKANHVTKILRNTERKPEEALVID 120

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 66/162 (40%), Gaps = 27/162 (16%)

Query: 229 ELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASA 288
           E  +  Y+ +++   TF    S E + +W+L T YLR   R  ++W A    I+L    +
Sbjct: 380 EDSMFNYSYSIISKLTF-EWESFELIQSWLLITFYLRTCYRQTSSWHALGQAINLCNGMS 438

Query: 289 LHHEVENVELTANDKALPPRTKKITERARRLFWCAWS---INSILSYDYGRSS-ASLGGI 344
           LH               P    K  E   +LF C W+   I+  +S+  GR     L   
Sbjct: 439 LHL-----------NEFPHIHSKYEE--SKLFHCFWACFIIDKFISFQLGRFYLLPLPIH 485

Query: 345 SCKLPTKS----DG-----NYTAQLVDLALIIPPANTEASKE 377
             + P++S    DG       T QL  L+LII       ++E
Sbjct: 486 HMEFPSESNRCNDGTDWFSKETIQLFHLSLIIMELQNRNAEE 527

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTR 70
          KK++R + AC+ CR+R  +C   NPC  C+    KC Y E      +    +  + DS  
Sbjct: 25 KKQKRQQIACLECRKRHIKCPNGNPCFKCLKNNLKCEYIEPSRKIVISMKYLSNLQDSLV 84

Query: 71 SISPPRTRM 79
           +     R+
Sbjct: 85 DLKRENVRL 93

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 27/39 (69%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CD  +PC  C  Y+Y+C Y++
Sbjct: 14 KRRRITRACDECRKKKVKCDNRHPCIHCTVYSYECTYNQ 52

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 27/39 (69%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KR+R  +AC  CR++K +CD  +PC  C  Y+Y+C Y++
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHCTVYSYECTYNQ 48

>TDEL0H00790 Chr8 complement(132519..135002) [2484 bp, 827 aa]
          {ON} Anc_1.199 YKR064W
          Length = 827

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYK--CHY--DEQGDPATLPAPLIPE 64
          P +KR R    C  CR+RK +CD   PCG CV    K  C Y  + +GD  ++   +  +
Sbjct: 11 PVRKRNRLTVVCSNCRRRKSKCDRQTPCGNCVRLGDKDTCVYIKEAKGDRNSMDLRITKK 70

Query: 65 IPDSTRSISPPRTR 78
          +P S R  S   T+
Sbjct: 71 LPTSKRKNSVTNTK 84

>TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.56
           YOR337W
          Length = 840

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
           +T +PS    KR   R AC  CR+R+++CD   PCG CV Y   C+ +E+
Sbjct: 79  TTILPSTTGVKR---RLACSSCRRRRKKCDMQYPCGNCVHYKDSCNINEE 125

>KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa]
          {ON} similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206C and some similarities with YIL130W
          uniprot|P40467 Saccharomyces cerevisiae YIL130W ASG1
          Proposed transcriptional activator member of the Gal4p
          family of zinc cluster proteins
          Length = 650

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDP 54
          R + + AC  C++RK RCDG +PC  C++   KC Y     P
Sbjct: 29 RHKVKHACSSCKERKVRCDGQSPCASCINARVKCEYVMNMKP 70

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 12  KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           KR R    C  CR+RK RCD  NPC  CV+ + +C Y
Sbjct: 67  KRNRVSYVCYACRRRKTRCDRGNPCSKCVALSTECVY 103

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 aa]
           {ON} YKL015W (REAL)
          Length = 985

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 10  HKKRQRARK----ACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
           HK+RQR +     AC+ CR+R  +C G NPC  C++    C Y E      +    + ++
Sbjct: 20  HKQRQRKQPRSAVACLSCRKRHIKCPGGNPCQKCITSNAICEYLEPSKKIVVSTKYLQQL 79

Query: 66  P----DSTRSISPPRTRMVAKPPS 85
                D TR  S  R  ++ K  S
Sbjct: 80  QNDLNDKTRENSRLRALLLEKTNS 103

>Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W
           (REAL)
          Length = 1010

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 8   VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKC----HYDEQGDPATLPAP 60
           V    R +   ACV CR+RK +C G +PC  C+SY   C     Y  QG  A  P P
Sbjct: 44  VKKSTRSKVSTACVNCRKRKIKCTGKHPCTNCISYDCTCVFLKRYLPQGKDAPQPFP 100

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60
          K + + ++AC  CR+RK RCDG  PC  CVS   +C+Y    D A +  P
Sbjct: 4  KHKAKVKRACQICRRRKIRCDGYLPCSSCVSLKKECNYH---DSAGIKKP 50

>KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa]
          {ON} Anc_8.283 YLR098C
          Length = 664

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 17 RKACVPCRQRKRRCDGANPCGMCVSYAYKC 46
          R AC+ CRQR+R+CD   PC +C+ +  +C
Sbjct: 16 RLACITCRQRRRKCDMQEPCSICIKFGTRC 45

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP 63
           ++KR R    C  CR+ K +CD   P CG C+ +  KC Y    D +  PAP IP
Sbjct: 56  NRKRNRISFVCQACRKSKTKCDREKPECGRCIKHGLKCVY----DVSKQPAPRIP 106

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP 63
           ++KR R    C  CR+ K +CD   P CG CV +  KC Y    D +  PAP IP
Sbjct: 56  NRKRNRILFVCQACRKSKTKCDREKPECGRCVKHGLKCVY----DVSKQPAPRIP 106

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa]
          {ON} Anc_4.113 YGL013C
          Length = 995

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          K R + R+AC  CR+RK +C G  PC  C +Y+  C Y E
Sbjct: 14 KPRIKVRQACDNCRKRKLKCTGKQPCSTCEAYSCDCIYSE 53

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          K+++R+  ACV CR+R  +C G NPC  C++    C Y E
Sbjct: 39 KRQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIACEYIE 78

>Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019W
          (REAL)
          Length = 894

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          K R R +KAC  C++RK +CDG  PC  C  +  +C YD
Sbjct: 23 KTRLRVQKACELCKKRKVKCDGNKPCLNCSKHQKECRYD 61

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 60/300 (20%), Positives = 118/300 (39%), Gaps = 70/300 (23%)

Query: 218 SLFSGRPGHPRELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLAS 277
           S+ +G+P    E  + +YA +++   TF    S E + +W+L   Y R   R  A W A 
Sbjct: 426 SVLNGKPF--IEEMMFEYAYSIINTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNAL 482

Query: 278 CVTIHLAEASALH-HEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGR 336
              +++     L+ ++   +  T ++            +A   FWC + ++ ++S+  GR
Sbjct: 483 SQAVNMCNGMTLYLNKFPEIHSTYDES-----------KAWHCFWCCFIMDKLISFQTGR 531

Query: 337 ----------SSASLGGISCKLPTKSDGNY----TAQLVDLALIIPPANTEASKETRVAD 382
                         +  +  K   + + ++    T Q++DL++I+       +++  +++
Sbjct: 532 FYQLSLPVNEMFEQMNLVKSKKFLQDEDDWFHKETFQMLDLSIIVTRFLKRDAQDLNLSE 591

Query: 383 LLQ---ALTLVYET-----------PDEHNFLSL----VKADLCNSFYRRLRLF------ 418
            +Q    L   Y T            + H F  L       D+  +F  R +LF      
Sbjct: 592 TIQLRGQLAQWYNTFMADKDIDAYDKNYHGFYQLQPLMTYLDISLTFEIR-QLFCLVAPS 650

Query: 419 --------NYTLDSEVVFQLTTVCNHALSAAYDLVERKL---PWWNVLSAPF--QYICVL 465
                    Y +D+++   L + C  A     ++  R L   PWW  LS  F    IC++
Sbjct: 651 SNVNGKSLEYAVDTQL---LVSHCQTAADNLINITRRNLFFVPWWLNLSQLFTVNLICII 707

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
          (PDR1) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
          FULL
          Length = 924

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP 60
          V  KKR +  +AC  CR+RK +C GA PC  C +Y  +C Y       ++P+P
Sbjct: 7  VVKKKRSKVSRACNNCRRRKIKCTGAQPCLNCQTYRCECTY-------SIPSP 52

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 5/80 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKC---HYDEQGDPAT--LPAPLIPEI 65
          K++++A  AC  CR ++R+CD   PC  C+ Y  +C   + D++    T      L  EI
Sbjct: 8  KRKRKAHLACQNCRIKRRKCDMERPCSNCLKYGIECITVNNDKRTKRTTHEYVEKLEAEI 67

Query: 66 PDSTRSISPPRTRMVAKPPS 85
           D  RSI   ++  +   PS
Sbjct: 68 DDLKRSIEKMKSETLEGTPS 87

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          ++++RA  AC+ CR+R  RC G NPC  CVS    C Y E
Sbjct: 48 ERKKRAPLACLRCRKRHVRCPGGNPCSKCVSANIACEYLE 87

>NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {ON}
           Anc_1.199
          Length = 995

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 19/75 (25%)

Query: 6   PSVPHKKRQRARKACVPCRQRKRRCDGANPCGMC--VSYAYKCHYDEQGDPATLPAPLIP 63
           P+ P +KR R+   C  C++RK +CD + PCG C  +     C Y             IP
Sbjct: 58  PNQPSRKRHRSTVVCTNCKKRKSKCDRSRPCGTCKRLGDGNSCFY-------------IP 104

Query: 64  EIPDSTRSISPPRTR 78
           E+P     + P ++R
Sbjct: 105 EVP----KVKPSKSR 115

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 7/71 (9%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ-------GDPATLPAPLI 62
            K   +  KAC  CR+RK +C G  PC  C +Y   C Y  Q        + A +  P I
Sbjct: 38  RKPTNKVSKACDNCRKRKIKCTGKQPCATCEAYQCPCIYSTQKRKTSKRNNTAKMEQPEI 97

