Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C04048g8.831ON93593542850.0
Kwal_27.103188.831ON92595516950.0
Smik_13.258.831ON94996410441e-126
SAKL0D01716g8.831ON9427548538e-99
ZYRO0G13992g8.831ON12114216161e-65
YML109W (ZDS2)8.831ON9424496032e-64
YMR273C (ZDS1)8.831ON9154615906e-63
Smik_13.4868.831ON9234535853e-62
NCAS0B011108.831ON9934865854e-62
KAFR0A027708.831ON8844665816e-62
Skud_13.328.831ON9484485792e-61
Skud_13.4458.831ON8984955702e-60
Suva_13.4618.831ON9314505501e-57
Kpol_541.108.831ON10564655333e-55
Kpol_1069.28.831ON10014885146e-53
KLLA0D01683g8.831ON9441085064e-52
AAL185W8.831ON10181235022e-51
TDEL0B006608.831ON9594014701e-47
TPHA0I002008.831ON10491124641e-46
NDAI0E003508.831ON11631194596e-46
Suva_13.358.831ON9824094523e-45
KNAG0G033708.831ON1076974499e-45
CAGL0J06688g8.831ON8283834173e-41
CAGL0F03421g8.831ON8171154146e-41
KAFR0B038608.831ON843964067e-40
Ecym_27108.831ON8962883971e-38
TPHA0C047208.831ON10721163981e-38
TBLA0D031908.831ON16821044001e-38
TBLA0B032008.831ON1086933901e-37
KLLA0C17644g8.231ON157688762.7
TPHA0B034008.231ON1593111753.0
NCAS0A036708.231ON1591136753.4
KLTH0F03564g1.134ON141569753.6
KLLA0C08723g6.333ON95890726.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C04048g
         (935 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} simila...  1655   0.0  
Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273...   657   0.0  
Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W (...   406   e-126
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...   333   8e-99
ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa...   241   1e-65
YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein...   236   2e-64
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...   231   6e-63
Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {...   229   3e-62
NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {O...   229   4e-62
KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {O...   228   6e-62
Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W (...   227   2e-61
Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {...   224   2e-60
Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {...   216   1e-57
Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON...   209   3e-55
Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..45...   202   6e-53
KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {...   199   4e-52
AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homo...   197   2e-51
TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.8...   185   1e-47
TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON...   183   1e-46
NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.83...   181   6e-46
Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W (...   178   3e-45
KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {...   177   9e-45
CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa] ...   165   3e-41
CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {...   164   6e-41
KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {O...   160   7e-40
Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar...   157   1e-38
TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa]...   157   1e-38
TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {...   158   1e-38
TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {...   154   1e-37
KLLA0C17644g Chr3 (1557138..1561868) [4731 bp, 1576 aa] {ON} sim...    34   2.7  
TPHA0B03400 Chr2 complement(787511..792292) [4782 bp, 1593 aa] {...    33   3.0  
NCAS0A03670 Chr1 complement(732993..737768) [4776 bp, 1591 aa] {...    33   3.4  
KLTH0F03564g Chr6 (309896..314143) [4248 bp, 1415 aa] {ON} weakl...    33   3.6  
KLLA0C08723g Chr3 (762625..765501) [2877 bp, 958 aa] {ON} simila...    32   6.7  

>KLTH0C04048g Chr3 (352955..355762) [2808 bp, 935 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 935

 Score = 1655 bits (4285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 828/935 (88%), Positives = 828/935 (88%)

Query: 1   MSVVSQKQENQALKVGDVQGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRI 60
           MSVVSQKQENQALKVGDVQGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRI
Sbjct: 1   MSVVSQKQENQALKVGDVQGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRI 60

Query: 61  SIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQXXXXXXXXXXXXXXXXXXXXIDITS 120
           SIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQ                    IDITS
Sbjct: 61  SIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQLYNSHSDHDSDDDLSYVNDSIDITS 120

Query: 121 TEYLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLL 180
           TEYLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLL
Sbjct: 121 TEYLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLL 180

Query: 181 WVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXXXXXXXXXQ 240
           WVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVH             Q
Sbjct: 181 WVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHAPAAASANLPPSNQ 240

Query: 241 LRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPRIGSRSS 300
           LRSGLNSLVRRPSGLRKSFT            TSGGDENAELPSADKMPSVRPRIGSRSS
Sbjct: 241 LRSGLNSLVRRPSGLRKSFTELEDLLLQEAQDTSGGDENAELPSADKMPSVRPRIGSRSS 300

Query: 301 SLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASSM 360
           SLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASSM
Sbjct: 301 SLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASSM 360

Query: 361 LTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIRVDQKNAQ 420
           LTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIRVDQKNAQ
Sbjct: 361 LTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIRVDQKNAQ 420

Query: 421 LQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPKXXXXXXXXXX 480
           LQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPK          
Sbjct: 421 LQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPKDDTLLDSESS 480

Query: 481 XXXXHKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPRXXXXXXXXXXXXXXD 540
               HKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPR              D
Sbjct: 481 LHDLHKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPRKKSGWSWFGKKSSKD 540

Query: 541 QESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRHYSIDDTANXXXXXXXXXXXXX 600
           QESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRHYSIDDTAN             
Sbjct: 541 QESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRHYSIDDTANSSTESTTSNTVSS 600

Query: 601 XXXXXKKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLR 660
                KKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLR
Sbjct: 601 SQSPTKKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLR 660

Query: 661 KNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQD 720
           KNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQD
Sbjct: 661 KNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQD 720

Query: 721 KPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHEGITESNTQAEAD 780
           KPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHEGITESNTQAEAD
Sbjct: 721 KPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHEGITESNTQAEAD 780

Query: 781 TVXXXXXXXXXXXXXXXXFTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPM 840
           TV                FTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPM
Sbjct: 781 TVTAYAPEETAAASADDSFTKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPM 840

Query: 841 KFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMY 900
           KFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMY
Sbjct: 841 KFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMY 900

Query: 901 AYLNLVNHSLYLQQLDEEGPTGVDAAGMDGMTASL 935
           AYLNLVNHSLYLQQLDEEGPTGVDAAGMDGMTASL
Sbjct: 901 AYLNLVNHSLYLQQLDEEGPTGVDAAGMDGMTASL 935

>Kwal_27.10318 s27 (284806..287583) [2778 bp, 925 aa] {ON} YMR273C
           (ZDS1) - peripheral plasma membrane protein [contig 36]
           FULL
          Length = 925

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/955 (46%), Positives = 563/955 (58%), Gaps = 66/955 (6%)

Query: 4   VSQKQENQALKVGDVQGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIG 63
           + Q+++++A    D++ +  +  + +  RSEKRKSEVLIAAQSLDSELQHVKNLKR+S G
Sbjct: 1   MDQERDHRASLNNDMRDQSVSGNTRRSARSEKRKSEVLIAAQSLDSELQHVKNLKRMSFG 60

Query: 64  SMDMLIDPEMEFRVSPSPSQPAPTTD-TSHDQQXXXXXXXXXXXXXXXXXXXXIDITSTE 122
           SMD+ +DPEMEFR+SPS SQ + ++D  S + Q                    I++T+ E
Sbjct: 61  SMDLPLDPEMEFRMSPSHSQRSSSSDAVSLESQAEEPNQDDDSDDNLSYLNDSIELTAHE 120

Query: 123 YLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWV 182
           YL+E      E    S ++     R LSGVRRGG+S K R    LS   +++VT NL WV
Sbjct: 121 YLEEPRDFLVERSSVSKSEDSHNGRNLSGVRRGGMSKKPR---ELSNGGDDNVTQNLFWV 177

Query: 183 PANQHPNIKPENYLELVQDTLHTLKI----EPDNEGSVEGGNDEKIVHXXXXXXXXXXXX 238
           PANQHPN+KPENYLELVQDTLHTL I    EP  + +VEG N                  
Sbjct: 178 PANQHPNVKPENYLELVQDTLHTLSIDSEVEPPTDKTVEGNNP-----YLASANTKASPS 232

Query: 239 XQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPRIGSR 298
            QLRSG NSLVRRPSGLRKS+T            +   +ENA+    + +   RPR  S 
Sbjct: 233 SQLRSGQNSLVRRPSGLRKSYTELEDLLQHEIQDSDENNENAQ-SELNNIIKNRPRATSS 291

Query: 299 SSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESV-----GSPEKKPE 353
            SSLKDITEELTRISN+AGFTDGDAV LARTLSMASSY    DGE        + +  P+
Sbjct: 292 GSSLKDITEELTRISNKAGFTDGDAVCLARTLSMASSY----DGEQSQANQSANTDHTPD 347

Query: 354 KEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIR 413
            EYAS++LTKNGLAIPARSSLRRSKFNTYRIR T  GS+  S+    ++  NE  + P  
Sbjct: 348 SEYASTILTKNGLAIPARSSLRRSKFNTYRIR-TPNGSSVTSSSLRSTSLPNEERKDPEG 406

Query: 414 VDQKNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFHSIASKRPKXXX 473
             +K+ +L+SPTSVNDFNEIYDHYRQ S  S+  + PH   N  +S      S       
Sbjct: 407 YIEKSDRLRSPTSVNDFNEIYDHYRQGSVGST--SEPHAVDNDASSASPFNKSLVHPSHH 464

Query: 474 XXXXXXXXXXXHKGSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPRXXXXXXXX 533
                       K S +K L+   +   +G+     N E   +K + +Q  R        
Sbjct: 465 ETHLNEESESSSKHSTDKTLNYPLEKDGKGNNSKAKNKE---NKPSGTQILRKKSSWNWF 521

Query: 534 XXXXXXDQESSPEHTQRVSSDFLGVSSSAKPTNVPTEKINHSRHRHYSIDDTANXXXXXX 593
                 DQ+ + +  Q   SDFL VS +AK + +PTEK+NHSRHRHYSID  +       
Sbjct: 522 GKKTSKDQDIANDDEQNTFSDFLSVSGNAKTSYIPTEKVNHSRHRHYSID--SGSRGSIA 579

Query: 594 XXXXXXXXXXXXKKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTR 653
                       KKQ++EKKFIQLFKR+RT ST  R+K+D  +      S N   +LKT+
Sbjct: 580 ADPSKLAVSSSPKKQKREKKFIQLFKRSRTASTGSRDKEDKVNYLGGT-SGNPTDMLKTK 638

Query: 654 TSSTNLRKNRLSPKKTRL---SGDGRRESVKE---DFGSTQDYKVVREEKEPLAKLQPSV 707
            SS N+ K  L  +  ++    G+ R  S+ E   D GS  D  +    ++ +AKLQPSV
Sbjct: 639 ASSRNVSKPTLDVQPAKIPTIGGERRSASLDESSLDKGSDLDQGM----EKSVAKLQPSV 694

Query: 708 SLTPKSRPPLTQDKPKQNNVGEDLRLNNQDK----HRADSVLDSDSEPELEADEEAGPRT 763
            LT K++  ++       +V E+ ++   +K    H+ + V +SD++ E E D +     
Sbjct: 695 CLTSKAKNEVSTPV----HVVENPQVQGANKLDGEHQVEPVFESDTDTESETDLQG---- 746

