Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C04070g8.830ON1131135792e-78
Kwal_27.103288.830ON1271134422e-57
YML108W8.830ON1051053222e-39
SAKL0D01738g8.830ON1781053264e-39
Smik_13.268.830ON1051053197e-39
Suva_13.368.830ON1051053171e-38
Skud_13.338.830ON1051053171e-38
Kpol_1069.38.830ON1151053093e-37
ZYRO0G13970g8.830ON1121022991e-35
KLLA0D01661g8.830ON1121052981e-35
KNAG0G033608.830ON1111022962e-35
AAL184W8.830ON1121112911e-34
TBLA0B031908.830ON1221172912e-34
TDEL0B006708.830ON1111042867e-34
Ecym_27118.830ON1151122851e-33
NCAS0B011008.830ON1151062851e-33
NDAI0E003608.830ON1221202842e-33
TPHA0I001908.830ON138942827e-33
KAFR0A027608.830ON1121072693e-31
CAGL0J06666g8.830ON1121002651e-30
KLTH0B03564g5.194ON38149661.1
Ecym_44697.157ON43341642.3
TPHA0H020206.285ON13435622.8
Skud_14.2842.267ON65654632.8
NCAS0A014705.234ON17164614.0
ADR015W7.157ON43641614.9
KLTH0F13398g7.157ON41941607.6
TDEL0G031302.383ON57920599.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C04070g
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   227   2e-78
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   174   2e-57
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   128   2e-39
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   130   4e-39
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   127   7e-39
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   126   1e-38
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   126   1e-38
Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   123   3e-37
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   119   1e-35
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   119   1e-35
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   118   2e-35
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   116   1e-34
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   116   2e-34
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   114   7e-34
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   114   1e-33
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   114   1e-33
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   114   2e-33
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   113   7e-33
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   108   3e-31
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   106   1e-30
KLTH0B03564g Chr2 (287100..288245) [1146 bp, 381 aa] {ON} simila...    30   1.1  
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    29   2.3  
TPHA0H02020 Chr8 (478901..479305) [405 bp, 134 aa] {ON} Anc_6.28...    28   2.8  
Skud_14.284 Chr14 complement(523897..525867) [1971 bp, 656 aa] {...    29   2.8  
NCAS0A01470 Chr1 complement(287493..288008) [516 bp, 171 aa] {ON...    28   4.0  
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    28   4.9  
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    28   7.6  
TDEL0G03130 Chr7 (585728..587467) [1740 bp, 579 aa] {ON} Anc_2.383     27   9.9  

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  227 bits (579), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF
Sbjct: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEIN 113
           DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEIN
Sbjct: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEIN 113

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  174 bits (442), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 98/113 (86%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MSDER YRMLVLVED ++  G  + ++ +   APKATHEFVDELILPFEIDDMD LNEWF
Sbjct: 15  MSDERAYRMLVLVEDPVKSEGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWF 74

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEIN 113
           DKFDA+ICIPNEGFIKYEISSDGLVVLLLDRS+E+VVA+VRKFV++E   ++N
Sbjct: 75  DKFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERASDVN 127

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  128 bits (322), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/105 (61%), Positives = 78/105 (74%), Gaps = 3/105 (2%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MS    YRMLVL+ED         E E   +G P   HEFVDELILPF +D++D+LN WF
Sbjct: 1   MSKSNTYRMLVLLED---DTKINKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWF 57

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFDA+ICIPNEG IKYEISSDGL+VL+LD+  E+VV +V+KFVE
Sbjct: 58  DKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVE 102

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  130 bits (326), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 5/105 (4%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MS +  YRML+L+E+ +  + ++N      E   K +HEFVDEL+LP ++D+MD LN+WF
Sbjct: 70  MSGDNGYRMLMLLEEAIPDSSQEN-----NENTTKTSHEFVDELVLPIQVDEMDLLNDWF 124

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFD  ICIPNEG+IKYEISSDGL+VL+L++ +E+VV +VR+FVE
Sbjct: 125 DKFDEQICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVE 169

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  127 bits (319), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 64/105 (60%), Positives = 80/105 (76%), Gaps = 3/105 (2%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MS    YRMLVL+ED    A    E E   +G P   HEFVDELILPF++D++D+LN WF
Sbjct: 1   MSRNNTYRMLVLLED---DAKVNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWF 57