Query: 63  PEIPDSTRSIS 73
           P  P+S  + S
Sbjct: 98  PNGPNSVETNS 108

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
          PDR1Zinc cluster protein that is a master regulator
          involved in recruiting other zinc cluster proteins to
          pleiotropic drug response elements (PDREs) to fine tune
          the regulation of multidrug resistance genes
          Length = 1068

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 1  MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           STG      K R +  KAC  CR+RK +C+G  PC  C  Y+ +C +
Sbjct: 27 FSTGFSGKIRKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 74

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 2  STGIP-SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQG 52
          +T IP + P KKR R   +C  CR+RK +CD   P C  C     A+ CHY EQ 
Sbjct: 4  TTTIPGAAPKKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQN 58

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP 63
           ++KR R    C  CR+ K +CD   P CG C  +  KC Y    D +  PAP IP
Sbjct: 56  NRKRNRISFVCQACRKSKTKCDREKPECGRCTKHGLKCVY----DVSKQPAPRIP 106

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1030

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATL 57
          +K R + R+AC  CR+RK +C G +PC  C +Y   C +  +G    +
Sbjct: 25 NKPRNKVRRACNNCRKRKIKCTGLHPCASCEAYGCPCIFSPRGKGGNI 72

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 aa]
           {ON} YKL015W (REAL)
          Length = 976

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 18/116 (15%)

Query: 12  KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAP----LIPEIPD 67
           ++QR+  AC+ CR+R  +C G NPC  CV+    C Y E      +       L  E+ D
Sbjct: 26  RQQRSSIACLSCRKRHIKCPGGNPCQKCVASNAICEYLEPSKKIVVSTKYLQQLQKELND 85

Query: 68  STRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVF----DAAKSRYMGLSSAVA 119
            T+  +  R  ++ K  +           C  D G      +AA S  + +SSA A
Sbjct: 86  KTQENNRLRGLLLEKAVN----------ACCKDNGTGKHPNNAATSDTLEVSSAPA 131

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar
          to uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor
          Length = 1107

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          P  +R +  KAC  CR+RK +C+G  PC  C  Y  +C Y
Sbjct: 20 PSTRRTKVGKACDSCRRRKIKCNGLKPCPSCTIYGCECTY 59

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYK--CHY-----DEQGDPATLPA 59
          +P KKRQR    C  C++RK RCD   P CG C+    +  CHY     ++ GD    P 
Sbjct: 2  MPLKKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLGNRETCHYFISPSEKGGDGGDSPG 61

>KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654
           YKL015W
          Length = 896

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 7   SVPHKKRQRAR--KACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
           S   KK  R+R   ACV CR+R  +C G NPC  C++    C Y E
Sbjct: 61  SKKEKKANRSRLPVACVACRRRHSKCPGGNPCSKCIAANLTCEYIE 106

>YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}
          PDR3Transcriptional activator of the pleiotropic drug
          resistance network, regulates expression of ATP-binding
          cassette (ABC) transporters through binding to
          cis-acting sites known as PDREs (PDR responsive
          elements); post-translationally up-regulated in cells
          lacking a functional mitochondrial genome
          Length = 976

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 12/78 (15%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPD 67
          V    R +   ACV CR+RK +C G  PC  C+SY   C + ++          +P+  D
Sbjct: 3  VKKSTRSKVSTACVNCRKRKIKCTGKYPCTNCISYDCTCVFLKKH---------LPQKED 53

Query: 68 STRSISPPRTRMVAKPPS 85
          S++S+    T  VA P S
Sbjct: 54 SSQSLP---TTAVAPPSS 68

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
          weakly similar to uniprot|P33200 Saccharomyces
          cerevisiae YBL005W PDR3 Transcriptional activator of
          the pleiotropic drug resistance network regulates
          expression of ATP-binding cassette (ABC) transporters
          through binding to cis-acting sites known as PDREs (PDR
          responsive elements)
          Length = 940

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 7  SVPH-------KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPA 59
          SVPH       K   +  +AC  CR+RK +C G  PC  C +Y   C Y  +     +PA
Sbjct: 8  SVPHMPPKRVTKSSSKVSRACDNCRRRKIKCTGKQPCSNCQAYQCHCEYSIRRGNGIIPA 67

Query: 60 PLIPE 64
             P+
Sbjct: 68 TTPPK 72

>KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa]
          {ON} conserved hypothetical protein
          Length = 701

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQG 52
          KR R+R  C  CR R+++CD  +P CG C  +  KC +  +G
Sbjct: 25 KRNRSRAGCFTCRLRRKKCDEVHPKCGTCTKHVLKCIWPRKG 66

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/80 (18%), Positives = 41/80 (51%)

Query: 12  KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRS 71
           K+++  +AC+ CR+R  +C G +PC  C+   + C + E      +    + ++ D+ ++
Sbjct: 51  KKRKITRACIRCRERHIKCPGNDPCQKCLEANHICKFSEPNKKVIVSINYLTKLHDNIKT 110

Query: 72  ISPPRTRMVAKPPSIRTKIL 91
           +    + +  +   ++ K++
Sbjct: 111 LEDENSSLKLEVNKLKNKLI 130

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911
          aa] {ON} YMR019W (REAL)
          Length = 911

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          + R R +KAC  C++RK +CDG  PC  C  +  +C YD
Sbjct: 37 RGRLRVQKACEICKRRKVKCDGNRPCLNCSKHKKECRYD 75

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/260 (18%), Positives = 93/260 (35%), Gaps = 63/260 (24%)

Query: 126 IELQSANPPHLHSFAWNCG----LRSEEKSNTHCALHDLITKEETF-------------H 168
           IE      P + ++ WN      L+ +E+  +H   +  I+ E  F              
Sbjct: 304 IEYAKLKRPRVQNYGWNLSGGHYLKYKEEFKSH---NKQISNESKFFNFDDPVHLFLVNK 360

Query: 169 FTQIYFSAIHPVFDVVDPEHF-KKSVESYWNDGCKVSAFGAVVGGII--ALGSLFSGRPG 225
             + YF  I+PVF ++    F ++    +   G + ++   +   ++   L +    R G
Sbjct: 361 LLRYYFDEINPVFSIIHEATFWQQYNNKFLRQGKQNNSSAKLFTSMLYLILSTTLRFREG 420

Query: 226 H-----------------------------PRELEIVQYAKNVLEDPTFSRLPSAEQVSA 256
           H                               E ++ +YA +++   TF    S E + +
Sbjct: 421 HLDGQKGEGINSESSLNITLEEESVLVKRPSIEEKMFKYAYSIINTLTF-EWESFELIQS 479

Query: 257 WVLRTLYLRATTRPHAAWLASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERA 316
           W+L   Y R   R  A W A    +++    +L+           +K     +     +A
Sbjct: 480 WLLIAFYFRTCYRQTACWNALSQAVNMCNGMSLYL----------NKFPEIHSSYDESKA 529

Query: 317 RRLFWCAWSINSILSYDYGR 336
              FWC + ++ ++S+  GR
Sbjct: 530 WHCFWCCFIMDKLISFQMGR 549

>Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON}
          [contig 161] FULL
          Length = 755

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQG 52
          KR R+R  C  CR R+++CD A P CG C  +  KC +  +G
Sbjct: 24 KRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIWPRKG 65

>Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar to
          Saccharomyces cerevisiae YBL005W
          Length = 943

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQG 52
          K + + ++AC  CR+RK +C G  PC  CV+Y   C Y   G
Sbjct: 7  KSQLKIKRACDNCRRRKIKCTGTQPCACCVAYQCGCVYSSGG 48

>ZYRO0D02090g Chr4 complement(167354..169882) [2529 bp, 842 aa]
          {ON} similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W Hypothetical ORF
          Length = 842

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 1  MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYK--CHY 48
          +S  +     ++R R    C  C++RK +CD  NPC  CV +  K  CHY
Sbjct: 3  LSQDVRGASVRRRNRPTVVCTNCKRRKSKCDRQNPCSNCVRFGNKDTCHY 52

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGD 53
          VP KKR R    C+ CR+RK +CD   P C  C+     C Y E  D
Sbjct: 9  VPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTD 55

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDS 68
           ++KR R    C  CR+ K +CD   P C  C+ +  KC YD    PA       P IP  
Sbjct: 56  NRKRNRISFVCQACRKSKTKCDREKPECSRCIKHGLKCVYDVSKQPA-------PRIPSK 108

Query: 69  TRSIS 73
              IS
Sbjct: 109 DAIIS 113

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYK-CHYDEQGD-----PATLPAPLIP 63
          +KR R  K+C  CR RK +CD   P C  CV +  K C YD++       P +  A  +P
Sbjct: 17 RKRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISDKRVPVSELANAVP 76

Query: 64 EIPDST 69
           I DS+
Sbjct: 77 RISDSS 82

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa]
          {ON} 
          Length = 1136

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 8/68 (11%)

Query: 7  SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
          ++  KKR R    C  CR+ K +CD   P C  C+    KC YDE+  P        P I
Sbjct: 37 NIQLKKRNRISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEERQPR-------PRI 89

Query: 66 PDSTRSIS 73
          P+   +I+
Sbjct: 90 PNKDATIA 97

>Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920
          aa] {ON} YMR019W (REAL)
          Length = 920

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          + R R +KAC  C++RK +CDG  PC  C  +  +C Y+
Sbjct: 48 RGRLRVQKACELCKKRKVKCDGNKPCLNCFKHQKECRYE 86

 Score = 38.5 bits (88), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 49/109 (44%), Gaps = 13/109 (11%)