Query: 764 DAIHEG--ITESNTQAEADT--VXXXXXXXXXXXXXXXXFTKSQ----EPNAP-ELQAPA 814
            ++ +G  + +S +  +ADT  V                   S     E NA  +  APA
Sbjct: 747 -SLKQGFEVKQSASVEKADTQPVIQLEEPFQQKQASRKDVQDSSPVDIEDNAGIDPMAPA 805

Query: 815 AGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAI 874
           AGGY LPPRKL FSDV+KPERPN+PMKFSDSSFGFPLPPLT+STVVMIDHRL INVERAI
Sbjct: 806 AGGYTLPPRKLTFSDVVKPERPNSPMKFSDSSFGFPLPPLTISTVVMIDHRLTINVERAI 865

Query: 875 YRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMD 929
           YRLSHLKLGDPKRELRQQV+LSNFMYAYLNLVNHSLYLQQL+E+ P   D+A  D
Sbjct: 866 YRLSHLKLGDPKRELRQQVVLSNFMYAYLNLVNHSLYLQQLEEDNP--ADSASND 918

>Smik_13.25 Chr13 (47889..50738) [2850 bp, 949 aa] {ON} YML109W
           (REAL)
          Length = 949

 Score =  406 bits (1044), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 331/964 (34%), Positives = 464/964 (48%), Gaps = 145/964 (15%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTS-- 91
           EKRKS+V IAA+SLD+E+Q+VKNLKR+SIGSMD++IDPE+EF+V+   S  + ++  S  
Sbjct: 47  EKRKSDVFIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 106

Query: 92  ------------HDQQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESL---- 135
                        +++                    IDIT TEYL + E    E +    
Sbjct: 107 ESLCEEDVIQPKQEEEKRGEDNDAYEEGEATNADDSIDITQTEYLHDEETLEKEKIFYNA 166

Query: 136 --GSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPE 193
              +SS    C  R LSGV+           ++  +K  +  T NLLWVPANQHPN+KPE
Sbjct: 167 PSSTSSARVTCRNRRLSGVKALAHDAVLEAMDDHESKTVD-FTQNLLWVPANQHPNVKPE 225

Query: 194 NYLELVQDTLHTLKIEPD---NEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLVR 250
           NYLEL+QDTL  ++I  D    E ++E GN+  I++               R    S+VR
Sbjct: 226 NYLELIQDTLQNIQISTDEDSGESTLEVGNNHVILN---------------RKSSGSIVR 270

Query: 251 RPSGLRKSFTXXXXXXXXXXXXTSGGDE-NAELPSADKMPSVRPRIGSRSSSLKDITEEL 309
           RPS L+ S+T              G ++ N  +PS++    VR     RS SLK+ITEEL
Sbjct: 271 RPSRLKTSYTKFDDEISVADKPEVGQEQVNKRIPSSE----VR---TIRSVSLKEITEEL 323

Query: 310 TRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASSMLTKNGLAIP 369
           T+ISN AG T  +AV+LAR+LSM+ S +T+E+   + S + + + E+AS+M  ++G  IP
Sbjct: 324 TKISNNAGLTGSNAVTLARSLSMSGS-FTNENL-LLKSNDAENDSEFASNMFNESGRTIP 381

Query: 370 ARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIRVDQKNAQL-QSPTSVN 428
            RSSLRRSKFNTY+IR    G    +NL++        DR         A+L Q   S+N
Sbjct: 382 ERSSLRRSKFNTYKIRLEGSGLPQAANLKNLMNMRTSDDRRSTSSPACYARLPQEQGSLN 441

Query: 429 DFNEIYDHYRQSSFDSSLGAYPHEHQNAHTSNFH---------SIASKRPKXXXXXXXXX 479
           DF EI+DHYR++S D S        +   + N+H         SI+              
Sbjct: 442 DFQEIFDHYRRTSTDWSTDWSTENAKYDDSPNYHSDEEDLTHASISQDSSLLSTDSSNNS 501

Query: 480 XXXXXHK-GSLNKALDDEQQASFRGHVEATNNDEKDDHKHASSQAPRXXXXXXXXXXXXX 538
                H  GS+     D+Q  S R   +  NN  +  H  +                   
Sbjct: 502 VLVKPHNAGSMISERLDQQHVSSRE--DENNNISEPSHGWSWLNYSNENLNNNDNTHEQF 559

Query: 539 XDQESSPEHTQRVSSDF--LGVSSSAKPTNVPTEKINHSRHRHYSI-------------- 582
            D +      +   +DF  L VS   K T   +E+INHS++RH  I              
Sbjct: 560 IDDQDDDGCVENEKADFVNLSVSRRTKSTKRASERINHSKNRHSPIFQVRSDESKSPIIT 619

Query: 583 ------------DDTANXXXXXXXXXXXXXXXXXXKKQRKEKKFIQLFKRNRTTSTNGRE 630
                       D T                    KK+  EK+   LFKR + +      
Sbjct: 620 PPVLSSSSSQSSDPTVLSVTEKKLESPNDDKTNTHKKKSLEKRLAGLFKRRQQS------ 673

Query: 631 KDDGPSISE-KLQSSNAVKVLKTRTSSTNLRKNRLSPKKTRLSGDGRRESVKEDFGSTQD 689
              GPS S+ K+   +  K LK + S + L K R SPKK                   ++
Sbjct: 674 ---GPSKSDVKVIKKSVRKELKKKASHSGLSKFRKSPKK-----------------KFKE 713

Query: 690 YKVVREEKEPLAKLQPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDS 749
            KV +E   P  +   +  +  +S    T   P  + +  D  ++    H ++ V+++ S
Sbjct: 714 AKVNQECPSPPVETDSTGDVDTESTIQSTIQNPNTSTILSDRNIS----HSSEFVVETIS 769

Query: 750 EPELEADEEAGPRTDAIHEGITESNTQAEADTVXXXXXXXXXXXXXXXXFTKSQEPN--- 806
             EL+ D+      + I+  + E ++  + DT                   + QE +   
Sbjct: 770 --ELDGDDSFDISGNDINYNV-EVHSNIDRDTAAGSDDS-----------IEQQEESIIP 815

Query: 807 APELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRL 866
           +PE Q P      L PRKL F DV+KP+ PNAP+KF+DS+FGFPLP +T STV+M DHRL
Sbjct: 816 SPETQTPN-----LIPRKLTFGDVVKPKYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRL 870

Query: 867 PINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPT--GVD 924
            INVERAIYRLSHLKL DP RELRQQV+LSNFMY+YLNLVNH+LY++Q+  E     G  
Sbjct: 871 GINVERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQMGSEDVVFNGDS 930

Query: 925 AAGM 928
           A GM
Sbjct: 931 ALGM 934

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score =  333 bits (853), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 270/754 (35%), Positives = 378/754 (50%), Gaps = 77/754 (10%)

Query: 14  KVGDVQGRGSNKGSEQ---------PGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGS 64
           K+ D + RG     E+         P   EKRKSEVLIAAQSLD+ELQ+VKNLKR+SIGS
Sbjct: 5   KLDDARIRGQQMDEEEYQASKIRNSPTSKEKRKSEVLIAAQSLDNELQNVKNLKRLSIGS 64

Query: 65  MDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQXXXXXXXXXXXXXXXXXXXXIDITSTEYL 124
           MD+L+DPEMEFR++ S S     + +S +++                    +DIT TEYL
Sbjct: 65  MDLLMDPEMEFRINSSLSSSPTKSLSSEEEENDKEGYAEEYDDDYSYSEDSMDITKTEYL 124

Query: 125 QE---------SEGTGFESLGSSSN---------DADCGKRTLSG---VRRGG-LSGKTR 162
            +         + G    S+G S +         D    +R LSG   VRRGG LS ++R
Sbjct: 125 HDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALSGTGSVRRGGVLSNRSR 184

Query: 163 MNNNL--SAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGN 220
           ++        DEE++T NLLWVPANQHP++KPENYLELVQDTL  L++E          N
Sbjct: 185 LSGGKLNDPNDEEALTQNLLWVPANQHPSVKPENYLELVQDTLQNLQLENGVRDESNKEN 244

Query: 221 DEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENA 280
             K++H              ++ G NSLVRRPS LRKS+T                 E  
Sbjct: 245 TVKLIHGLNSNVSQLP----IQQGKNSLVRRPSRLRKSYTEFEDT------------EEY 288

Query: 281 ELPSADKMPSVRPRIGS-RSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYY-- 337
            LP +    S+   + + RS SL++IT+ELT++SN AG TD DA++LARTLSMAS++Y  
Sbjct: 289 NLPISGNSSSLPSSVPTPRSVSLREITDELTKVSNNAGLTDSDAITLARTLSMASTFYEG 348

Query: 338 TDEDGESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGST---AP 394
           ++ + E+  + EK  E E+AS+ML +N LAIPARSSLRRSKFNTYRIR  SG ST   A 
Sbjct: 349 SNSEKENQSNTEKAEEDEFASNMLNQNSLAIPARSSLRRSKFNTYRIRTPSGSSTNEFAQ 408

Query: 395 SNLRSPSAEHNELDRSPIRVDQ------KNAQLQSPTSVNDFNEIYDHYRQSSFDSSLGA 448
           SNL+  S E N      + V++      +   L SP+++ND  +IYDHY  SS + SL  
Sbjct: 409 SNLKVSSTEENPQPEIEVAVEETLPRVLEEHILNSPSTINDMQDIYDHYDTSSVEESLPP 468

Query: 449 YPHEHQNAHTSNFHSIASKRPKXXXXXXXXXXXXXXHKGSLNKALDDEQQASFRGHV-EA 507
               + +A     +   S                   K S+ +   D  Q  F   V E+
Sbjct: 469 QNSNYSSAQQDGDNLQDSPDSSDFSTDSSTANAILKSKQSIVQTKSDSIQKEFLSPVTES 528

Query: 508 TNNDEKDDHKHASSQAPRXXXXXXXXXXXXXXDQESSPEHTQRVSSDFLGVSSSAKPT-- 565
           T  D K   K                      + + S +HT R SSDF  V S +  T  
Sbjct: 529 TTADVKRQKKKGG----WSWFNKKSKKEPEEDNLKQSEQHTHRDSSDFFNVLSPSNGTSK 584

Query: 566 -NVPTEKINHSRHRHYSIDDTANXXXXXXXXXXXXXXXXXXKKQRKEKKFIQLFKRNRTT 624
            N+P+ +INHSR+RH+S+   +N                  +K++K +K      + +  
Sbjct: 585 HNLPSNRINHSRNRHHSVVPASNDGSTSTATPTDMEMEKLPQKKQKLEKKFIKLFKKKHV 644

Query: 625 STNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLRK-----NRLSPKKTRLSGDGRRES 679
           S + +EKD+  S+  +  SS  VK LK + S ++L K     N++       + D  +  
Sbjct: 645 SPDRKEKDNEISVRPETHSSKPVKELKNKASISSLSKICIGSNKVDENVDLTAKDRLKPR 704