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFDA+ICIPNEG IKYEISSDGL+VL+LD+  E+V+ +V++FVE
Sbjct: 58  DKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVE 102

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  126 bits (317), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 3/105 (2%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           M+    YRMLVL+ED         E E   +G P   HEFVDEL+LPF++D++D+LN WF
Sbjct: 1   MAKNNTYRMLVLLED---DTKINKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVWF 57

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFDA+ICIPNEG IKYEISSDGL+VL+LD+  EDVV +V++FVE
Sbjct: 58  DKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVE 102

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  126 bits (317), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 65/105 (61%), Positives = 78/105 (74%), Gaps = 3/105 (2%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MS    YRMLVL+ED         E E   +G P   HEFVDELILPFEID++D+LN WF
Sbjct: 1   MSKSNAYRMLVLLED---DTKISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIWF 57

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFDA+ICIPNEG IKYEISSDGL+VL+LD+  ++VV +V+ FVE
Sbjct: 58  DKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVE 102

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  123 bits (309), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 83/105 (79%), Gaps = 2/105 (1%)

Query: 4   ERNYRMLVLVEDVLEQAGEKNEQETKGE--GAPKATHEFVDELILPFEIDDMDKLNEWFD 61
           E NYRML+L+E+ +E   E+  Q+ + E     K  HEFVDEL+LPF++D++D LN+WFD
Sbjct: 6   ESNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSLNDWFD 65

Query: 62  KFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEA 106
           KFD +ICIPNEG IKYEI+SDG++VL+LD+  E+V+ +V++FV++
Sbjct: 66  KFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQS 110

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
           {ON} highly similar to uniprot|Q03759 Saccharomyces
           cerevisiae YML108W defines a new subfamily of the split
           beta-alpha-beta sandwiches.
          Length = 112

 Score =  119 bits (299), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 77/102 (75%), Gaps = 9/102 (8%)

Query: 4   ERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWFDKF 63
           E +YRMLVL+E+ +  +G K E E       K  HEF+DEL+LPF +D++D+LN WFDKF
Sbjct: 5   ENSYRMLVLLEEPV--SGSKPEDE-------KKVHEFMDELVLPFNVDEIDQLNSWFDKF 55

Query: 64  DADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           D  ICIPNEG IKYEI+SDG++VL+LD+  E +V+QVR FVE
Sbjct: 56  DEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVE 97

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  119 bits (298), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 77/105 (73%), Gaps = 8/105 (7%)

Query: 2   SDERNYRMLVLVED-VLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           + E  YRML+L+E+ + E AG+  +++        ATHEFVDEL LP ++D+MD LN WF
Sbjct: 3   ATENVYRMLILLEEPISESAGDTKKKQN-------ATHEFVDELPLPIQVDEMDLLNSWF 55

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           DKFD  ICIPNEG IKYEISSDGL+VL+LD+S E +V +V  FVE
Sbjct: 56  DKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVE 100

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  118 bits (296), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 57/102 (55%), Positives = 74/102 (72%), Gaps = 1/102 (0%)

Query: 6   NYRMLVLVEDVLEQAGEKNEQETKGEGAP-KATHEFVDELILPFEIDDMDKLNEWFDKFD 64
            YRML+LVE+ LE      E  ++    P K+THE++DEL LPF +D++D LNEWFDKFD
Sbjct: 8   TYRMLILVEEPLEDDVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDALNEWFDKFD 67

Query: 65  ADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEA 106
            +ICIPNEG IKYEISSDGL+VL+L +  E V  Q++ F+E 
Sbjct: 68  EEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIET 109

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  116 bits (291), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 6/111 (5%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           M+ +  YRM++L+E+  +Q        T G     A+H+FVDEL+LP ++DD++ LN WF
Sbjct: 1   MATDNFYRMMILLEEPHKQ------HSTDGRKIENASHDFVDELLLPIQVDDLEVLNTWF 54

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDE 111
           DKFD +ICIPNEG IKYEISSDGL+VL+LD+   +V+  VR FV A   DE
Sbjct: 55  DKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQLDE 105

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  116 bits (291), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%), Gaps = 13/117 (11%)

Query: 2   SDERNYRMLVLVEDVLE------------QAGEKNEQETKGEGA-PKATHEFVDELILPF 48
           S+   YRM+VL+E+ +E             + +  E+ T  +   PK +HEF+DELILPF
Sbjct: 3   SNSVAYRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELILPF 62