Query: 229 ELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASA 288
           E  + +YA +++   TF    S E + +W+L   Y R   R  A W A    +++    +
Sbjct: 460 EERMFKYAYSIISTLTF-EWESFELIQSWLLIAFYFRTCYRQTACWNALSQAVNMCNGMS 518

Query: 289 LH-HEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGR 336
           L+ ++   +  T ++            +A   FWC + ++ ++S+  GR
Sbjct: 519 LYLNKFPEIHSTYDE-----------SKAWHCFWCCFIMDKLISFQMGR 556

>Kpol_1059.26 s1059 complement(57391..58653) [1263 bp, 420 aa]
          {ON} complement(57391..58653) [1263 nt, 421 aa]
          Length = 420

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCV--SYAYKCHYDEQGDPATLPAPL 61
          K+R+++ KACV CR+    C+G  PC  C+    ++ C+Y+E+G+ A++   L
Sbjct: 6  KERRKSYKACVFCRRSHLVCNGQRPCERCIKRDISHLCNYEERGNSASVAENL 58

>Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098C
          (REAL)
          Length = 644

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%)

Query: 19 ACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGD 53
          AC  CR+RKR+CDG  PC  C      C YD Q D
Sbjct: 11 ACNTCRKRKRKCDGRKPCYYCSRGKTHCVYDPQND 45

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 11  KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
           K+R+    AC  C++R++RCDG  P CG CV+   +C + ++     LP   I  +
Sbjct: 58  KRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDYIDRL 113

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
          YER184C (REAL)
          Length = 170

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          ++  R  KAC  CR++K +CD   PC  C+    KC Y  Q
Sbjct: 9  RQGSRVSKACERCRRKKVKCDSKKPCFGCIGSQSKCRYKNQ 49

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPD 67
          +KR++  KACV CR+RK +CD   P C  C S    C Y  Q +     A L    P+
Sbjct: 5  RKRRKIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNCIYTNQYNFDLSDAELFANQPN 62

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 26/54 (48%), Gaps = 5/54 (9%)

Query: 11  KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP 63
           KKR R    C  CR+ K +CD   P C  CV    KC Y    D A  PAP IP
Sbjct: 60  KKRNRISFVCQECRKAKTKCDKEKPYCTRCVKQNIKCIY----DVAEQPAPRIP 109

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
           YKL015W
          Length = 1041

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 34/78 (43%), Gaps = 5/78 (6%)

Query: 5   IPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPE 64
           +P +P     R   AC+ CR+R  +C   NPC  CV    +C Y E      +    +  
Sbjct: 30  VPPIP-----RKSNACIQCRRRHVKCPNGNPCLRCVKSKLQCEYSEPSRKIVVSLSYLQN 84

Query: 65  IPDSTRSISPPRTRMVAK 82
           + DS  ++     ++ ++
Sbjct: 85  LQDSIITLKKNNLKLQSQ 102

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPL-IPEIPDST 69
          +R R    C+PC+ RK +CD   P C  C   + +C Y  + +P+ L  P    E+PD  
Sbjct: 8  RRPRPSFVCIPCKSRKLKCDRLRPVCTRCRKTSKQCTY--ENEPSLLKTPRSTMEVPDKG 65

Query: 70 RSISPPRTR 78
          R  S   TR
Sbjct: 66 RHCSVQGTR 74

>Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R +   AC+ CR+RK +C G +PC  C+SY   C +
Sbjct: 8  RSKVSTACINCRKRKIKCTGKHPCTNCISYNCTCVF 43

>SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 912

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPA 55
          KR R    C  CR+RK +CD   P C  C+    KC YD +  P 
Sbjct: 10 KRNRFSFVCTACRKRKSKCDKTKPICNKCLEQGTKCVYDFEQQPT 54

>YKR064W Chr11 (562547..565138) [2592 bp, 863 aa] {ON}
          OAF3Putative transcriptional repressor with
          Zn(2)-Cys(6) finger; negatively regulates transcription
          in response to oleate levels, based on mutant phenotype
          and localization to oleate-responsive promoters; the
          authentic, non-tagged protein is detected in highly
          purified mitochondria in high-throughput studies
          Length = 863

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 4/56 (7%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYA--YKCHY--DEQGDPATLPA 59
          V  KKR R    C  C++RK +CD   PCG CV       C Y  D  G P + P+
Sbjct: 7  VRTKKRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCVYLTDSSGQPESSPS 62

>KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 820

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K  +RA +AC+ CR+RK +C G +PC  C +Y   C Y
Sbjct: 9  KPAERAARACLNCRRRKVKCSGQSPCANCRNYNCACTY 46

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa]
          {ON} YGL013C (REAL)
          Length = 1069

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 1  MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           + G+     K R +  KAC  CR+RK +C+G  PC  C  Y+ +C +
Sbjct: 24 FTIGLSGKVRKPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 71

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R+R  KAC  CR +K +CDG +PC  C   + +C Y
Sbjct: 7  RKRVSKACDACRAKKIKCDGCDPCSNCKKVSQECGY 42

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          KK +R+  AC  CR+R  +C G NPC  C+     C Y E
Sbjct: 37 KKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVACEYVE 76

>Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)
          Length = 117

 Score = 40.8 bits (94), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           +K  R  +AC  C++RK +CD   PC  CV    KC Y
Sbjct: 7  QRKSSRVSRACERCKKRKIKCDTLKPCFNCVGSQSKCTY 45

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 84/215 (39%), Gaps = 34/215 (15%)

Query: 12  KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHY-DEQGDPATLPAPLIPEIPDST 69
           +R +A KAC+ CR++K++CD A P C  C     +C Y  E+ D  ++       IP+S 
Sbjct: 8   RRNKAIKACLNCRRKKQKCDQARPQCYQCRIRKTECVYLGEKADKNSIS------IPNSI 61

Query: 70  RSISPPRTRMVAKP----------PSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVA 119
              +P     V             P + TK +          GV       ++  +S + 
Sbjct: 62  LDTTPFDINHVGSKDNSCKSEEANPLVGTKFIFQKEDKWLACGVTSMRTIFHLHCNSKIN 121

Query: 120 --FA---RSLGIE--LQSANPPHLHSFAW------NCGLRSEEKSNTHCALHDLITKEET 166
             F    + L  E  +  A   +   F W      N     E   +  C +  L + EE 
Sbjct: 122 GYFTTPWKKLKQERNIWKAKNNYSSQFDWSLLGEPNILRNGESLIDAVCRV--LPSYEEV 179

Query: 167 FHFTQIYFS-AIHPVFDVVDPEHFKKSVESYWNDG 200
               Q YFS  +H  F++VDP+   +   SY+  G
Sbjct: 180 EMHLQKYFSDTMHKTFEIVDPKKIMQDFRSYFIKG 214

>Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa]
          {ON} YLR098C (REAL)
          Length = 644

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 14/64 (21%)

Query: 2  STGIPSVPHKKRQ-------------RARK-ACVPCRQRKRRCDGANPCGMCVSYAYKCH 47
          ST  PS+P   ++             R RK AC  CR+R+R+CD   PC  C+ +   C 
Sbjct: 12 STTTPSLPSSLKRPMANNEENNDNVPRKRKLACQSCRRRRRKCDMEKPCSNCIKFQTDCV 71

Query: 48 YDEQ 51
          + +Q
Sbjct: 72 FAQQ 75

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa]
          {ON} Anc_8.845 YMR280C
          Length = 1246

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 1/74 (1%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPD 67
          P     R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      I +
Sbjct: 21 PSSSNYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEE 80

Query: 68 STRSISPPRTRMVA 81
            R +     R++A
Sbjct: 81 RVRELEAENRRLLA 94

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 7   SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
           S P +KR R   +C  CR+RK +CD   P C  C     ++ CHY EQ
Sbjct: 105 SKPKRKRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTGVSHLCHYMEQ 152

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 84/200 (42%), Gaps = 28/200 (14%)

Query: 161 ITKEETFH-FTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCK---VSAFGAVVGGIIAL 216
           + K ET   +   YF   H ++ +V  E F     + +ND  K   V  +  ++  ++AL
Sbjct: 379 LAKRETISAYIDAYFKHYHALYPLVSKEMFF----AQYNDQIKPENVEIWHILLNAVLAL 434

Query: 217 GSLFSGRPGHPRELEIVQYAKNVLEDPTFSRLP--SAEQVSAWVLRTLYLRATTRPHAAW 274
           GS  S        L    Y +N L   + + L   S +   A +L T Y++   +P+ AW
Sbjct: 435 GSWCSNSCSSHHTL----YYQNALSYLSTAVLETGSTDLTIALILLTHYVQKMHKPNTAW 490

Query: 275 LASCVTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDY 334
               +  H+A +  LH ++ N   T +D+ L           R L+W  +     LS + 
Sbjct: 491 SLIGLCSHMATSLGLHRDLPNS--TIHDQQL----------RRVLWWTIYCTGCDLSLET 538

Query: 335 GRSS--ASLGGISCKLPTKS 352
           GR S   +L  I   LP  S
Sbjct: 539 GRPSLLPNLQAIDIPLPASS 558

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 14 QRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          +R R AC  CR+R+++CD + PC  CV     C+ +E+
Sbjct: 53 KRKRLACTNCRKRRKKCDLSYPCASCVRLRIDCNVNEE 90

>TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1086

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K R +  +AC  CR+RK +C G  PC  CV+Y  +C +
Sbjct: 11 KPRSKVSRACENCRRRKIKCTGNQPCNNCVTYQCECIF 48

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
          some similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCV 40
          R++  KAC+ C+QRK++C G  PC  CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 688

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCV 40
          R++  KAC+ C+QRK++C G  PC  CV
Sbjct: 3  RKKMMKACIKCKQRKKKCSGQLPCDYCV 30