Query: 680 VK---EDFGSTQDYKVVREEKEPLAKLQPSVSLT 710
           V    +D  + Q+     +  E L  LQP+VS+T
Sbjct: 705 VSPGTKDVTNFQNESFESDGLEELPTLQPAVSVT 738

 Score =  197 bits (502), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 91/120 (75%), Positives = 100/120 (83%), Gaps = 3/120 (2%)

Query: 812 APAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVE 871
           +P    + LPPRKL F DV +PE PNAPMKF+DS+FGFPLPPLTVSTV+M DHRLPINVE
Sbjct: 800 SPTNDPHRLPPRKLVFEDVKRPEYPNAPMKFTDSAFGFPLPPLTVSTVIMFDHRLPINVE 859

Query: 872 RAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMDGM 931
           RAIYRLSHLKL DPKRELRQQV+LSNFMYAYLNLVNHSLYLQQ++EE    V   G D M
Sbjct: 860 RAIYRLSHLKLSDPKRELRQQVLLSNFMYAYLNLVNHSLYLQQVEEENSMIV---GDDSM 916

>ZYRO0G13992g Chr7 complement(1112324..1115959) [3636 bp, 1211 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109W ZDS2 Protein that interacts with silencing
           proteins at the telomere involved in transcriptional
           silencing paralog of Zds1p
          Length = 1211

 Score =  241 bits (616), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 171/421 (40%), Positives = 226/421 (53%), Gaps = 75/421 (17%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPS------------- 80
           EKRKSEV+IAAQSLD+E+Q VKNLKRISIGSMDML+DPE+E+RVS +             
Sbjct: 56  EKRKSEVMIAAQSLDNEVQSVKNLKRISIGSMDMLLDPELEYRVSSNAGKQENRKSWTSG 115

Query: 81  -PSQPAPTTDTSHDQQXXXXXXXXXXXX-------XXXXXXXXIDITSTEYL-------- 124
            P++PA   +   ++                             D+T++EYL        
Sbjct: 116 VPARPAEEVENMQNRATVRYTYPSRAVEGEPDESFESELSEISFDVTNSEYLEGLDPNDD 175

Query: 125 ---QESEGTGFESLGSSSNDADCGKRTLSGV---RRGGLS---GKTRMNNNLSAKDEESV 175
              Q+SE    +  GS  +      R++SGV   +RG  +    KT  +++ S+    S+
Sbjct: 176 SSIQKSENDTTDLRGSQKSQVSSSGRSISGVGTLKRGASNIPLRKTSTSSDASSGSNGSL 235

Query: 176 THNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGND-----EKIVHXXXX 230
           T NLLWVPANQHPN+KPENYLELVQDTLH +++E + +   + GND      K+ H    
Sbjct: 236 TKNLLWVPANQHPNVKPENYLELVQDTLHNIRLEGNEDE--QTGNDMNTTTAKVEHGTNK 293

Query: 231 XXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSG-----GDENAELPSA 285
                     L    NSLVR+PS LRKS+T            TSG       E+ E  S 
Sbjct: 294 ENEDKGY---LPRKNNSLVRKPSRLRKSYT-EFDEENDDYLDTSGFSKKRSSEDVEDASN 349

Query: 286 DKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDED---- 341
             + S      SR+ SL+DIT+ELT+ISN AG TD DA++LARTLSMA S+ +DE     
Sbjct: 350 LTISSTN---SSRAVSLRDITDELTKISNNAGLTDSDAITLARTLSMAGSFTSDEPDDII 406

Query: 342 --------------GESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNT 387
                          E+    +K+ + E+AS+M  KNG  IPARSSLRRSKFNTYR+R+ 
Sbjct: 407 ENSRGTQGDDLQYYNEADAMEKKEDDAEFASNMFMKNGFVIPARSSLRRSKFNTYRVRSA 466

Query: 388 S 388
           S
Sbjct: 467 S 467

 Score =  186 bits (471), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 92/100 (92%)

Query: 820  LPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSH 879
            LP RKL FSDV + +RPNAPM+F+DS+FGFPLP LTVSTVVM DHRLPINVERAIYRLSH
Sbjct: 1070 LPARKLTFSDVKRLDRPNAPMQFTDSAFGFPLPMLTVSTVVMFDHRLPINVERAIYRLSH 1129

Query: 880  LKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEG 919
            LKL DPKRELRQQV+LSNFMYAYLNLVNH+LY++Q+ +EG
Sbjct: 1130 LKLSDPKRELRQQVMLSNFMYAYLNLVNHTLYMEQVAQEG 1169

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 397 LRSPSAEHNELDRSPIR-VDQKNAQLQSPTSVNDFNEIYDHYRQSSFD 443
           L +P  +H+   +SP + + +  + L SP++++DF +IYDHYRQSS D
Sbjct: 545 LGTPGDQHSHGSKSPSQFIGEDGSNLTSPSTISDFQDIYDHYRQSSVD 592

>YML109W Chr13 (51640..54468) [2829 bp, 942 aa] {ON}  ZDS2Protein
           with a role in regulating Swe1p-dependent polarized
           growth; involved in maintenance of Cdc55p in the
           cytoplasm where it promotes mitotic entry; interacts
           with silencing proteins at the telomere; implicated in
           the mitotic exit network through regulation of Cdc14p
           localization; paralog of Zds1p
          Length = 942

 Score =  236 bits (603), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 180/449 (40%), Positives = 246/449 (54%), Gaps = 73/449 (16%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTT----- 88
           EKRKS+VLIAA+SLD+E+Q+VKNLKR+SIGSMD++IDPE+EF+V+   S  + ++     
Sbjct: 46  EKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVIDPELEFKVNSRNSYSSDSSKESLQ 105

Query: 89  DTSHD---------QQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESL---- 135
           ++ H+         ++                    IDIT TEYL + E    E +    
Sbjct: 106 ESLHEENIIRSEQKEEQGSEDNDAYEEGDATNVDDSIDITQTEYLHDEETLEKEKIIRNA 165

Query: 136 ---GSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKP 192
               SSS       R LSGV+         + N+  +K  + +T NLLWVPA+QHPN+KP
Sbjct: 166 SSSTSSSARVTSRNRRLSGVKTLAHDVVLDVENDHDSKMVD-LTQNLLWVPADQHPNVKP 224

Query: 193 ENYLELVQDTLHTLKIEPD---NEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLV 249
           ENYLEL+QDTL  ++I  +   +E  +E GN+  I               + R+G  S+V
Sbjct: 225 ENYLELIQDTLQNIQISTNQDIDENKLELGNNHVI-------------SNRKRTG--SVV 269

Query: 250 RRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADK----MPSVRPRIGS------RS 299
           RRPS L+ S+T                  + E P ADK       V  RI S      RS
Sbjct: 270 RRPSRLKTSYTKF----------------DDEPPLADKPQEGEIQVDKRISSSDIKTIRS 313

Query: 300 SSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEKEYASS 359
            SLK+ITEELT+ISN AG TD DAV+LAR+LSM+ S +T+E     G+   + + E+AS+
Sbjct: 314 VSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGS-FTNESLHLNGN-HTENDNEFASN 371

Query: 360 MLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPS---AEHNELDRSPIRVDQ 416
           M  + GL IP RSSLRRSKFNTY+IR    GS+ P  ++  S    + N+  RS      
Sbjct: 372 MFNETGLTIPERSSLRRSKFNTYKIR--LEGSSLPQAVKLNSLMNIQTNDNRRSASSPAS 429

Query: 417 KNAQLQSPTSVNDFNEIYDHYRQSSFDSS 445
                Q   S+NDF+EI+DHYR++S D S
Sbjct: 430 YTQVPQEQASLNDFHEIFDHYRRTSTDWS 458

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score =  231 bits (590), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 168/461 (36%), Positives = 230/461 (49%), Gaps = 92/461 (19%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFR--------------VSP 79
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+LIDPE++ +               S 
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFGGESSGRRSWSGTTSS 83

Query: 80  SPSQPAPTTDTSHDQQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSS 139
           S S P+ TT  ++ +                      D T  E L     +G E    SS
Sbjct: 84  SASMPSDTTTVNNTRYS--------------------DPTPLENLHGRGNSGIE----SS 119

Query: 140 NDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPENYLELV 199
           N    G     G+++G  S   ++N N+  K       NLLWVPANQHPN+KP+N+LELV
Sbjct: 120 NKTKQG--NYLGIKKGVHSPSRKLNANVLKK-------NLLWVPANQHPNVKPDNFLELV 170

Query: 200 QDTLHTLKIE---PDNEGSVEGGND--------EKIVHXXXXXXXXXXXXXQLRSGLNSL 248
           QDTL  +++     DN+G+    ND        E   +               R G  SL
Sbjct: 171 QDTLQNIQLSDNGEDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGLSRHGNASL 230

Query: 249 VRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEE 308
           +RRPS LR+S+T             S  +      + +K+     +I  R  SL+DITEE
Sbjct: 231 IRRPSTLRRSYTEFDDNEDDDNKGDSASE------TVNKVEERISKIKERPVSLRDITEE 284

Query: 309 LTRISNRAGFTDGDAVSLARTLSMASSYYTDED-------------GESVGSPEKKPEKE 355
           LT+ISN AG TD DA++LARTLSMA SY   +D             G S        + E
Sbjct: 285 LTKISNSAGLTDNDAITLARTLSMAGSYSDKKDQPQPEGHYDEGDIGFSTSQANTLDDGE 344

Query: 356 YASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSN---LRSPSAEHNELDRSPI 412
           +AS+M   N +  P RSSLRRS+FNTYRIR+         +   +++   E  +L ++ I
Sbjct: 345 FASNMPINNTMTWPERSSLRRSRFNTYRIRSQEQEKEVEQSVDEMKNDDEERLKLTKNTI 404

Query: 413 RV------------DQKNAQLQSPTSVNDFNEIYDHYRQSS 441
           +V            D+ +  + SP S+ DF +IY+HYRQSS
Sbjct: 405 KVEIDPHKSPFRQQDEDSENMSSPGSIGDFQDIYNHYRQSS 445

 Score =  178 bits (452), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 78/115 (67%), Positives = 99/115 (86%), Gaps = 4/115 (3%)

Query: 801 KSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVV 860
           ++Q P AP L+  +    +LPPRKL F+DV KP++PN+P++F+DS+FGFPLP LTVSTV+
Sbjct: 791 QTQAPAAPPLKHTS----ILPPRKLTFADVKKPDKPNSPVQFTDSAFGFPLPLLTVSTVI 846

Query: 861 MIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL 915
           M DHRLPINVERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+
Sbjct: 847 MFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 901

>Smik_13.486 Chr13 complement(794245..797016) [2772 bp, 923 aa] {ON}
           YMR273C (REAL)
          Length = 923

 Score =  229 bits (585), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 165/453 (36%), Positives = 233/453 (51%), Gaps = 69/453 (15%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+L+DPE++ +     +     + T+++
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLVDPELDIKFGGESNGRRSWSGTAYN 83