Query: 49  EIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
            +D++D LNEWFDKFD  ICIPNEG IKYEI+SDGL++L+LD   + VV QV+ FV+
Sbjct: 63  HVDELDILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQ 119

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  114 bits (286), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 7   YRMLVLVEDVLEQAGEKNEQETKGEGAP--KATHEFVDELILPFEIDDMDKLNEWFDKFD 64
           Y M++ +E+ +E   E N  +  GE     K++HEFVDEL+LPF++D++D LNEWFDKFD
Sbjct: 8   YHMIIFLEESIENGQEGNSVDN-GEDKQDVKSSHEFVDELVLPFQVDEIDALNEWFDKFD 66

Query: 65  ADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAES 108
             +CIPNEG IKYEI+SDG++VLLLD+  E +V  V+ FVE  S
Sbjct: 67  EKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEENS 110

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  114 bits (285), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 51/112 (45%), Positives = 81/112 (72%), Gaps = 7/112 (6%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWF 60
           MS +  YRM++L+E+ + ++ ++N +         ATH+FVDE++LP ++D++D LN+WF
Sbjct: 4   MSADNFYRMMILLEEAIPESKDENIKAN-------ATHDFVDEVVLPMQVDELDVLNKWF 56

Query: 61  DKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAESGDEI 112
           DKFD +IC+PNEG+IKYEISSDGL+VL++ + +  +V QV+ FV     D +
Sbjct: 57  DKFDEEICLPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKNPLDNV 108

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  114 bits (285), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 83/106 (78%), Gaps = 1/106 (0%)

Query: 1   MSDERNYRMLVLVEDVLEQAGEKNEQETKGEGA-PKATHEFVDELILPFEIDDMDKLNEW 59
           MS +  YRMLVL+E+ +E+    +   T  +   PK THEF++EL+LPFE+ ++D LN+W
Sbjct: 1   MSKDNMYRMLVLLEEEMEEPELFDNDTTDSKATEPKKTHEFIEELLLPFEVSELDALNKW 60

Query: 60  FDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVE 105
           FDKFD +ICIPNEG IKYEISSDGL+VLLLD+  E+V+++V+KF++
Sbjct: 61  FDKFDEEICIPNEGHIKYEISSDGLIVLLLDKEIENVISEVKKFID 106

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  114 bits (284), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 61/120 (50%), Positives = 81/120 (67%), Gaps = 14/120 (11%)

Query: 1   MSDERN-YRMLVLVEDVLEQAG-------EKNEQETKG------EGAPKATHEFVDELIL 46
           MS   N YR+++L+E+ + +         E  E ETK       E   K  HEF++ELIL
Sbjct: 1   MSSTNNMYRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELIL 60

Query: 47  PFEIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEA 106
           PF  +++D LNEWFDKFD +ICIPNEG IKYEI+SDGL+VLLLD+  EDVV +++KF+E 
Sbjct: 61  PFGTEELDLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIET 120

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  113 bits (282), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 55/94 (58%), Positives = 73/94 (77%), Gaps = 7/94 (7%)

Query: 13  VEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWFDKFDADICIPNE 72
           V++V E   EK E ++K       +HEFVDELILPF +D++D LNEWFDKFD ++CIPNE
Sbjct: 31  VKEVNEHNVEKGETQSK-------SHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNE 83

Query: 73  GFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEA 106
           G IKYEI+SDGL+VL+LD+  E VV++V++FV A
Sbjct: 84  GHIKYEITSDGLIVLMLDKEIEHVVSKVKEFVSA 117

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  108 bits (269), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/107 (61%), Positives = 81/107 (75%), Gaps = 6/107 (5%)

Query: 2   SDERNYRMLVLVEDVLEQAGEKNEQETKGEGAPKA----THEFVDELILPFEIDDMDKLN 57
           SD R YRMLVL+E+  E+  EK E    GE  PK     +HEF++ELILPFE  ++D LN
Sbjct: 4   SDNR-YRMLVLLEEESEEVIEKFEDNDNGE-QPKQESTKSHEFIEELILPFETSELDTLN 61

Query: 58  EWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFV 104
           EWFDKFD +ICIPNEG IKYEISSDGLVVLL+D+  E+VV +V++FV
Sbjct: 62  EWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQIENVVEKVKEFV 108