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 89/211 (42%), Gaps = 25/211 (11%)

Query: 163 KEETFHFTQIYFSAIHPVFDVVDPEHFKKSVE--SYWNDGCKVSAFGAVVGGIIALGSLF 220
           +  T  + Q YF   H ++ VVD   F    E  S   D C    +  +V  ++ALG+  
Sbjct: 168 QSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDAC---LWTGLVNVVLALGAWC 224

Query: 221 SGRPGHPRELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTL--YLRATTRPHAAWLASC 278
           +G P         +   +VL       L + ++V A  L  +  Y   T   + AW+   
Sbjct: 225 AGAPPAAHVFYYDKAESHVLG----RMLRTGDRVLAIALLLMAHYNYMTHHRNTAWMLLG 280

Query: 279 VTIHLAEASALHHEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRSS 338
           +   LA +  LH +++          LPP+ + +   A+ L+W  +S  + ++ + GR S
Sbjct: 281 LASQLATSLGLHRDLQ---------GLPPKQRTL---AQILWWGIYSTTTQVALELGRPS 328

Query: 339 --ASLGGISCKLPTKSDGNYTAQLVDLALII 367
               +G     +P  ++  Y+    ++ L+I
Sbjct: 329 PLPRIGHTDVPVPDMTNPLYSHLANEVNLVI 359

>Smik_2.115 Chr2 (210321..213236) [2916 bp, 971 aa] {ON} YBL005W
          (REAL)
          Length = 971

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 22/41 (53%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          V    R +   ACV CR+RK +C G  PC  C+SY   C +
Sbjct: 3  VKKSTRSKVPTACVNCRKRKIKCTGKYPCTNCISYDCTCVF 43

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
           YMR280C
          Length = 1301

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 97  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLEERVRELE 156

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 157 AENRRLVA 164

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          KR R   AC  CR +K++CDG  PC +C +   +C Y ++
Sbjct: 20 KRLRVSHACDNCRLKKKKCDGQQPCKLCKNSENECIYSDR 59

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 5/43 (11%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANP----CGMCVSYAYKCHY 48
          H KR R+ KAC  CR+RK RCD  NP    C  CV +  +C +
Sbjct: 32 HYKR-RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTF 73

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa]
          {ON} Anc_4.113 YGL013C
          Length = 1207

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 7  SVPHKKRQRAR--KACVPCRQRKRRCDGANPCGMCVSYAYKC 46
          +V H  R R++  KAC  CR+RK +C G  PC  C +Y  +C
Sbjct: 2  AVKHATRPRSKVSKACDNCRRRKIKCSGERPCAGCKTYNCEC 43

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 40.8 bits (94), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 9/57 (15%)

Query: 17 RKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
          ++AC  CR R+ +CDG  PCG C+     C Y +         PL    P S RS S
Sbjct: 38 KQACDCCRVRRVKCDGKGPCGRCLQRDLNCTYLQ---------PLRKRGPKSIRSRS 85

>YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1
           enhancer activator required for full levels of Ty
           enhancer-mediated transcription; C6 zinc cluster
           DNA-binding protein
          Length = 759

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
            TG  ++ +    R R AC  CR R+++CD   PCG C      C+ +++
Sbjct: 52  GTGANTLTNGGSTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDE 101

>TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1486

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 3/47 (6%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQG 52
          P +KR R   +C  CR+RK +CD  +P C  C     ++ CHY EQ 
Sbjct: 8  PKRKRNRIPLSCTICRKRKVKCDKTHPYCVQCTKTGMSHLCHYMEQS 54

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar
           to uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8
           Zinc cluster transcriptional activator
          Length = 1206

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%), Gaps = 1/76 (1%)

Query: 7   SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
           SV      R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      +
Sbjct: 61  SVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 66  PDSTRSISPPRTRMVA 81
            +  R +     R+VA
Sbjct: 121 EERVRELEAENRRLVA 136

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKC 46
          + ++R  +AC  CR +K +CDG  PC  C    Y C
Sbjct: 20 RTKKRHSQACDRCRSKKIKCDGLQPCSNCAKIGYNC 55

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
          to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer- mediated
          Activation Ty1 enhancer activator and to YLR098C
          uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
          Zinc- finger protein with Zn[2]-Cys[6] fungal-type
          binuclear cluster domain DNA-binding transcriptional
          activator or CHA1
          Length = 701

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          K  +R R AC  CR+R+++CD   PC  CV    +C+ +E+
Sbjct: 46 KMGERKRLACSNCRRRRKKCDLNYPCSSCVRLRLQCNVNEE 86

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1429

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYK--CHYDEQG 52
          +KR R   +C  CR+RK +CD  +P C  CV    +  CHY EQ 
Sbjct: 36 RKRNRIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQHLCHYMEQS 80

>KAFR0G00570 Chr7 complement(148813..151401) [2589 bp, 862 aa]
          {ON} Anc_1.199 YKR064W
          Length = 862

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYK--CHYDEQGDPAT 56
          ++R+R    C  CR+RK RCD   PC  C+       C Y+ + +P T
Sbjct: 9  RRRKRGTVVCTNCRKRKSRCDRQLPCNTCMRLGNSETCEYENKLNPNT 56

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
          similarities with uniprot|P35995 Saccharomyces
          cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 40/73 (54%), Gaps = 12/73 (16%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDST 69
          K R +  ++C+ C++RK++CD   P C  C+   Y+C Y+           L  ++ D T
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIYN---------VNLQSQLVDGT 53

Query: 70 RSISPPRTRMVAK 82
          + +S  +++++AK
Sbjct: 54 KQLS--KSQLIAK 64

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 35/84 (41%), Gaps = 17/84 (20%)

Query: 16 ARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSISPP 75
           + AC  CR R+ +CDG  PC  C+ + + C Y +               P   R   P 
Sbjct: 4  VKYACDYCRVRRVKCDGKKPCSRCIEHNFDCTYQQ---------------PLKKRGSKPI 48

Query: 76 RTRMVAKPPSIRTKILLNSTQCAA 99
           TR +   P  + K+ +++  C A
Sbjct: 49 GTRSLKYIP--KAKMFIDNKSCTA 70

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 3  TGIPSVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCV--SYAYKCHYDEQ 51
          TG P    +KR R   +C  CR+RK +CD   P C  CV     + CHY EQ
Sbjct: 9  TGTPQQ-KRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLCHYMEQ 59

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa]
          {ON} YGL013C (REAL)
          Length = 1080

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K R +  KAC  CR+RK +C+G  PC  C  Y+ +C +
Sbjct: 34 KPRSKVSKACDNCRKRKIKCNGKFPCASCEIYSCECTF 71

>SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa]
          {ON} similar to uniprot|P26370 Saccharomyces cerevisiae
          YDL170W UGA3 Transcriptional activator necessary for
          gamma- aminobutyrate (GABA)-dependent induction of GABA
          genes (such as UGA1 UGA2 UGA4) zinc-finger
          transcription factor of the Zn(2)-Cys(6) binuclear
          cluster domain type localized to the nucleus
          Length = 591

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 11/94 (11%)

Query: 8  VPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP--- 63
          +  K+R  ++  C+ C+ RK+RC    P C  C    Y C Y     PA     L+    
Sbjct: 2  ISKKRRTHSKTGCITCKVRKKRCSEEKPVCSDCARLGYTCVY----LPAHAAKELVQKHK 57

Query: 64 ---EIPDSTRSISPPRTRMVAKPPSIRTKILLNS 94
             EI    R+ +P R  +V   PS+     L+S
Sbjct: 58 EQVEIELKKRTAAPTRETVVTGQPSVVLDDFLDS 91

>TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.56
          YOR337W
          Length = 662

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 15 RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          R R AC  CR+R+++CD   PCG C   + +C+ +E+
Sbjct: 35 RKRLACSNCRRRRKKCDLTYPCGNCQRLSLECNVNEE 71

>TPHA0C01080 Chr3 (246019..247794) [1776 bp, 591 aa] {ON} Anc_8.283
           YLR098C
          Length = 591

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/343 (19%), Positives = 133/343 (38%), Gaps = 35/343 (10%)

Query: 19  ACVPCRQRKRRCDGANPCGMCVSYAYKC-HYDEQGDPATLPAPLIPEIPDSTRSISPPRT 77
           AC  CR+R+R+C+   PC  C+ +   C   +E        A  +  + +    +    T
Sbjct: 16  ACQNCRKRRRKCNFLIPCSNCIKFQTDCVAVNEDLRKTRYTASYVKSLEEKIAYLESNLT 75

Query: 78  RMVAKPPSIRTKILLNST---QCAADQGVFDAAKSRYMGLSSAVAFARSLGIELQSANPP 134
               K  +I    LLNS+     A+   + +  K     + +      +    L+S++  
Sbjct: 76  ESDTKEKTIDDIKLLNSSISLATASSASLLNVPKRDKKEVKNEYNLVEN---PLRSSSIY 132

Query: 135 HLHSFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSAIHPV-FDVVDPEHFKKSV 193
            +HS + +    S E   T   L +L            +F  ++P  +  +  E F   +
Sbjct: 133 PMHSLSISKPFTSIEFKQTQTNLKNLTRSTAIMRSLSFFFKWLYPAHYFFIHRETF---L 189

Query: 194 ESYWNDGCKVSAFGA--VVGGIIALGSLF--SGRPGHPRELEIVQYAKNV-------LED 242
            S++ D    S + +  +V  + ALG+    S    + R  E  Q +K++       LED
Sbjct: 190 SSFFGDTNTKSYYCSEELVFAMSALGAKLVKSDDELYGRSTEFYQTSKSIVLKKVFQLED 249