Query: 94  QQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSSNDADCGKRT-LSGV 152
                                  D T  E L E      ES       +D G+++  +G 
Sbjct: 84  SASTPGGTTRMNNTRYS------DPTPLENLHERGDLKLES-------SDKGRQSNYAGS 130

Query: 153 RRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDN 212
           ++G  S   ++N N       ++  NLLWVPANQHPN+KP+NYLELVQDTL  +++    
Sbjct: 131 KKGVHSTSRKLNAN-------ALKKNLLWVPANQHPNVKPDNYLELVQDTLQNIQLNGSE 183

Query: 213 EGSVEGGNDEKI----VHXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXX 268
           + + +  N  K     V+               R G  SL+RRPS LR+S+T        
Sbjct: 184 DNNDDQNNGNKNSGSKVYDNKENDTENLNRAMSRHGTASLIRRPSTLRRSYTEFDDSE-- 241

Query: 269 XXXXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLAR 328
                   D+N +  + +K+     RI  R  SL+DITEELT+ISN AG TD DA++LAR
Sbjct: 242 --------DDNGDSKTVNKVEERTSRIKERPVSLRDITEELTKISNSAGLTDNDAITLAR 293

Query: 329 TLSMASSY---------------YTDEDGESVGS-PEKKPEKEYASSMLTKNGLAIPARS 372
           TLSMA SY               + +ED  ++ S  E   + EYAS+M   N +  P RS
Sbjct: 294 TLSMAGSYSDKKDEAEPSNQEGHHIEEDSNAMTSQAEPSDDGEYASNMPINNNMTWPERS 353

Query: 373 SLRRSKFNTYRIR---NTSGGSTAPSNLRSPSAEHN----------ELD--RSPIRVDQK 417
           SLRRS+FNTYRIR              ++    EH+           +D  +SP R   +
Sbjct: 354 SLRRSRFNTYRIRQQEQEKEVEEDKEKIKDYETEHHLPLANNTSKTAIDPHKSPFRQQAE 413

Query: 418 NAQ-LQSPTSVNDFNEIYDHYRQSS--FDSSLG 447
             + + SP S+ DF +IYDHYRQSS  ++  +G
Sbjct: 414 EPESMSSPGSIGDFQDIYDHYRQSSGEWEQEMG 446

 Score =  179 bits (453), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 96/116 (82%)

Query: 800 TKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTV 859
           T S+ P   +   P     VLPPRKL F+DV KP++PNAP++F+DS+FGFPLP LTVSTV
Sbjct: 796 TPSEAPAKTQAAPPLRHTSVLPPRKLTFADVKKPDKPNAPVQFTDSAFGFPLPLLTVSTV 855

Query: 860 VMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL 915
           +M DHRLPINVERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q+
Sbjct: 856 IMFDHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQV 911

>NCAS0B01110 Chr2 complement(182537..185518) [2982 bp, 993 aa] {ON}
           Anc_8.831 YML109W
          Length = 993

 Score =  229 bits (585), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 179/486 (36%), Positives = 247/486 (50%), Gaps = 78/486 (16%)

Query: 26  GSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVS---PSPS 82
           GS Q  R +KRKSEVLIAAQSLD+E+Q VKNLKR+SIGSMD+LIDPE+EFRV+    + S
Sbjct: 15  GSLQTQR-DKRKSEVLIAAQSLDNEVQSVKNLKRLSIGSMDLLIDPELEFRVNNDKSNQS 73

Query: 83  QPAPTTDTSHDQ-QXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSSND 141
            P  + + S++  +                    I++T TEYL ++          +   
Sbjct: 74  TPIGSYERSNENLEQINEPEDNENDESSVSIDDSIELTQTEYLHDA---SVPQTNRTVTP 130

Query: 142 ADCGKRTLSG---VRRGGLSGKTR----MNNNLSA------------------------- 169
            +   R++SG   ++R G S   R    ++  +SA                         
Sbjct: 131 EEPSHRSMSGAGSLKRNGSSISKRKLPFISTGMSAAPTSHLSPSSTSTSSSSSSSSNSAS 190

Query: 170 KDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEP---------------DNEG 214
              + +T NLLWVPANQHPN+KPENYLELVQDTL  + +E                    
Sbjct: 191 SSPDDLTKNLLWVPANQHPNVKPENYLELVQDTLQNIHLEEPASSLQHENEKSNNNKENI 250

Query: 215 SVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTS 274
            +   N  +                ++ +   SLVRRPS LR S+T            + 
Sbjct: 251 DISKSNMSEEEPIDRHPQSLDKTFLEITNRNRSLVRRPSRLRTSYTEFEEDDYSNSEESE 310

Query: 275 GGDENAELPSADKMPSV---------RPRIGSRSSSLKDITEELTRISNRAGFTDGDAVS 325
                ++L S ++ P +               RS SLKDITEELT ISN+AG TD DA++
Sbjct: 311 AKTNESQLSSREEKPFLFNDRNGLNQLRNFSQRSVSLKDITEELTNISNKAGLTDSDAIT 370

Query: 326 LARTLSMASSYYTDED---GESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTY 382
           LARTLSMASS ++D +   G+S    E   E E+AS+M  KNGL IP RSSLRRSKFNTY
Sbjct: 371 LARTLSMASS-FSDGNVNLGKSKLQNESNEESEFASNMFMKNGLTIPERSSLRRSKFNTY 429

Query: 383 RIRNTSGGS-----TAP----SNLRSPSAEHNELDRSPIRVDQKNAQLQSPTSV-NDFNE 432
           RIR+TS  +     T+P    S+     A+ ++L RSP+    +++ L + TS     ++
Sbjct: 430 RIRSTSSSTSTREKTSPLLQSSSFARQEADTDDLQRSPVSFTNRDSYLATTTSSPGSISD 489

Query: 433 IYDHYR 438
           +YDHY+
Sbjct: 490 LYDHYQ 495

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 80/118 (67%), Positives = 96/118 (81%), Gaps = 6/118 (5%)

Query: 818 YVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRL 877
           +VLP RKL F+DV +P+RPNAP++F+DS+FGFPLP LTVSTV+M DHRL INVERAIYRL
Sbjct: 848 HVLPARKLTFADVKRPDRPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRL 907

Query: 878 SHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ------LDEEGPTGVDAAGMD 929
           SHLKL D KRELRQQV+LSNFMYAYLNLVNH+LY++Q      +++   TG D    D
Sbjct: 908 SHLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQVAQQETMEDVAITGTDVIDSD 965

>KAFR0A02770 Chr1 complement(575572..578226) [2655 bp, 884 aa] {ON}
           Anc_8.831 YMR273C
          Length = 884

 Score =  228 bits (581), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 175/466 (37%), Positives = 236/466 (50%), Gaps = 92/466 (19%)

Query: 35  KRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQ----------P 84
           KRKSEVLIAA+S+D+E+++VKNLKR+SIGSMD+LIDPE+E++VS   +           P
Sbjct: 31  KRKSEVLIAARSIDNEVRNVKNLKRLSIGSMDLLIDPELEYKVSHVNTNDDLNKRKSWTP 90

Query: 85  APTTDTS----------------HDQQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESE 128
             TT T                 HD                      IDIT TEYL +  
Sbjct: 91  DSTTFTGTKVNTRPKSKSFGTHIHDPPLVRINNNSDSSSSDEEEDDSIDITRTEYLHDQ- 149

Query: 129 GTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHP 188
            T  +S            R LSG+     S +   N+     +E+ + +NLLWVPA++HP
Sbjct: 150 -TTLQSQRKL-----PKHRNLSGINSSRQSSRKLSND--RTDNEDKLKNNLLWVPASKHP 201

Query: 189 NIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSL 248
           N+KP+NY+ELVQDTL  + I+       +  N E   H               ++G  SL
Sbjct: 202 NVKPQNYIELVQDTLQHIHIDDSKSNDNDNINKENDAHSS-------------KNG--SL 246

Query: 249 VRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEE 308
           VRRPS LRKS+T             +  ++  E P+   + + R     RS SLKDITEE
Sbjct: 247 VRRPSRLRKSYTEYEEENYQDDYNRNNSND-EENPN---IGNFRSSNKGRSVSLKDITEE 302

Query: 309 LTRISNRAGFTDGDAVSLARTLSMASSY------------YTDEDGESVGSPE--KKPEK 354
           LT+ISN+AG TD DA++LARTLSM  S+            Y+D+   +  + E   K + 
Sbjct: 303 LTKISNKAGLTDSDAITLARTLSMTGSFSNGTDDMELLSNYSDQQDNNFNNDEHYNKNDD 362

Query: 355 EYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRS--------------- 399
           E+AS+ML KNGL IP RSSLRRSKFNTYR+R     S+APSN+ S               
Sbjct: 363 EFASNMLMKNGLTIPQRSSLRRSKFNTYRVR----SSSAPSNIHSKPINSNIKEPKTFKY 418

Query: 400 PSAEHNELDRSPIRVDQKNAQ--LQSPTSVNDFNEIYDHYRQSSFD 443
           P      + +SP+       +   +SP S++D   +YDHY  SS D
Sbjct: 419 PYNSKTSIKKSPVNRSNNYTEPVTESPGSISD---LYDHYAYSSVD 461

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 86/95 (90%)

Query: 820 LPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSH 879
           LPPRKL F DV +PE+PNAP+ FSDS+FGFPLP LT STV+M DHRL INVERAIYRLSH
Sbjct: 747 LPPRKLTFDDVKRPEKPNAPIHFSDSAFGFPLPMLTTSTVIMFDHRLGINVERAIYRLSH 806

Query: 880 LKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
           LKL DPKRELRQQV+LSNFMYAYLNLVNH+LY++Q
Sbjct: 807 LKLSDPKRELRQQVLLSNFMYAYLNLVNHTLYMEQ 841

>Skud_13.32 Chr13 (51228..54074) [2847 bp, 948 aa] {ON} YML109W
           (REAL)
          Length = 948

 Score =  227 bits (579), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 171/448 (38%), Positives = 237/448 (52%), Gaps = 50/448 (11%)

Query: 19  QGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVS 78
           QGR       +    EKRKS+VLIAA+SLD+E+Q+VKNLKR+SIGSMD++ DPE+EF++S
Sbjct: 36  QGRMRKTQLSKKELFEKRKSDVLIAAKSLDTEIQNVKNLKRLSIGSMDLVFDPELEFKLS 95

Query: 79  PSPSQPAPTT-----DTSHDQQXXXXXXXXX---------XXXXXXXXXXXIDITSTEYL 124
              S  + ++     ++ H ++                             IDIT TEYL
Sbjct: 96  SRNSYSSDSSKESLQESLHGEEIKQLEQEIEERGQDDDVYEEDDATNADDSIDITQTEYL 155

Query: 125 QESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNN-----LSAKDEESV--TH 177
            + E    E +   ++      R  S  RR  LSG     ++     + + D  +V  T 
Sbjct: 156 HDEETLEKERISRKASSTSFPARVTSRNRR--LSGVKSFPHDEVLDVVDSHDSNAVNFTQ 213