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  106 bits (265), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 5/100 (5%)

Query: 7   YRMLVLVEDVLEQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWFDKFDAD 66
           YRM+VL    LE+  E++   +  +   K  HEF+DEL LPF+ID++D LN+WFDKFD +
Sbjct: 5   YRMMVL----LEEPMEEDITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFDDE 60

Query: 67  ICIPNEGFIKYEISSDGLVVLLLDRS-KEDVVAQVRKFVE 105
           ICIPNEG IKYEI+SDGL+VL+LD+   E+ V +V+ FVE
Sbjct: 61  ICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVE 100

>KLTH0B03564g Chr2 (287100..288245) [1146 bp, 381 aa] {ON} similar
           to uniprot|P48362 Saccharomyces cerevisiae YGR187C
          Length = 381

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 9/49 (18%)

Query: 71  NEGFIKY---------EISSDGLVVLLLDRSKEDVVAQVRKFVEAESGD 110
           +EGF+KY           S+D + +LL + +KED + +V  F   +S D
Sbjct: 85  DEGFLKYLTCKICDLRNTSADIMCILLTNLAKEDCITKVFSFTTMDSKD 133

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 29.3 bits (64), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 34 PKATHEFVDELILPFEIDDMDKLNEWFDKFDADICIPNEGF 74
          PKAT  F   +   +++   D+L   +DKF  D  +P  GF
Sbjct: 42 PKATERF-QAISEAYQVLGSDELRAKYDKFGKDEAVPQNGF 81

>TPHA0H02020 Chr8 (478901..479305) [405 bp, 134 aa] {ON} Anc_6.285
           YPL250C
          Length = 134

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 40  FVDELILPFEIDDMDKLNEWFDKFDADICIPNEGF 74
           F  E+  P+E++D++K+N  F     ++ I N GF
Sbjct: 79  FSMEIQQPYELNDINKINNSFTSAITNMSISNYGF 113

>Skud_14.284 Chr14 complement(523897..525867) [1971 bp, 656 aa] {ON}
           YNL047C (REAL)
          Length = 656

 Score = 28.9 bits (63), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 23/54 (42%), Gaps = 6/54 (11%)

Query: 18  EQAGEKNEQETKGEGAPKATHEFVDELILPFEIDDMDKLNEWFDKFDADICIPN 71
           EQ   K    T   G     H +V      F++D  D + EWFD  +A   +PN
Sbjct: 511 EQGNNKFILRTNSNGLIHRGHNWV------FKVDSYDDMIEWFDNINALSSLPN 558

>NCAS0A01470 Chr1 complement(287493..288008) [516 bp, 171 aa] {ON}
           Anc_5.234 YLR010C
          Length = 171

 Score = 28.1 bits (61), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 48  FEIDDMDKLNEWFDKFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEAE 107
           F+I+  ++  E +D  D  + I N GFI  +     + +L L+      V Q+R+F+ + 
Sbjct: 97  FDINCSNRTPELYDAVDLTVAIWNNGFINIKCEVIDIEILNLEE-----VNQLREFIASP 151

Query: 108 SGDE 111
            G E
Sbjct: 152 MGQE 155

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 34 PKATHEFVDELILPFEIDDMDKLNEWFDKFDADICIPNEGF 74
          PKAT  F   +   +++   D+L   +DKF  +  +P  GF
Sbjct: 42 PKATERF-QAISEAYQVLSSDELRAKYDKFGKEEAVPQNGF 81

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 34 PKATHEFVDELILPFEIDDMDKLNEWFDKFDADICIPNEGF 74
          P AT  F   +   +++   D L   +DKF  +  +P EGF
Sbjct: 42 PTATERF-QAISQAYQVLSKDDLRAKYDKFGKEEAVPKEGF 81

>TDEL0G03130 Chr7 (585728..587467) [1740 bp, 579 aa] {ON} Anc_2.383
          Length = 579

 Score = 27.3 bits (59), Expect = 9.9,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 53  MDKLNEWFDKFDADICIPNE 72
           +DKLNE F K  A++CI N+
Sbjct: 346 IDKLNEAFTKLYANVCIKNQ 365

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.137    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,711,651
Number of extensions: 555885
Number of successful extensions: 1492
Number of sequences better than 10.0: 51
Number of HSP's gapped: 1482
Number of HSP's successfully gapped: 51
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)