Query: 243 PTFSRLPSAEQVSAWVLRTL-----YLRATTRPHAAWLASCVTIHLAEASALHHEVENVE 297
            +F+    + +++  +++TL     Y         AW  S +   +A    L      ++
Sbjct: 250 SSFADSTPSSKLA--IIQTLLCLAFYDIGNGENPMAWYLSGLAFRIAHEIGLQ-----LD 302

Query: 298 LTANDKALPPRTKKITERAR-RLFWCAWSINSILSYDYGRSSA 339
             A          KI    R R++W  +  + ++S  +GR++ 
Sbjct: 303 PDAWSNVYENDLSKIDFEVRSRIYWGCYIADHMISILFGRTTT 345

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 1148

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 8/54 (14%)

Query: 4  GIPSVPHKKRQRARKACVPCRQRKRRCDGANP----CGMCVSYAYKC--HYDEQ 51
          G+ + P KKR    KAC  CR+RK +CD  +P    C  C+ Y   C  HY E+
Sbjct: 20 GVTTKPAKKR--VSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHYHEE 71

>TBLA0C02060 Chr3 (486966..489920) [2955 bp, 984 aa] {ON}
          Anc_1.199 YKR064W
          Length = 984

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 1  MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCV--SYAYKCHY 48
          M T I   P K+R R    C  C++RK +CD A PC  C+    A +C Y
Sbjct: 1  MDTPISFPPIKRRARLTVVCTNCKKRKSKCDRAKPCSHCIRLGIANECTY 50

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar
          to uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
          Oleate-activated transcription factor acts alone and as
          a heterodimer with Pip2p activates genes involved in
          beta-oxidation of fatty acids and peroxisome
          organization and biogenesis
          Length = 1035

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPA 55
          KKR R    C  CR+ K +CD   P CG CV +   C YD +   A
Sbjct: 51 KKRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVYDVEKQAA 96

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
          Anc_7.56 YOR337W
          Length = 757

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          K   + R AC  CR+R+++CD   PCG C     +C+ +E+
Sbjct: 42 KNDGKRRLACSNCRKRRKKCDVEYPCGGCSRLGLECNINEE 82

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          K R R    C  CR+RK +CD A P CG C     +C+YD
Sbjct: 23 KSRLRLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYD 62

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 14  QRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSI 72
           +R  +AC  CR +K RCDG  P C  C    ++C   ++    + P      + +  R +
Sbjct: 102 KRISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGYTETLEEKIREL 161

Query: 73  SPPRTRMVA 81
                R++A
Sbjct: 162 QTENKRLLA 170

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 16 ARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          A++AC  CR R+ +CDG  PC  C+ +  KC Y
Sbjct: 9  AKQACDCCRVRRVKCDGKKPCNRCLQHDLKCTY 41

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa]
          {ON} Anc_4.113
          Length = 1118

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 2  STGIPSVPHKKRQ---RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          S  +P+   K R+   +  KAC  CR+RK +C G  PC  C +Y   C Y  Q
Sbjct: 42 SLHVPTKEKKIRKPSNKVTKACDNCRRRKIKCTGKTPCATCEAYQCLCIYSTQ 94

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1270

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 86  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 145

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 146 AENRRLVA 153

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa]
          {ON} Anc_8.283
          Length = 710

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          K QR + AC  CR+ +R+CD  NPC  C+ +   C Y E+
Sbjct: 38 KSQR-KIACQHCRKIRRKCDMINPCSNCIKFDTTCVYAEK 76

>Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C
          (THI2) - Probable Zn-finger protein [contig 238] FULL
          Length = 443

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 7  SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          S   K + R+   C  CR +KRRCD A P C +C+ +  +C YD
Sbjct: 2  STASKTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQCSYD 45

>Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W
          (REAL)
          Length = 832

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPAT 56
          +R R R  C+ C++ KR+CD   P C  C  ++ +C Y++  D ++
Sbjct: 7  RRSRLRLVCLQCKRIKRKCDKVRPVCSRCQQHSLECKYEDSADLSS 52

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (42%)

Query: 19  ACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSISPPRTR 78
           ACV CR+R  +C G  PC  C S    C Y E      +    + ++ +S  ++     R
Sbjct: 75  ACVRCRRRHVKCPGGQPCAKCASANIACEYLEPNKKLIVSMKYLQDLQESLANMKRENVR 134

Query: 79  MVAKPPSIRTKILLNSTQCAADQG 102
           + +   S+++    +     AD G
Sbjct: 135 LQSLVTSLQSNYESDVEAKEADSG 158

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 18 KACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          +AC+ CR+RK +C+G  PC  C +   +C YD
Sbjct: 49 QACISCRRRKVKCNGCRPCSSCKTNGLECAYD 80

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 17 RKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R AC+ CRQ+  +C G NPC  CV  +  C Y
Sbjct: 25 RVACLRCRQKHIKCPGGNPCAKCVISSATCEY 56

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
           H    R R AC  CR R+++CD   PCG C      C+ +++
Sbjct: 60  HGSSTRKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDE 101

>TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1247

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 11/112 (9%)

Query: 11  KKRQRARKACVPCRQRKRRCDGANP-CGMCV--SYAYKCHYDEQ-----GDPATLPAPLI 62
           +KR R   +C  CR+RK +CD   P C  CV    A+ CHY EQ      +        +
Sbjct: 23  RKRNRIPLSCTICRKRKVKCDKTRPHCDQCVKTGVAHLCHYMEQSWAEEAEKEISKETEL 82

Query: 63  PEIPDSTRSISPPRTR---MVAKPPSIRTKILLNSTQCAADQGVFDAAKSRY 111
            ++ D  +S+    ++   + +  P     +L N  + + D   F +  S+Y
Sbjct: 83  KQLRDRVKSLEESLSKVHSVCSNTPDSNILVLDNGNEISGDDSKFLSGNSKY 134

>KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON}
          similar to uniprot|P53749 Saccharomyces cerevisiae
          YNR063W Hypothetical ORF
          Length = 591

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 19 ACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          AC+ C++RK++CDG  PC  C     KC Y
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVKCIY 31

>KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar
          to uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc-finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 834

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          ++ +R+  ACV CR+R  +C G  PC  CV+    C Y E
Sbjct: 44 RRIKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYME 83

>SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 833

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 12 KRQRAR-----KACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLP 58
          KRQ+ +     +AC  CR+RK +C G  PC  C  Y   C Y  +   A LP
Sbjct: 13 KRQKKQPDKVFRACKSCRKRKIKCSGFQPCSNCEVYKCVCEYKAKRPAAKLP 64

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 1/46 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGM-CVSYAYKCHYDEQGDPA 55
          +KR R    C+ CR+RK +CD   PC + C      C YD +  PA
Sbjct: 16 QKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIERQPA 61

>NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56
          Length = 718

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 14 QRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          +R R AC  CR+R+++CD   PC  C+     C+ +E+
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLNCNVNEE 68

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa]
          {ON} weakly similar to uniprot|P39961 Saccharomyces
          cerevisiae YER184c
          Length = 835

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDP 54
          + R  +AC  CR+RK +CDG  PC  C++ +  C Y+    P
Sbjct: 14 KDRVIRACDVCRKRKVKCDGDQPCSSCMTASTVCIYNGVAFP 55

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa]
          {ON} conserved hypothetical protein
          Length = 362

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          ++R  KAC  CR+ K +CDG  PC  C+S    C Y
Sbjct: 4  KKRVSKACDTCRKSKTKCDGERPCQRCLSENKICTY 39

>KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} similar
          to uniprot|P53749 Saccharomyces cerevisiae YNR063W
          Hypothetical ORF
          Length = 612

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAY--KCHYD 49
          KR+  R+AC+ C+ +K +CDG  PCG C       +C Y+
Sbjct: 8  KRKVGRRACMLCKLKKLKCDGNYPCGRCAKSGVPSECGYE 47

>ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON}
          similar to uniprot|P12383 Saccharomyces cerevisiae
          YGL013C PDR1 Zinc cluster protein that is a master
          regulator involved in recruiting other zinc cluster
          proteins to pleiotropic drug response elements (PDREs)
          to fine tune the regulation of multidrug resistance
          genes
          Length = 1036

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          + R +  +AC  CR+RK +C G  PC  C +Y  +C Y
Sbjct: 8  RPRNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECLY 45

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
          similar to uniprot|P39529 Saccharomyces cerevisiae
          YJL206c
          Length = 832

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          + QR  +AC  C++RK +C G NPC  C     +C Y E
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYRE 66

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
           {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
           ABL121Cp and similar to YMR280C uniprot|P39113
           Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
           transcriptional activator
          Length = 1250

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 99  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELE 158

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 159 AENRRLVA 166

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
           (CAT8) - Zinc-cluster protein involved in activating
           gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETLEERVRELE 128

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 129 AENRRLVA 136

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 12  KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD---EQGDPATLPA--PLIPEI 65
           KR R    C  CR RK +CD A P C  C  +  +C Y+   ++ +P T+ A    + E+
Sbjct: 7   KRNRRLHVCDACRIRKLKCDKAKPNCSRCAKHGLECIYNPYRQKEEPETVVALKKELLEL 66

Query: 66  PDSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAFAR 122
                + SP         P I   I +   +     GV+   +S Y  LS    FAR
Sbjct: 67  RAQLVANSPASCTSEVSKPKISWDIFVTPVKVG---GVW---RSYYSPLSDVALFAR 117

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
          {ON} weakly similar to uniprot|P12383 Saccharomyces
          cerevisiae YGL013C PDR1 Zinc cluster protein that is a
          master regulator involved in recruiting other zinc
          cluster proteins to pleiotropic drug response elements
          (PDREs) to fine tune the regulation of multidrug
          resistance genes
          Length = 1082