Query: 178 NLLWVPANQHPNIKPENYLELVQDTLHTLKIEPD---NEGSVEGGNDEKIVHXXXXXXXX 234
           NLLWVPANQHPN+KPENYLEL+QDTL  ++I  D   +E  +E GN+    +        
Sbjct: 214 NLLWVPANQHPNVKPENYLELIQDTLQNIQISVDQEFDESKLELGNNHAFPNRQ------ 267

Query: 235 XXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPR 294
                  RSG  S+VR PS L+ S++             +G  +  +     ++PS   +
Sbjct: 268 -------RSG--SIVRNPSRLKTSYS-----KFDDEPSLAGQPQQEQEQVERRIPSSEFK 313

Query: 295 IGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPEKKPEK 354
              RS SLK+ITEELT+ISN AG TD DAV+LAR+LSM+ S+ +     S  + E   + 
Sbjct: 314 -SMRSVSLKEITEELTKISNNAGLTDSDAVTLARSLSMSGSFTSGNLHLSNNNAEN--DN 370

Query: 355 EYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELDRSPIRV 414
           E+AS+M  + G  IP RSSLRRSKFNTY+IR    G +  S   S  +      R    +
Sbjct: 371 EFASNMFNEIGGGIPERSSLRRSKFNTYKIRLEGSGLSQASRPNSLMSIQISEGRRSASL 430

Query: 415 DQKNAQL-QSPTSVNDFNEIYDHYRQSS 441
               AQL Q   S+NDF EI+DHYR++S
Sbjct: 431 PASYAQLPQQQGSLNDFQEIFDHYRKTS 458

 Score =  184 bits (467), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 183/389 (47%), Gaps = 71/389 (18%)

Query: 556 LGVSSSAKPTNVPTEKINHSRHRHYSI--------------------------DDTANXX 589
           L VS  AK T   +E+INHS++RH  I                          + T    
Sbjct: 578 LSVSRRAKSTKRVSERINHSKNRHSPILQMPSDGSKSVVITSSVPSSPPLQSSEATIPAA 637

Query: 590 XXXXXXXXXXXXXXXXKKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKV 649
                           KKQ  EK+  +LFKR        ++  DG     K+   N    
Sbjct: 638 AEKEQNCPDDNRPLSHKKQSLEKRLARLFKR--------KQHCDGSKSDAKVLKKNVKNE 689

Query: 650 LKTRTSSTNLRKNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSL 709
           LK + S ++L K R SPKK R       E V  D  S+    +  E+ +  + ++P+V  
Sbjct: 690 LKKKASHSSLSKFRKSPKKKR-----EEEEVVHDRPSSPVETITTEDFDTSSDIEPAV-- 742

Query: 710 TPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHEG 769
                     + P   N+  D   N    H ++ V+++ +E  L+ D+        I  G
Sbjct: 743 ----------ESPNACNILPDSNTN----HSSEFVVETINE--LDGDDSFD-----ISGG 781

Query: 770 ITESNTQAEADTVXXXXXXXXXXXXXXXXFTKSQEPNAPELQAPAAGGYVLPPRKLAFSD 829
             + N    +D                       E     + +PA     L PRKL F D
Sbjct: 782 ENDCNIDVRSDIARDTTAGPN---------ESMGEEEESMVPSPAPQISTLLPRKLIFED 832

Query: 830 VIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKREL 889
           VIKPE PNAP+KF+DS+FGFPLP +  STV+M DHRL INVERAIYRLSHLKL DP REL
Sbjct: 833 VIKPEYPNAPIKFTDSAFGFPLPMIANSTVIMFDHRLNINVERAIYRLSHLKLSDPGREL 892

Query: 890 RQQVILSNFMYAYLNLVNHSLYLQQLDEE 918
           RQQV+LSNFMY+YLNLVNH+LY++Q+  E
Sbjct: 893 RQQVLLSNFMYSYLNLVNHTLYMEQMGSE 921

>Skud_13.445 Chr13 complement(784651..787347) [2697 bp, 898 aa] {ON}
           YMR273C (REAL)
          Length = 898

 Score =  224 bits (570), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 175/495 (35%), Positives = 236/495 (47%), Gaps = 118/495 (23%)

Query: 15  VGDVQGRGSNKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEME 74
           + D   R ++       + +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+LIDPE++
Sbjct: 5   INDSMLRATSNNRMAACQRDKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELD 64

Query: 75  FRV----------SPSPSQP--APTTDTSHDQQXXXXXXXXXXXXXXXXXXXXIDITSTE 122
            +           S + S+P  AP   T  +                       D T  E
Sbjct: 65  IKFCGESNGRRSWSGTTSKPTSAPNGTTGMNNTRYS------------------DPTPLE 106

Query: 123 YLQESEGTGFESLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLSAKDEESVTHNLLWV 182
            L E   +G E+   +   +  G +      RG  S   ++  N       ++  NLLWV
Sbjct: 107 NLHERRSSGIETCAKNKQGSSTGHK------RGVHSPSRKLTAN-------ALKKNLLWV 153

Query: 183 PANQHPNIKPENYLELVQDTLHTLKIEPD---------------NEGSVEGGNDEKIVHX 227
           PANQHPN+KP+NYLELVQDTL  +++  +                E +   GN E +   
Sbjct: 154 PANQHPNVKPDNYLELVQDTLQNIRLGDNDDNDDENDKNENNRVTEETESHGNKENM--- 210

Query: 228 XXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADK 287
                        LR G  SL+RRPS LR+S+T               G  N    + ++
Sbjct: 211 ----NTVDLNRGMLRHGNASLIRRPSTLRRSYTEFDDIED------DNGQRNEASKTVNR 260

Query: 288 MPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSY----------- 336
           +     RI  R  SL+DITEELT+ISN AG T+ D ++LARTLSMA SY           
Sbjct: 261 VEERTSRIKERPVSLRDITEELTKISNSAGLTNNDTITLARTLSMAGSYSDGGNEAGPKD 320

Query: 337 -YTDEDGESVG--SPEKKP--EKEYASSMLTKNGLAIPARSSLRRSKFNTYRIR------ 385
              D +GES+G  S ++K   + EYAS+M T N +  P RSSL+RS+FNTYRIR      
Sbjct: 321 LKDDYEGESIGVASSQRKASDDGEYASNMPTNNDMTGPERSSLKRSRFNTYRIRSQEQEK 380

Query: 386 ----------NTSGG------STAPSNLRSPSAEHNELDRSPI-RVDQKNAQLQSPTSVN 428
                     N   G       T  + + SP        +SP  + D ++    SP SV 
Sbjct: 381 EEEQNVEETKNEEAGRLHLTDKTLKTEIESP--------KSPFGQEDDESEYASSPGSVG 432

Query: 429 DFNEIYDHYRQSSFD 443
           DF +IYDHYRQ S D
Sbjct: 433 DFQDIYDHYRQFSGD 447

 Score =  180 bits (457), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 96/112 (85%), Gaps = 4/112 (3%)

Query: 803 QEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMI 862
           Q P AP L+  +    VLPPRKL F+DV KPE+PNAP++FSDS+FGFPLP LTVSTV+M 
Sbjct: 772 QAPVAPPLRHTS----VLPPRKLTFADVKKPEKPNAPVQFSDSAFGFPLPLLTVSTVIMF 827

Query: 863 DHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
           DHRLPINVERAIYRLSHLKL + KR LR+QV+LSNFMYAYLNLVNH+LY++Q
Sbjct: 828 DHRLPINVERAIYRLSHLKLSNSKRGLREQVLLSNFMYAYLNLVNHTLYMEQ 879

>Suva_13.461 Chr13 complement(793859..796654) [2796 bp, 931 aa] {ON}
           YMR273C (REAL)
          Length = 931

 Score =  216 bits (550), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 164/450 (36%), Positives = 231/450 (51%), Gaps = 67/450 (14%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93
           +KRKSEVLIAAQSLD+E++ VKNLKR+SIGSMD+LIDPE++ +                 
Sbjct: 24  DKRKSEVLIAAQSLDNEIRSVKNLKRLSIGSMDLLIDPELDIKFG--------------G 69

Query: 94  QQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLG-SSSNDADCGKRTLSGV 152
           +                       + +T Y   S+ T  E L   SS + +  +R     
Sbjct: 70  ESNGRRSWSGATSSSTSAPNVTRSMNNTRY---SDPTPLEKLHVQSSTETESYER----C 122

Query: 153 RRGGLSGKTRMNNNLSAK-DEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPD 211
           R+G  +G  ++ ++ S K +  ++ +NLLWVPANQHPN+KP+NYLELVQDTL  +++  +
Sbjct: 123 RQGNYTGHKKVVHSPSRKLNANALKNNLLWVPANQHPNVKPDNYLELVQDTLQNIRLGDN 182

Query: 212 NEGSVEGGNDEKIVHXXXXXXXXXXXXXQL-------RSGLNSLVRRPSGLRKSFTXXXX 264
           ++ +    N+    H              +       R G  SL+RRPS LR+S+T    
Sbjct: 183 DDDNDNNDNEGDEAHGETESYGNKENLNVVNVNRGMPRHGNASLIRRPSTLRRSYTEFDD 242

Query: 265 XXXXXXXXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAV 324
                     G D++  +  A +  S   RI  R  SL+DITEELT+ISN AG TD DA+
Sbjct: 243 SEGDIGQ---GDDDSMTVNKAKERTS---RIRERPISLRDITEELTKISNSAGLTDDDAI 296

Query: 325 SLARTLSMASSY---------------YTDEDGESVGSPEKKPEK-EYASSMLTKNGLAI 368
           +LARTL+MA SY               Y +E+ +  GS  + P+  EYAS+M   N    
Sbjct: 297 TLARTLNMAGSYSDKGDGPRSEDSRVGYEEENAKVTGSQTETPDDVEYASNMPINNDSTG 356

Query: 369 PARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAE--------HNELD------RSPIRV 414
           P RSSL+RS+FNTYRIR+ +        L     E         N ++      +SP R 
Sbjct: 357 PERSSLKRSRFNTYRIRSHTEEQEEEQVLEETKKEDVSRLHLAENTIEIGINSPKSPFRQ 416

Query: 415 -DQKNAQLQSPTSVNDFNEIYDHYRQSSFD 443
            D ++  + SP S+ DF +IYDHY QSS D
Sbjct: 417 EDDESDPVSSPGSIGDFQDIYDHYTQSSGD 446

 Score =  178 bits (451), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (92%)

Query: 819 VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878
           VLPPRKL F+DV K E+PNAP++F+DS+FGFPLP LTVSTVVM DHRLPINVERAIYRLS
Sbjct: 820 VLPPRKLTFADVKKSEKPNAPVQFTDSAFGFPLPLLTVSTVVMFDHRLPINVERAIYRLS 879

Query: 879 HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
           HLKL + KRELR+QV+LSNFMYAYLNLVNH+LY++Q
Sbjct: 880 HLKLSNSKRELREQVLLSNFMYAYLNLVNHTLYMEQ 915

>Kpol_541.10 s541 complement(26683..29853) [3171 bp, 1056 aa] {ON}
           complement(26683..29853) [3171 nt, 1057 aa]
          Length = 1056

 Score =  209 bits (533), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 165/465 (35%), Positives = 241/465 (51%), Gaps = 67/465 (14%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHD 93
           +KRKS VLIAA+SLD EL+H+K+LKR SIGSMDML+DPE+E+RVS    Q   +TDT + 
Sbjct: 32  DKRKSAVLIAAKSLDRELKHIKDLKRFSIGSMDMLMDPELEYRVSNINKQ---STDT-YS 87

Query: 94  QQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSSNDADCGKRTLSGVR 153
           ++                    + I STE+L         S+  SSN +  G R+    R
Sbjct: 88  KRRSITSDLQPLDANDDFSDDPLGIKSTEFLP-------SSVIRSSNPS--GNRSDKYTR 138

Query: 154 RGGLSGKTRMN---NNLSAKDEESVT-HNLLWVPANQHPNIKPENYLELVQDTLHTLKIE 209
           R  LSG   +N   ++++   + S T  NLLWVPA++HPN+ P+NY++++Q++L+ L +E
Sbjct: 139 R-KLSGSRSLNTIPDSMAYNSKASTTKKNLLWVPADKHPNVMPDNYIQMIQNSLNNLSLE 197

Query: 210 PDNEGSVEGG-----NDEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXX 264
            + +   +       N E I               +      SLVRRPS LRKS+T    
Sbjct: 198 SNEDVDKDSKVLPQENKENIYEDRERLSVAYKRRNR------SLVRRPSQLRKSYTEFNN 251

Query: 265 XXXXXXXXTSGG--------DENAELPSADKMPSVRPRIGSRSS-SLKDITEELTRISNR 315
                               +EN+   S D + + +     R S SLKDIT ELT+ISN 
Sbjct: 252 SDDEEDNTDENNLSKNNKDTNENSANTSMDSIKTSKSFDNKRYSISLKDITAELTKISNS 311

Query: 316 AGFTDGDAVSLARTLSMASSYYTDEDGESVG-------SPEKKPEKEYASSMLTKNGLAI 368
            G +D DAVSLAR+LS+   Y  + + +  G       S E+    E+ S+M+ +NGL I
Sbjct: 312 VGLSDSDAVSLARSLSITGPYQDETESDGAGDIMLDNPSDEESLNDEFVSNMVLRNGLMI 371

Query: 369 PARSSLRRSKFNTYRIRNTSGGSTAP----------SNLRSPSAEHNELDRSP------- 411
           P RSSLRRSKF TYR R +S  S +P          +++ S  A  NE+ ++P       
Sbjct: 372 PTRSSLRRSKFTTYRSRTSSSDSLSPKKQNFDDKQETSVSSSKANENEI-KNPFGKLPEV 430

Query: 412 -IRVDQKNAQ---LQSPTSVNDFNEIYDHYRQSSFDSSLGAYPHE 452
            ++ ++ N     L++  + +DF +IYDHYRQ S D  +    H+
Sbjct: 431 NLKAEESNEDDESLKTSPAASDFQDIYDHYRQPSSDWDMEFKKHD 475

 Score =  172 bits (436), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 96/117 (82%)

Query: 819  VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878
            VLPPRKL F+DV K + PN P++F+DS+FGFPLP LT+STV+M DHRLP+NVERAIYRLS
Sbjct: 929  VLPPRKLVFADVHKSDIPNGPIQFTDSAFGFPLPLLTISTVIMFDHRLPVNVERAIYRLS 988

Query: 879  HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMDGMTASL 935
            HLKL +PKR LR QV+LSNFMYAYL+LVNH+LY++Q ++   + ++   +  MT S+
Sbjct: 989  HLKLSEPKRALRDQVLLSNFMYAYLHLVNHTLYMEQHEQLPTSTMNQTNIAMMTDSV 1045

>Kpol_1069.2 s1069 (1560..4565) [3006 bp, 1001 aa] {ON} (1560..4565)
           [3006 nt, 1002 aa]
          Length = 1001

 Score =  202 bits (514), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 173/488 (35%), Positives = 239/488 (48%), Gaps = 92/488 (18%)

Query: 27  SEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEF----------- 75
           +E+  + +KRKS VLIAAQSLD E+Q+VKNLKR+SIGSMD+LIDPE+E+           
Sbjct: 14  AEEKIQRDKRKSAVLIAAQSLDQEVQNVKNLKRLSIGSMDLLIDPELEYTVNNPSSPPSS 73

Query: 76  ----RVSPSPSQPAPTTDTSHDQQX---XXXXXXXXXXXXXXXXXXXIDITSTEYLQE-- 126
               +   S      T +TS D++                        D T  EYL +  
Sbjct: 74  VNSQKSYSSNETTYETAETSLDKKEGSYLEDSVVDASNSSIADASDSFDTTGVEYLHDGN 133

Query: 127 ---SEGTGFESLGSSSNDADC---GKRTLSGVRRGGLSGKTRMNNNLSAKDE-------- 172
              S     +S+ +   +       KR LSG+  GGL   +R   N+++K E        
Sbjct: 134 EPVSSNEQLDSIKTVKENELSQPQSKRNLSGI--GGLRRSSR---NVTSKPENETQVLPK 188

Query: 173 ------ESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVH 226
                 ++ T+NLLWVPANQHP++KP+N++ELV DTL  + ++      V+    E    
Sbjct: 189 RKLENKKAFTNNLLWVPANQHPSVKPQNFVELVHDTLQNMSLD-----DVQTNESESKNE 243

Query: 227 XXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSAD 286
                         +R+   SLVRRPS LRKS+T            T+  +   E     
Sbjct: 244 VSKDLLNTFSRDMNMRNK--SLVRRPSRLRKSYTEFEEETEEEVKPTTSSNNINE----- 296

Query: 287 KMPSVRPRI-GSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYT-----DE 340
              S +  + G R+ SLKDI +ELT ISN  G ++ DA+SLAR+LS+A S  +     +E
Sbjct: 297 ---SNKKNVQGKRAVSLKDIADELTVISNNVGLSNSDAISLARSLSIAGSIGSTSEEEEE 353

Query: 341 DGESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGG------STAP 394
           D     S   + E+ +AS++L KNG++IPARSSLRRSKFNTY+IR TSG       STAP
Sbjct: 354 DKVLNTSSIGQSEEVFASNILAKNGISIPARSSLRRSKFNTYKIR-TSGSSQKDELSTAP 412

Query: 395 SNLRSPSAEHNELDR--SPIRVDQKNAQLQSPTSVNDFNEIYDHYRQ-------SSFDSS 445
             L S       L R  S   ++ KN Q            I+DH ++        S D+S
Sbjct: 413 IILNSDGGNIGSLRRTSSSSYIETKNRQ----------EGIFDHTQRKLSSGSIGSSDNS 462

Query: 446 LGAYPHEH 453
            GA P  H
Sbjct: 463 TGALPVPH 470

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 182/340 (53%), Gaps = 55/340 (16%)

Query: 606 KKQRKEKKFIQLFKRNRTTSTNGREKDDGPSISEKLQSSNAVKVLKTRTSSTNLRKNRLS 665
           KK+R EKK + LF+R   + +  ++K     ++ K Q+     V+K ++S TN+R    S
Sbjct: 662 KKERFEKKLVNLFRRKGNSKSPAKDK-----LTRKSQN----HVIKKKSSLTNIRLRIGS 712

Query: 666 PKKTRLSGDGR---RESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQDKP 722
            K+  LS        E  +E     QDY+   EE + +  +  +     +  P    D P
Sbjct: 713 YKQEELSNSKSTKPSEEAQEKPEGNQDYEQAEEEIKDVGIINSTTEDVCQEEPI---DDP 769

Query: 723 KQNNVGEDLRLN----------NQDKHRADSVLDSDSEPELEADEEAGPRTD-AIH-EGI 770
             +   ED   N          N  +   D+ +  +S  EL+ DE++   ++ +I+ E I
Sbjct: 770 ADDTEEEDYDANESATQLQPALNVVRTANDNCI-VESVNELDDDEDSQDFSNGSIYTESI 828

Query: 771 T-ESNTQAEADTVXXXXXXXXXXXXXXXXFTKSQEPNAPELQAPAAGGYVLPPRKLAFSD 829
             + NT A  D                       + N    QAP     +LPPRKL F D
Sbjct: 829 ALQKNTYATKDVTI--------------------QNNDLANQAPPT---ILPPRKLTFED 865

Query: 830 VIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPKREL 889
           V + +RPN  M F+DS+FGFPLP LTVSTV+M DHRLP+NVERAIYRLSHLKL D +R L
Sbjct: 866 VERLDRPNGSMVFTDSAFGFPLPLLTVSTVIMFDHRLPVNVERAIYRLSHLKLSDSRRSL 925

Query: 890 RQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMD 929
           R+QV+LSNFMYAYL+LVNHSLY++Q++EE    +DA+  D
Sbjct: 926 REQVLLSNFMYAYLHLVNHSLYMEQVEEE---SMDASYSD 962

>KLLA0D01683g Chr4 complement(148855..151689) [2835 bp, 944 aa] {ON}
           some similarities with uniprot|P54786 Saccharomyces
           cerevisiae YML109W ZDS2 Protein that interacts with
           silencing proteins at the telomere involved in
           transcriptional silencing paralog of Zds1p and with
           YMR273C uniprot|P50111 Saccharomyces cerevisiae YMR273C
           ZDS1 Protein that interacts with silencing proteins at
           the telomere, involved in transcriptional silencing;
           also has a role in localization of Bcy1p, which is a
           regulatory subunit of protein kinase A; paralog of Zds2p
          Length = 944

 Score =  199 bits (506), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 85/108 (78%), Positives = 97/108 (89%)

Query: 811 QAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINV 870
           Q      Y LPPRKL F+DV+KP+RPN+PMKF+DS+FGFPLPPLT+STV+M DHRLPI+V
Sbjct: 815 QGTLENQYPLPPRKLTFADVLKPDRPNSPMKFTDSAFGFPLPPLTISTVIMFDHRLPIHV 874

Query: 871 ERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEE 918
           ERAIYRLSHLKL DPKR LRQQV+LSNFMYAYLNLVNHSLYLQQ++EE
Sbjct: 875 ERAIYRLSHLKLSDPKRVLRQQVLLSNFMYAYLNLVNHSLYLQQIEEE 922

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/243 (43%), Positives = 139/243 (57%), Gaps = 25/243 (10%)

Query: 166 NLSAKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIV 225
           N  +K  ES+  NLLWV A+QHPN+KPENYLELVQ+TL  + +     G     N+    
Sbjct: 179 NDESKHNESLGQNLLWVRADQHPNVKPENYLELVQNTLENMNLG----GRSPTANE---T 231