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K R++  +AC  CR++K +C G  PC  C +Y  +C Y
Sbjct: 46 KPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVY 83

>Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON}
          (69833..73657) [3825 nt, 1275 aa]
          Length = 1274

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 1  MSTGIPSVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYA--YKCHYDEQ 51
          M+T       +KR R   +C  CR+RK +CD  +P C  C+     + CHY EQ
Sbjct: 1  MNTEAAGKVKRKRNRIPLSCTICRKRKVKCDKTHPHCNQCIKTGVHHLCHYMEQ 54

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 16 ARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          A++AC  CR R+ +CDG  PC  C+ +  KC Y
Sbjct: 4  AKQACDCCRVRRVKCDGDKPCNRCLQHDLKCTY 36

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
           (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
           FULL
          Length = 822

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 64/168 (38%), Gaps = 43/168 (25%)

Query: 14  QRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE---------------QGDPATLP 58
           +R+  ACV CR+R  +C G NPC  C +    C Y E               Q D A L 
Sbjct: 43  KRSGLACVRCRRRHAKCSGDNPCTTCRAANIACEYLEPNKKLVVSMKYLQKLQSDLAELK 102

Query: 59  APLIPEIPDSTRSISPPRTRMVA---KPPSIR--------------------TKILLNST 95
              + ++  S +S++P     V    +PP I+                     +I+ N T
Sbjct: 103 RENV-KLQASVKSMNPQEPTKVTPTKRPPDIKFQRNTVDQSSPLAASNVPEDEEIVPNFT 161

Query: 96  QCAADQGVFDAAKSRYMGLSSAVAFARSLGIELQSANPPHLHSFAWNC 143
           +           +  ++G SS   F    G+E+QS  P +L +    C
Sbjct: 162 ERRGRLVASRTGQQYFVGSSSMTLF----GMEIQSLIPQNLTNQKQKC 205

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCV--SYAYKCHYDEQ 51
          +KR R   +C  CR+RK RCD   P C  CV     + CHY EQ
Sbjct: 10 RKRNRIPLSCTICRKRKVRCDKTKPHCTQCVKTGVVHLCHYMEQ 53

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
           similar to Ashbya gossypii ABL121C
          Length = 1577

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 124 RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 183

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 184 AENRRLVA 191

>KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.56
          YOR337W
          Length = 691

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 15 RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
          + R AC  CR+R+++C+ A PC  CV    KC+ +E+
Sbjct: 42 KKRLACNNCRKRRKKCNLAYPCDGCVRLKLKCNINEE 78

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
          (REAL)
          Length = 831

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPAT 56
          +R R R  C+ C++ KR+CD   P C  C  ++ +C Y++  D ++
Sbjct: 7  RRSRLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSS 52

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 13  RQRARKACVPCRQRKRRCDGANP----CGMCVSYAYKCHYDEQGDPAT 56
           ++RA +AC  CR+RK +CD  +P    C  C  +   C +D +   AT
Sbjct: 134 KKRATRACESCRKRKIKCDPVDPITNKCSNCTKFHMICVFDNRKRKAT 181

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 3/45 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQG 52
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ 
Sbjct: 29 RKRNRIPLSCTICRKRKVKCDKIRPHCNQCTKTGVAHLCHYMEQS 73

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C    ++C   ++    + P      + +  R + 
Sbjct: 76  RIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVRELE 135

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 136 NENRRLLA 143

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger
          overexpression increases salt tolerance through
          increased expression of the ENA1 (Na /Li extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 878

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R+R  KAC  CR +K +C+G   C  C+ Y   C Y
Sbjct: 9  RRRVSKACDSCRSKKIKCNGEQTCSNCLKYGCPCTY 44

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 10  HKKRQRARKACVPCRQRKRRCDGAN----PCGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
           H  ++RA KAC  CR+RK +CD  +     C  C+ Y  +C +  Q         LI + 
Sbjct: 93  HPPKKRASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKRK---GDLIEKA 149

Query: 66  PDSTRSIS 73
            +S RS S
Sbjct: 150 EESKRSRS 157

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
           Anc_1.380 YLR256W
          Length = 1581

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
           ST   +   +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 48  STNTSNKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQ 100

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa]
          {ON} YGL013C (REAL)
          Length = 1000

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K R +  KAC  CR+RK +C+G  PC  C  Y  +C +
Sbjct: 34 KPRSKVSKACDNCRKRKIKCNGKFPCASCEIYLCECTF 71

>KNAG0C01160 Chr3 complement(226939..229446) [2508 bp, 835 aa]
          {ON} Anc_1.199 YKR064W
          Length = 835

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSY--AYKCHYDEQGDPATLPAPLI 62
          +KR+R    C  CR+RK RCD   PC  C  +  A  C Y +    +  P  L+
Sbjct: 13 RKRKRPTVVCTNCRRRKSRCDRERPCNTCTRFGNADSCVYLDSSPSSNEPQILL 66

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 18 RKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 61

>NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON}
          Anc_1.199
          Length = 875

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMC--VSYAYKCHY-DEQGDPATLPAPLIPEIPD 67
          KKR R    C  C++RK +CD   PC  C  +    +C Y  + G  +  P P+   +P 
Sbjct: 15 KKRNRPTVVCTNCKKRKSKCDRGRPCSTCARLGDGDRCIYVSDTGSES--PVPMNQFMPK 72

Query: 68 STRSISPPRTRMVAKPPSI 86
            + + P       + P +
Sbjct: 73 RVKVLKPSNRHAFPRSPDM 91

>ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595
          aa] {ON} similar to uniprot|P43634 Saccharomyces
          cerevisiae YLR098C CHA4 Zinc-finger protein with
          Zn[2]-Cys[6] fungal- type binuclear cluster domain
          DNA-binding transcriptional activator or CHA1
          Length = 595

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 7  SVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKC 46
          S P +     + AC  CR+R+R+C+   PC  CV Y  +C
Sbjct: 6  SSPDEPSNSRKLACQNCRKRRRKCNSEIPCSNCVKYGIEC 45

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar
           to uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
           similar to YMR280C uniprot|P39113 Saccharomyces
           cerevisiae YMR280C CAT8 Zinc cluster transcriptional
           activator
          Length = 1445

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 237

Query: 74  PPRTRMVA 81
               R+VA
Sbjct: 238 AENRRLVA 245

>YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}
          RDS1Putative zinc cluster transcription factor;
          involved in conferring resistance to cycloheximide
          Length = 832

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGD 53
          K+ R R  C+ C++ KR+CD   P C  C   + +C Y+E+ D
Sbjct: 7  KKPRLRLVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYEERTD 49

>Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]
          {ON} complement(116430..119819) [3390 nt, 1130 aa]
          Length = 1129

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R +  +AC  CR+RK +C G  PC  C++Y  +C +
Sbjct: 33 RSKVSRACEGCRRRKIKCSGNWPCSSCITYDCECIF 68

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
          similar to Ashbya gossypii AER183C
          Length = 898

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          R+R  KAC  CR +K +C+G  PC  C  +  +C Y
Sbjct: 20 RKRVSKACDTCRAKKIKCNGEEPCSNCGKHDLECAY 55

>Skud_11.300 Chr11 (544149..546746) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCV 40
          KKR R    C  C++RK +CD   PCG CV
Sbjct: 10 KKRHRITVVCTNCKKRKSKCDRIKPCGTCV 39

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
          {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 12/82 (14%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPL----IPEIP 66
          K+ R  K C+ CR+RK +CD  +P C  C+  +  C Y       T   P+    +P+  
Sbjct: 7  KKPRPSKVCLTCRRRKVKCDQQHPSCMRCIKSSTLCTY-------TYSTPVSDDSLPDSL 59

Query: 67 DSTRSISPPRTRMVAKPPSIRT 88
          D+ +S+S P+  ++     + T
Sbjct: 60 DTPKSMSQPKKSVMPTTDQLMT 81

>KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa]
          {ON} 
          Length = 968

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 9  PHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          P  +R++   AC  CR+RK +C G  PC  C +Y+  C Y
Sbjct: 17 PAHRRRKTVLACTNCRRRKIKCTGKWPCSNCEAYSCVCEY 56

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 4/46 (8%)

Query: 5   IPSVPHKKRQRARKACVPCRQRKRRCDGANP----CGMCVSYAYKC 46
           +P   HK+++RA KAC  CR+RK +CD  +P    C  C      C
Sbjct: 163 MPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 10 RKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 53

>Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa]
          {ON} YOR363C (REAL)
          Length = 995

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPA 55
          +KKR R    C  CR+ K +CD   P CG C      C YD    PA
Sbjct: 15 NKKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYDVARQPA 61

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
          YOR363C
          Length = 1232

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          KKR R    C  CR+ K +CD   P C  C+ +  +C YD
Sbjct: 43 KKRNRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQCVYD 82

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 43 RKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLCHYMEQ 86

>Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON}
          (44110..46518) [2409 nt, 803 aa]
          Length = 802

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 4/63 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMC--VSYAYKCHYDEQGDPATLPAPLIPEIPDS 68
          KKR R    C  C++RK +CD   PC  C  +     C Y +  D  +LP   I  + D 
Sbjct: 10 KKRHRITVVCTNCKKRKSKCDRGKPCSNCTRIGIENSCLYIK--DTPSLPIDSIGSVADL 67

Query: 69 TRS 71
          T S
Sbjct: 68 TAS 70

>SAKL0D08008g Chr4 complement(665498..669184) [3687 bp, 1228 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1228

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 8/73 (10%)

Query: 13 RQRARKACVPCRQRKRRCDGANP-CGMCVSY--AYKCHYDEQGDPATLPAPLIPEIPDST 69
          +++  K+C+ CR+RK +CD   P C  CV +    +C YD   D       +I ++PD  
Sbjct: 8  KKKVGKSCLVCRRRKVKCDKTKPVCLACVRHQSTMQCDYDINNDNM-----IIFQVPDIN 62