Query: 226 HXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAEL--- 282
                          ++SG NSL RRPS LR S+T             S  DE+  +   
Sbjct: 232 QAQSLSGLKTLRKRSMQSG-NSLARRPSRLRTSYTEL-----------SEDDEDKGMTDQ 279

Query: 283 PSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDG 342
           P A   P++  R   R+ SLKDITEELT++SN+AG TD DAV+LARTL +A    TD  G
Sbjct: 280 PLAAAAPTMSSR---RTVSLKDITEELTKLSNQAGLTDTDAVTLARTLWVADESTTDSTG 336

Query: 343 ESVGSPEKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSA 402
           + + +     E+E+AS+M TK+G  +PAR SLRRSKFNTYRI+++S         RSPS 
Sbjct: 337 QGLSNNLADEEEEFASTMFTKSGFTVPARHSLRRSKFNTYRIQSSSSKEERIIETRSPSG 396

Query: 403 EHN 405
            +N
Sbjct: 397 SNN 399

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 36/47 (76%), Positives = 45/47 (95%)

Query: 32 RSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVS 78
          + +KRKSEVLIAAQSLD E++HVKNLKR+SIGSMD+L+DPE+E+RVS
Sbjct: 5  KRDKRKSEVLIAAQSLDQEVKHVKNLKRLSIGSMDLLMDPELEYRVS 51

>AAL185W Chr1 (9537..12593) [3057 bp, 1018 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YML109W (ZDS2) and YMR273C
            (ZDS1)
          Length = 1018

 Score =  197 bits (502), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 86/123 (69%), Positives = 101/123 (82%)

Query: 812  APAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVE 871
             P    + LPPRKL F DV++PE+PN+PMKF+ S+FGFPLPPLTVSTV+M DHRLPI VE
Sbjct: 888  GPGEIAHSLPPRKLRFDDVLRPEKPNSPMKFTPSAFGFPLPPLTVSTVIMFDHRLPIYVE 947

Query: 872  RAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAGMDGM 931
            RAIYRLSHLKL DPKRELRQQV+LSNFMY+YLNLVNHSLYLQQ++E+   G+     D M
Sbjct: 948  RAIYRLSHLKLSDPKRELRQQVLLSNFMYSYLNLVNHSLYLQQIEEDKNQGIQFESTDNM 1007

Query: 932  TAS 934
             +S
Sbjct: 1008 ASS 1010

 Score =  184 bits (467), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 152/289 (52%), Gaps = 43/289 (14%)

Query: 173 ESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXX 232
           E  + NLLWV A+QHPN+KPENYLELV DTL+ L+I     G+  G  D  +        
Sbjct: 226 EPFSSNLLWVRADQHPNVKPENYLELVHDTLNNLRI-----GARHGRGDSPVQQSNTPVA 280

Query: 233 XXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVR 292
                    RS    LVR+ S LRKSFT            + G    +E+P   +M    
Sbjct: 281 NGESSTASARS----LVRKQSRLRKSFTEVEAIEESQFTDSIG----SEIPVGKRM---- 328

Query: 293 PRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDG---ESVGSPE 349
                R SSLK+ITEELTRISN AG TD DA++LARTL + S    DE     E V S E
Sbjct: 329 -----RVSSLKEITEELTRISNNAGLTDSDAITLARTLGIGSQS-ADEHATFSECVPSAE 382

Query: 350 KKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNL------------ 397
            + E EYASS+L KNGLAIPARSSLRRSKF TYRIR+    S+ P N             
Sbjct: 383 AE-ENEYASSILAKNGLAIPARSSLRRSKFTTYRIRSAGSDSSPPENKSTSSSSLAAAYE 441

Query: 398 ---RSPSAEHNELDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFD 443
              RSP  +      S  R+  +N  L +P S N  N+IYDHY  S  D
Sbjct: 442 RNSRSPKMQKAAFKGSHPRLSGENTSL-APQSPNSINDIYDHYNTSDTD 489

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 5/54 (9%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFR-----VSPSPS 82
           EKRKSEVLIAAQSLD ELQ+VKNLKRISIGSMD+L+DPEMEFR     VSPS S
Sbjct: 71  EKRKSEVLIAAQSLDYELQNVKNLKRISIGSMDLLMDPEMEFRMNGAAVSPSAS 124

>TDEL0B00660 Chr2 (124552..127431) [2880 bp, 959 aa] {ON} Anc_8.831
           YMR273C
          Length = 959

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/401 (34%), Positives = 189/401 (47%), Gaps = 79/401 (19%)

Query: 551 VSSDFLGVSSSAKPTNVPTEKINHSRHRHYSI----------DDTANXXXXXXXXXXXXX 600
           +  DF   S+   P     ++ NHS++RH  I          D T               
Sbjct: 594 IDEDFEKTST---PVTTEIQRSNHSKNRHLPIFPANESSKRKDTTEEPAVSTKMGRSSSS 650

Query: 601 XXXXXKKQRKEKKFIQLFKRN--RTTSTNGREKD-DGPSISEKLQSSNAVKVLKTRTSST 657
                 +Q  EKK   LF+R   +     G  +D  G  +  K  S N  K  KT  +  
Sbjct: 651 DSSNLTRQMFEKKIANLFRRKGKKKLPDYGTSRDHTGAELKSKRSSDNLSKFAKTSKTPV 710

Query: 658 NLRKNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVV-------REEKEPLAKLQPSVSLT 710
            LR       ++R+  +  R SV +D     D  +V       + + E L  LQP+VS+T
Sbjct: 711 KLRS------ESRVE-EHLRNSVSKDV--VPDTAIVAGEVIPSKSKAEDLPALQPAVSVT 761

Query: 711 P--KSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSEPELEADEEAGPRTDAIHE 768
               +  PL       + V E ++            LD D   ++  D+ A    D   E
Sbjct: 762 STKSAHVPLAS-----SVVIESVK-----------ELDGDDSQDVSMDQNAQTSIDISTE 805

Query: 769 GITESNTQAEADTVXXXXXXXXXXXXXXXXFTKSQEPNAPELQAPAAG--GYVLPPRKLA 826
            ++     +E  T                           +++ PA G     +PPRKL 
Sbjct: 806 TLSMKEQTSEVQT---------------------------DVKQPADGPSHQPVPPRKLT 838

Query: 827 FSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLGDPK 886
           F DV + E+ NAPMKF+DS+FGFPLP LTVSTV+M DHRLPINVERAIYRLSHLKL DPK
Sbjct: 839 FDDVKRSEQSNAPMKFTDSAFGFPLPMLTVSTVIMFDHRLPINVERAIYRLSHLKLSDPK 898

Query: 887 RELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAG 927
           RELRQQV+LSNFMYAYLNLVNH+LY++Q+ +E     + +G
Sbjct: 899 RELRQQVVLSNFMYAYLNLVNHTLYMEQVAQENDLTTETSG 939

>TPHA0I00200 Chr9 complement(34713..37862) [3150 bp, 1049 aa] {ON}
           Anc_8.831 YMR273C
          Length = 1049

 Score =  183 bits (464), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 77/112 (68%), Positives = 95/112 (84%), Gaps = 1/112 (0%)

Query: 820 LPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSH 879
           LP RKL F DV+KPERPN PM+F+DS+FGFPLP LT STV+M DHRLP+NVERAIYRLSH
Sbjct: 885 LPARKLTFKDVVKPERPNGPMEFTDSAFGFPLPKLTTSTVIMFDHRLPVNVERAIYRLSH 944

Query: 880 LKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGP-TGVDAAGMDG 930
           LKL DPKRELR+Q++LSNFMYAYL+LVNHSLY++Q +++   + +D +  D 
Sbjct: 945 LKLSDPKRELREQILLSNFMYAYLHLVNHSLYIEQAEQQAKESNMDTSEYDN 996

 Score =  149 bits (377), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 153/289 (52%), Gaps = 33/289 (11%)

Query: 133 ESLGSSSNDADCGKRTLSGVR---RGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPN 189
           ESL  S  +    +R LSGV    RG          N   + E+ +T NLLWVPAN+HP 
Sbjct: 159 ESLFQSHKNNSQLRRGLSGVHSLNRGNSKQLKPKIQNKQTETEDQITQNLLWVPANKHPG 218

Query: 190 IKPENYLELVQDTLHTLKIE-PDNEGSVEGGND---EKIVHXXXXXXXXXXXXXQLRSGL 245
           +KPENY+EL+QDTL  + +   + + +VE  ++   +K+V               L    
Sbjct: 219 VKPENYVELLQDTLQNINLNLNETQNNVEDTSNKTSDKMV-MDREVIRRRRISQDLNRNH 277

Query: 246 NSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAE-----------LPSADKMPSVRPR 294
           +SLVRRP+GLR S++             +  + + E           + + D       +
Sbjct: 278 SSLVRRPTGLRISYSESVEEFHDALESENSLNSDKEREPSLSQNSISMITIDLQNKSTYQ 337

Query: 295 IGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGES-------VGS 347
           +G   +SLKDITEELT+ISN+AG ++ DA+SLAR+LS+A S    ++  S        G+
Sbjct: 338 MGKNYASLKDITEELTKISNKAGLSNSDAISLARSLSIAGSVSKTDNSVSDNLQSATQGN 397

Query: 348 PEKKP------EKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGG 390
            + KP      E  YAS++L +NG+ +P R SLRRSKFNTY+IRN SG 
Sbjct: 398 DDNKPRSSEVSEAGYASNILVRNGITMPTR-SLRRSKFNTYKIRNPSGN 445

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/42 (73%), Positives = 38/42 (90%)

Query: 34 EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEF 75
          EKRKS VLIAAQSLD E+Q+VK LKR+S+GSMD+L+DPE E+
Sbjct: 15 EKRKSAVLIAAQSLDLEVQNVKKLKRLSVGSMDLLLDPEFEY 56

>NDAI0E00350 Chr5 (54073..57564) [3492 bp, 1163 aa] {ON} Anc_8.831
            YML109W
          Length = 1163

 Score =  181 bits (459), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 97/119 (81%), Gaps = 1/119 (0%)

Query: 813  PAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVER 872
            P +  + LPPRKL F DV +PERPNAP++F+DS+FGFPLP LTVSTV+M DHRL INVER
Sbjct: 1018 PLSQQHGLPPRKLTFDDVKRPERPNAPVEFTDSAFGFPLPALTVSTVIMFDHRLGINVER 1077

Query: 873  AIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL-DEEGPTGVDAAGMDG 930
            AIYRLSHLKL D KRELR+QV+LSNFMYAYLNLVNH+LY++Q+  +E    V+  G D 
Sbjct: 1078 AIYRLSHLKLSDSKRELREQVLLSNFMYAYLNLVNHTLYMEQVAQQETIDNVEFTGDDA 1136

 Score =  173 bits (438), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 128/331 (38%), Positives = 159/331 (48%), Gaps = 72/331 (21%)

Query: 178 NLLWVPANQHPNIKPENYLELVQDTLHTL------------KIEPDNEGSVEGGNDEKIV 225
           NLLWVPANQHPNIKPE+YLELVQDTLH +            K+  D++     G DE   
Sbjct: 267 NLLWVPANQHPNIKPESYLELVQDTLHNIHLDDDNHNNDDAKVSTDDDLYSMDGTDETNK 326