Query: 70 RSISPPRTRMVAK 82
          +  S  R    +K
Sbjct: 63 QPASGSRINKTSK 75

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 73/172 (42%), Gaps = 13/172 (7%)

Query: 12  KRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHY----DEQGDPATLPAPLIPEIP 66
           KR+ +R  C  C++R+ +CD   P C  C     +C Y      +         ++ E  
Sbjct: 111 KRKYSRNGCAECKRRRMKCDETKPTCWQCSRLNRECVYVLNPKNKKRNGKSTENIVEEHC 170

Query: 67  DSTRSISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVAFARSLGI 126
            ST  ++P +  +      I+  +L  +      QG+ DA  +  +  S    +  SL I
Sbjct: 171 SST-VVTPSKIELRNTYTDIQKNVL--NVNGTVKQGIQDAFGNHSIT-SEVSGYDASLLI 226

Query: 127 E-LQSANPPHLH-SFAWNCGLRSEEKSNTHCALHDLITKEETFHFTQIYFSA 176
           + L       LH SF  N  L+  +  +    L +LI+KEET +   I F++
Sbjct: 227 QNLNDIVNMKLHDSFQLNEDLK--DLGSFDLELPELISKEETLNSVPISFNS 276

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 60/276 (21%), Positives = 110/276 (39%), Gaps = 33/276 (11%)

Query: 105 DAAKSRYMGLSSAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCALHDLITKE 164
           D     Y G  S ++  RS+G + Q   P        N     EE        H  I+ E
Sbjct: 178 DLNNKGYFGSKSQISHLRSIGFDSQQFQPTRRKITTINYNNVKEELPLNGSHSH-YISLE 236

Query: 165 ETFHFTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAF---------GAVVGGIIA 215
               F + YF   H  + +++ E F K + S+ ++                  +   ++A
Sbjct: 237 MESSFIESYFRNFHVYYPILNKESFMKRIRSHQSNTNNNHTTNDDDEFFFQNILYNMVLA 296

Query: 216 LGSLFSGRPGHPRELEIVQYAK--NVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAA 273
           +GS +       ++++ + Y K  N ++   F    S   + A+ L + Y + T  P+++
Sbjct: 297 IGS-WCLEEYSKKKIDSIFYTKAINSIDGQIFEN-GSIILIIAFYLLSKYCQWTENPNSS 354

Query: 274 WLASCVTIHLAEASALHHEVENVELTANDKALPPRTK-----KITERARRLFWCAWSINS 328
           ++    +I +A +  L  E+        +K++P  +       I E+ RR++WC  + + 
Sbjct: 355 YIYIGHSIKMAISIGLFKELP-------EKSIPSSSSSSSSSNIVEQRRRIWWCLSNHDF 407

Query: 329 ILSYDYGRSSASLGGI------SCKLPTK-SDGNYT 357
            LS  + R S     I      S  LPT  SD  +T
Sbjct: 408 QLSILFDRPSQISNHINDNNLASINLPTPISDDKFT 443

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 838

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/89 (20%), Positives = 40/89 (44%)

Query: 2   STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPL 61
           S+G      K  +R+  ACV CR++  +C G +PC  C +    C Y E     T+    
Sbjct: 24  SSGSAGYVRKPPRRSTLACVRCRRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKY 83

Query: 62  IPEIPDSTRSISPPRTRMVAKPPSIRTKI 90
           + ++ ++   +     ++ +   ++ + +
Sbjct: 84  LQQLQENLADLKRENVKLQSIVNTVNSDV 112

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 4/76 (5%)

Query: 10 HKKRQRARK----ACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQGDPATLPAPLIPEI 65
          +K+RQR +     AC+ CR+R  +C G +PC  C++    C Y E      +    + ++
Sbjct: 20 NKQRQRRQPRSAVACLSCRKRHIKCPGGSPCQKCITSNAICEYLEPSKKIVVSTKYLQQL 79

Query: 66 PDSTRSISPPRTRMVA 81
                 +    R+ A
Sbjct: 80 QKDLNEKTEENNRLRA 95

>KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa]
          {ON} weakly similar to uniprot|Q6B2M3 Saccharomyces
          cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger
          transcription factor that activates genes involved in
          multidrug resistance paralog of Yrr1p acting on an
          overlapping set of target genes
          Length = 771

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 3  TGIPSVPHKKRQRAR--KACVPCRQRKRRCDGANP-CGMCV 40
          +G  S P  +R+R +  K+C  CRQRK +CD   P CG CV
Sbjct: 49 SGASSKPSTRRRRRKVIKSCTFCRQRKMKCDQQKPMCGSCV 89

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 2  STGIPSVPHKKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          + G  +   +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 25 ANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLCHYMEQ 77

>Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 15  RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
           R R AC  CR R+++CD   PCG C      C+ +++
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDE 101

>Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa]
          {ON} similar to Ashbya gossypii ACR209W + ACR208C
          Length = 856

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 10/48 (20%)

Query: 11 KKRQRARKACVPCRQRKRRCDGAN----------PCGMCVSYAYKCHY 48
          KKR+ A++AC+ CR+RK RCDG             C  C ++  KC +
Sbjct: 9  KKRKVAKRACLACRKRKIRCDGETRGTVVEDGQRVCSNCANHGLKCIF 56

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
          YRR1Zn2-Cys6 zinc-finger transcription factor that
          activates genes involved in multidrug resistance;
          paralog of Yrm1p, acting on an overlapping set of
          target genes
          Length = 810

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 2  STGIP-SVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAY-KCHYDEQ 51
          ++G P S   KKR +  K+C  CR+RK RCD   P C  C+S     C Y E+
Sbjct: 35 NSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCISRNLTTCQYAEE 87

>Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 15  RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDEQ 51
           R R AC  CR R+++CD   PCG C      C+ +++
Sbjct: 65  RKRLACTNCRNRRKKCDLGFPCGNCSRLELVCNVNDE 101

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 9   PHKKRQRARKACVPCRQRKRRCD-----GANPCGMCVSYAYKCHYD--EQGD 53
           P   ++R  +AC  CR+RK +CD       N C  C+ Y  +C +   EQ D
Sbjct: 242 PRSAKKRVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSECTFKNWEQND 293

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 123

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 124 AENKRLLA 131

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 125 AENKRLLA 132

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHY 48
          +K +R    C+PC+ +K RC+ A P C  C      CHY
Sbjct: 26 QKSKRTVSVCIPCKSQKLRCNKARPICSRCQRLGKHCHY 64

>Suva_14.423 Chr14 (733379..735229) [1851 bp, 616 aa] {ON} YNR063W
          (REAL)
          Length = 616

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMC--VSYAYKCHY--DEQGDPATL 57
          K++    AC  C++RK +CDG NPC  C  +    KC Y  D + D  T+
Sbjct: 8  KKKAVSLACTVCKKRKLKCDGNNPCSRCNKLKTPEKCSYCTDRRKDKRTV 57

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa]
          {ON} conserved hypothetical protein
          Length = 370

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 13 RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          ++R  KAC  CR+ K +CDG  PC  C+     C Y
Sbjct: 15 KRRVSKACDACRKSKTKCDGERPCSRCLKENKLCTY 50

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 16 ARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
           + AC  CR R+ +CDG  PC  C+ + ++C Y +
Sbjct: 4  VKYACDFCRVRRVKCDGKKPCSRCIQHDFECTYQQ 38

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 9  PHKKRQRARKA--CVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDP---ATLPAP 60
          P  K+ R R++  C  C++RK +CD A P CG C     +C YD Q +      LP P
Sbjct: 17 PEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGP 74

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 9/47 (19%)

Query: 11 KKRQRARKACVPCRQRKRRCDG-ANP--------CGMCVSYAYKCHY 48
          +KR+ A++AC+ CR+RK +CDG ANP        C  CV    +C +
Sbjct: 18 RKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLECVF 64

>YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative
          zinc-cluster protein of unknown function
          Length = 607

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCV 40
          +++    AC  CR+RK +CDG  PCG C+
Sbjct: 8  RKRSISLACTVCRKRKLKCDGNKPCGRCI 36

>KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa]
          {ON} Anc_4.113 YGL013C
          Length = 997

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K+R++  +AC  CR+RK +C    PC  C  Y  KC +
Sbjct: 14 KRRRKVNRACDNCRKRKIKCSETTPCTNCQIYQCKCVF 51

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} similar
           to uniprot|P12351 Saccharomyces cerevisiae YLR256w HAP1
           transcription factor
          Length = 1372

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 13  RQRARKACVPCRQRKRRCDGANP-CGMCV--SYAYKCHYDEQ 51
           R R   +C  CR+RK +CD + P C  CV    A+ CHY EQ
Sbjct: 64  RNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYMEQ 105

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%)

Query: 13  RQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           R+R  KAC  CR +K RC+G  PC  C  +   C Y
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEKFNLGCTY 109

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 7  RKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
          {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 2  STGIPSVPHKKRQRARKACVPCRQRKRRCDGANPCGMCVS---YAYKCHYD 49
          S   P    KKR +A +AC  CR+RK +CD +   G+C S    A +C +D
Sbjct: 31 SNSPPGSVSKKRTKASRACDQCRKRKIKCDFSEEKGICTSCSKNADRCAFD 81

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 7  RKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 125 AENKRLLA 132

>Smik_11.326 Chr11 (552455..555052) [2598 bp, 865 aa] {ON} YKR064W
          (REAL)
          Length = 865

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANPCGMC 39
          KKR R    C  C++RK +CD   PCG C
Sbjct: 10 KKRHRITVVCTNCKKRKSKCDRTKPCGTC 38

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 9   PHKKRQRAR--KACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
           P  KR+R R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 69  PKMKRKRNRIPLSCTICRKRKVKCDKTRPHCDPCSKTGVAHLCHYMEQ 116

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 1022

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          KKR R    C  CR+ K +CD   P C  C+ +  +C YD
Sbjct: 14 KKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRCVYD 53

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K RCDG  P C  C +  ++C   ++      P      + +  R + 
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 123

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 124 AENKRLLA 131

>NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa]
          {ON} Anc_6.154
          Length = 446

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 13 RQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          + R    C  CR +KRRCD  +P C +C+ +  KC YD
Sbjct: 11 KARTFTGCWACRLKKRRCDELHPKCSLCMKHGDKCSYD 48

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 13  RQRARKACVPCRQRKRRCDGANP----CGMCVSYAYKC---HYDE 50
           ++R  KAC  CR+RK RCD  +P    C  CV +   C   H DE
Sbjct: 126 KKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDE 170

>ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar
          to gnl|GLV|KLLA0C18953g Kluyveromyces lactis
          KLLA0C18953g and some similarites with YKL015W
          uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
          Positive regulator of PUT (proline utilization) genes
          zinc- finger transcription factor of the Zn(2)-Cys(6)
          binuclear cluster domain type
          Length = 649

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 20/27 (74%)

Query: 14 QRARKACVPCRQRKRRCDGANPCGMCV 40
          ++++KAC  C++RK+RC G  PC  CV
Sbjct: 4  KKSKKACEICKRRKKRCSGGLPCEYCV 30

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa]
          {ON} Anc_7.17 YOR363C
          Length = 989

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPA 55
          K+R R    C  CR+ K +CD   P CG C  +  +C YD +   A
Sbjct: 36 KRRNRISFVCQACRRSKTKCDREKPRCGRCQQHGLQCIYDVEKQAA 81

>NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.61
          YOR172W
          Length = 735

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC 39
          KKR++  K+C+ CR+RK +CD A P CG C
Sbjct: 14 KKRRKQIKSCMFCRKRKLKCDKAKPMCGQC 43

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%)

Query: 15  RARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIPEIPDSTRSIS 73
           R  +AC  CR +K +CDG  P C  C    ++C   ++ +  + P      + +  R + 
Sbjct: 55  RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETLEERVRELE 114

Query: 74  PPRTRMVA 81
               R++A
Sbjct: 115 TENKRLMA 122

>Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C
          (REAL)
          Length = 785

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
           ++  R  +AC  C++RK +CD   PC  CV    KC Y
Sbjct: 7  QRRSSRVSRACERCKKRKIKCDTLKPCFNCVGSQSKCTY 45

>TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON}
          Anc_6.154 YBR240C
          Length = 421

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 13 RQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          R R    C  CR +KRRCD A P C +CV +  +C YD
Sbjct: 9  RGRTFTGCWACRFKKRRCDEAKPRCSLCVKHDDRCCYD 46

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
          {ON} Anc_7.17
          Length = 1022

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 24/54 (44%), Gaps = 5/54 (9%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYDEQGDPATLPAPLIP 63
          KKR R    C  CR+ K +CD   P C  CV     C Y    D A  P P IP
Sbjct: 37 KKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVY----DVAKQPPPRIP 86

>KLLA0F22880g Chr6 (2123577..2127071) [3495 bp, 1164 aa] {ON} some
           similarities with uniprot|P12351 Saccharomyces
           cerevisiae YLR256W HAP1
          Length = 1164

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 15/109 (13%)

Query: 14  QRARKACVPCRQRKRRCDGANP-CGMCVSYA--YKCHYDEQGDPATLPAPLIPEIPDSTR 70
           ++  K+C+ CR+RK RCD A P C +CV +    +C+Y+ Q       +   P+      
Sbjct: 3   KKNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQKREVKFVSMKTPD------ 56

Query: 71  SISPPRTRMVAKPPSIRTKILLNSTQCAADQGVFDAAKSRYMGLSSAVA 119
            +S PR +   K  S +  I  + +     +   D  K R   L S ++
Sbjct: 57  -VSNPRMK---KQKSFKYSIPFSGSTTVVKE--LDVLKQRIHSLESLLS 99

>NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa]
          {ON} 
          Length = 978

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYD 49
          K+ R+ +AC  CR+RK +C G  PC  C  Y   C ++
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGCLCVFE 47

>KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} similar
          to uniprot|P38141 Saccharomyces cerevisiae YBR240C THI2
          Zinc finger protein of the Zn(II)2Cys6 type probable
          transcriptional activator of thiamine biosynthetic
          genes
          Length = 444

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 10 HKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          +K + R+   C  CR +KRRCD   P C +C+ +  +C YD
Sbjct: 5  NKTKARSFTGCWACRFKKRRCDENKPFCSLCLRHGDQCSYD 45

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
          Anc_7.56 YOR337W
          Length = 710

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 15 RARKACVPCRQRKRRCDGANPCGMCVSYAYKCHYDE 50
          + R +C  CR+R+++CD   PCG C     +C+ +E
Sbjct: 35 KKRLSCSNCRKRRKKCDLGFPCGNCTRLEIECNVNE 70

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 55 RKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQ 98

>Smik_15.342 Chr15 complement(595611..595820,595851..598070) [2430
          bp, 810 aa] {ON} YOR162C (REAL)
          Length = 810

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMCVSY-AYKCHYDEQ 51
          KKR +  K+C  CR+RK RCD   P C  CVS     C Y E+
Sbjct: 45 KKRNKLIKSCSFCRRRKLRCDQQKPMCSTCVSRNLMTCRYAEE 87

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 12 KRQRARKACVPCRQRKRRCDGANPCGMCVSYAYKCHY 48
          K+  A++AC  CR R+ +CDG  PC  C+ +   C Y
Sbjct: 5  KQTCAKQACDCCRVRRVKCDGKGPCSSCLQHNLDCTY 41

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
          YBR240C (REAL)
          Length = 450

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 5  IPSVPHKKRQRARKACVPCRQRKRRCDGANP-CGMCVSYAYKCHYD 49
          + S P   + R    C  CR +KRRCD   P C +C  +  +C YD
Sbjct: 14 LSSKPSPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYD 59

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11 KKRQRARKACVPCRQRKRRCDGANP-CGMC--VSYAYKCHYDEQ 51
          +KR R   +C  CR+RK +CD   P C  C     A+ CHY EQ
Sbjct: 7  RKRNRVPLSCTICRKRKVKCDKTRPHCQQCSKTGVAHLCHYMEQ 50

>TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON}
          Anc_5.322 YHR056C
          Length = 852

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 12 KRQRARKACVPCRQRKRRCDGANP-CGMC-VSYAYKCHYDEQGDPATLPAPLIPEIPDST 69
          ++ R   ACV CR+RK  CD   P CG C  S  Y C + +      +P    P + +  
Sbjct: 6  RKMRKPPACVQCRRRKIGCDRVKPVCGNCNKSGKYDCFFPD------VPGMYTPSVSNYE 59

Query: 70 RSISPPRTR-MVAKPPSIRTKILLNSTQ 96
          R  +P  ++  VA    +R  +L  + Q
Sbjct: 60 RKTTPKVSKAQVAMDHHVRESLLHKNDQ 87

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
          similarities with uniprot|P25502 Saccharomyces
          cerevisiae YKL015W PUT3 Positive regulator of PUT
          (proline utilization) genes zinc-finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 703

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 15 RARKACVPCRQRKRRCDGANPCGMCV 40
          ++++AC  C++RK+RC G  PC  CV
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCV 38

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 96/248 (38%), Gaps = 26/248 (10%)

Query: 111 YMGLSSAVAFARSLGIELQSANPPHLHSFAWNCGLRSEEKSNTHCAL--HDLITKEETFH 168
           + G  SA++  RS+G           +   +N  + ++E ++       + L ++  T  
Sbjct: 219 FYGNGSAISILRSIG----------FNGDYFNSSVTTKEIASPSLVTDKYSLSSRATTSR 268

Query: 169 FTQIYFSAIHPVFDVVDPEHFKKSVESYWNDGCKVSAFGAVVGGIIALGSLFSGRPGHPR 228
           F   YF   HP F ++  E       +  N   K   +  +   ++A+G+          
Sbjct: 269 FIDSYFQNFHPFFPLLHSETLLMLYNNQINSVAK-DQWQILFNTVLAIGAWCLEGDSTDI 327

Query: 229 ELEIVQYAKNVLEDPTFSRLPSAEQVSAWVLRTLYLRATTRPHAAWLASCVTIHLAEASA 288
           +L   Q AK+ L         S   V A  L + Y +   +P+ ++     +I +A +  
Sbjct: 328 DLFYYQNAKSHLTGAKIFETGSVTLVIALHLLSQYTQWRQKPNTSFNFHGHSIRMAISLG 387

Query: 289 LHHEVENVELTANDKALPPRTKKITERARRLFWCAWSINSILSYDYGRS---SASLGGIS 345
           LH E+           L  +   + E+ RR++W  +S    L+  YGR       L  I+
Sbjct: 388 LHKEL----------PLNFKDNSVKEQRRRIWWYIYSQEFHLALSYGRPLQFLMDLNEIT 437

Query: 346 CKLPTKSD 353
             LP+  D
Sbjct: 438 IALPSTLD 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.132    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,365,683
Number of extensions: 2256457
Number of successful extensions: 7562
Number of sequences better than 10.0: 696
Number of HSP's gapped: 7670
Number of HSP's successfully gapped: 710
Length of query: 561
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 446
Effective length of database: 40,294,809
Effective search space: 17971484814
Effective search space used: 17971484814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)