Query: 226 HXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTX-XXXXXXXXXXXTSGGDENAELPS 284
                         +LR    SLVRRPSGLRKS+T             TS  +E  +L +
Sbjct: 327 ENLNIDYLTKPSTSELRRKNKSLVRRPSGLRKSYTEFEEFNTSDEEDETSDCEEEQQLST 386

Query: 285 ---------------ADKMPS-VRPRIGSRSS---SLKDITEELTRISNRAGFTDGDAVS 325
                           +K P  + P+  +RSS   SLKDITEELT+ISN AG TD DA++
Sbjct: 387 DNSTNNANHHQDIIINNKTPEIIIPKGNTRSSRFVSLKDITEELTKISNNAGLTDSDAIT 446

Query: 326 LARTLSMASSY----------YTDEDGESVGSPEKKPEKEYASSMLTKNGLAIPARSSLR 375
           LARTLSMA S+              + ++  +PE   + EYAS+M  KNGL IP RSSLR
Sbjct: 447 LARTLSMAGSFQDNSNNNHNSDNFNEEQNGNTPE---DDEYASNMFMKNGLTIPTRSSLR 503

Query: 376 RSKFNTYRIR-----------------------NTSGGSTAPSNLRSPSAEHNELDRSPI 412
           RS+FNTYRIR                       N +   T P     P  +HN    S  
Sbjct: 504 RSRFNTYRIRSGSSSTSAQSSSSSRTTSGSQMTNNNKTVTEPGRGNQP-EDHNNTPASHY 562

Query: 413 RVDQKNAQLQSPTSVNDFNEIYDHYRQSSFD 443
                     SP S++D   +YDHY+ S  D
Sbjct: 563 TARLSYMSTTSPGSISD---LYDHYQNSDSD 590

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%)

Query: 24 NKGSEQPGRSEKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRV 77
          N  S Q  R EKRKS++ IAA+SLD+ELQ V+NLKR+SIGSMD+LIDPE+EFRV
Sbjct: 26 NAASIQQARKEKRKSDMFIAAKSLDNELQSVQNLKRLSIGSMDLLIDPELEFRV 79

>Suva_13.35 Chr13 (51377..54325) [2949 bp, 982 aa] {ON} YML109W
           (REAL)
          Length = 982

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 139/409 (33%), Positives = 194/409 (47%), Gaps = 75/409 (18%)

Query: 540 DQESSPEHTQRVSSDF--LGVSSSAKPTNVPTEKINHSRHRH------------------ 579
           D+E   +  +   +DF  L VS  AK T   +E+INHS++RH                  
Sbjct: 594 DEEDIGDCVEDEKADFVNLSVSRRAKSTKRASERINHSKNRHSPIFQMQSDESKSVVVTS 653

Query: 580 --------YSIDDTANXXXXXXXXXXXXXXXXXXKKQRKEKKFIQLFKRNRTTSTNGREK 631
                    S +  A                   KK   EK+  +LFKR +    N   K
Sbjct: 654 SVTSLSPSQSTESAAPAVVEKEQGSPNDNKPPAHKKHSLEKRLARLFKRKQH---NNNSK 710

Query: 632 DDGPSISEKLQSSNAVKVLKTRTSSTNLRKNRLSPKKTRLSGDGRRESVKEDFGSTQDYK 691
            D      K+   N  + LK +TS ++L K R SPKK                  +Q  +
Sbjct: 711 SDA-----KVIKKNVKQELKKKTSHSSLSKFRKSPKK-----------------KSQQVE 748

Query: 692 VVREEKE-PLAKLQPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSE 750
           VV++    P+  +   +  TP    P+ ++ P  +N+      N    H ++ V+++ +E
Sbjct: 749 VVQDRSSSPVETVSTRILDTPIEIEPIVEN-PTNSNIFSGGNTN----HSSELVVETINE 803

Query: 751 PELEADEEAGPRTDAIHEGITESNTQAEADTVXXXXXXXXXXXXXXXXFTKSQEPNAPEL 810
             L+ D+        I+  + E     + DT                   +  E   P L
Sbjct: 804 --LDGDDSFDISGGDINYNV-EVTANMDTDTTAEPNER----------VGEEDEDTVPTL 850

Query: 811 QAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINV 870
               +   +L P+KL F DVI PE PNAP+KF+DS+FGFPLP +T STV+M DHRL INV
Sbjct: 851 TPQLS---ILLPKKLTFEDVITPEYPNAPIKFTDSAFGFPLPMITNSTVIMFDHRLGINV 907

Query: 871 ERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEG 919
           ERAIYRLSHLKL DP RELRQQV+LSNFMY+YLNLVNH+LY++Q+  E 
Sbjct: 908 ERAIYRLSHLKLSDPGRELRQQVLLSNFMYSYLNLVNHTLYMEQIGSEN 956

 Score =  166 bits (419), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 133/343 (38%), Positives = 179/343 (52%), Gaps = 44/343 (12%)

Query: 116 IDITSTEYLQESEGTGFE-------SLGSSSNDADCGKRTLSGVRRGGLSGKTRMNNNLS 168
           IDIT TEYL + E    E       S  SSS       R LSGV          +  + S
Sbjct: 180 IDITQTEYLHDEETLEKEKSSRNASSSTSSSARVTSSNRRLSGVNSFAHDEVLDVAEDHS 239

Query: 169 AKDEESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXX 228
           + +  ++T NLLWVPA+QHPN+KPENYLELVQDTL  ++I  D +       DEK     
Sbjct: 240 S-NTANLTQNLLWVPASQHPNVKPENYLELVQDTLQNIQITTDQDP------DEK----N 288

Query: 229 XXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKM 288
                      + RSG  S+VRRPS L+ S+T              G  +  +  S+ + 
Sbjct: 289 SDLSNNHVFSNRQRSG--SIVRRPSHLKTSYTKFDDEPSSVDRQRQGHGQAEKRISSLET 346

Query: 289 PSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSP 348
            S+      R  SLK+ITEELT+IS+ AG TD DA++LAR+LSM+ S +T+E    + S 
Sbjct: 347 KSI------RCVSLKEITEELTKISDNAGLTDSDAITLARSLSMSGS-FTNE-SLHLSSN 398

Query: 349 EKKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAEHNELD 408
           +   + E+AS+M  K+GL IP R SLRRSKFNTY+IR         +N   P+   N L 
Sbjct: 399 KTDSDNEFASNMFNKSGLTIPER-SLRRSKFNTYKIR-------LENNDLLPTGRPNSLM 450

Query: 409 RSPIRVDQKNAQL--------QSPTSVNDFNEIYDHYRQSSFD 443
                 D++ A          Q  T +NDF EI++HYR++S D
Sbjct: 451 NVQTNDDRRRASSPASYTQPPQDQTPLNDFQEIFEHYRRTSTD 493

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/44 (79%), Positives = 44/44 (100%)

Query: 34 EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRV 77
          EKRKS+VLIAA+SLD+E+QHVKNLKR+SIGSMD++IDPE+EF+V
Sbjct: 51 EKRKSDVLIAAKSLDTEIQHVKNLKRLSIGSMDLVIDPELEFKV 94

>KNAG0G03370 Chr7 complement(724041..727271) [3231 bp, 1076 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1076

 Score =  177 bits (449), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 89/97 (91%)

Query: 819  VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878
             LPPRKL ++DV +PE+PNAP++F+DS+FGFPLP LTVSTV+M DHRL INVERAIYRLS
Sbjct: 929  TLPPRKLTYADVKRPEKPNAPIQFTDSAFGFPLPMLTVSTVIMFDHRLGINVERAIYRLS 988

Query: 879  HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQL 915
            HLKL D KRELRQQV+LSNFMYAYLNLVNH+LY++Q+
Sbjct: 989  HLKLSDSKRELRQQVLLSNFMYAYLNLVNHTLYMEQV 1025

 Score =  169 bits (428), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 169/353 (47%), Gaps = 61/353 (17%)

Query: 138 SSNDADCGKRTLSG---VRRGGLSGKTRMNNNLSAKDEESVTHNLLWVPANQHPNIKPEN 194
           SS  A    R LSG   +RRG  S  ++    LS   +  +  NLLWVPANQHPN+KPEN
Sbjct: 194 SSTSASANGRKLSGAGFLRRGS-SAVSQTARKLSGTAD--LKSNLLWVPANQHPNVKPEN 250

Query: 195 YLELVQDTLHTLKIEPDN-------EGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSG-LN 246
           YLELV DTL T+  E D        + S + G     V              + R+G  +
Sbjct: 251 YLELVHDTLQTINGEGDGDGDGHTIDTSADTGTAADSVDESDKENNNTRLRVRYRNGKAS 310

Query: 247 SLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDIT 306
           SLVRRPS LR+S+                 D      S D+    R     +S SL+DIT
Sbjct: 311 SLVRRPSRLRRSYIETDEDEDSNTSNAKIDDIEEGGRSLDERKPTRTNGDRKSVSLRDIT 370

Query: 307 EELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESV--------------------G 346
           EELT++SN  G TD DAV+LARTL+M  + YTD D E +                    G
Sbjct: 371 EELTKMSNSVGLTDDDAVTLARTLNMTCT-YTDTDSEGLDNLRTDSKEQLRAEESENPPG 429

Query: 347 SPEKK---PEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPSAE 403
           +   K    E ++AS+M  KNGL+IP RSSLRRSKFNTYRIR TS    AP+ L      
Sbjct: 430 TTHAKILPDENQFASNMFMKNGLSIPTRSSLRRSKFNTYRIRTTS----APTPLVEKPKR 485

Query: 404 HN---------ELDRSPIRVDQKNAQLQSPTSVND----------FNEIYDHY 437
           +N          LD       +  A LQSPT  ND           +++YDHY
Sbjct: 486 NNSRHARLSFVHLDDEEFASHESPAALQSPTVNNDEAGVIESPGSISDLYDHY 538

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 37/47 (78%), Positives = 45/47 (95%)

Query: 35 KRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSP 81
          KRKSEVLIAAQSLD E+Q+VK+LKR+SIGSMD+LIDPE+EFRV+ +P
Sbjct: 26 KRKSEVLIAAQSLDVEVQNVKHLKRLSIGSMDLLIDPELEFRVNSTP 72

>CAGL0J06688g Chr10 complement(640041..642527) [2487 bp, 828 aa]
           {ON} similar to uniprot|P54786 Saccharomyces cerevisiae
           YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 828

 Score =  165 bits (417), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 137/383 (35%), Positives = 196/383 (51%), Gaps = 66/383 (17%)

Query: 38  SEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQXX 97
           SE L AAQSLD E+Q+VKNLKR+SIGS+D++ DPE+   V+ +  +     DTS+D    
Sbjct: 21  SEYLRAAQSLDQEVQNVKNLKRLSIGSIDLITDPELNVTVTGTERE-----DTSYDADLS 75

Query: 98  XXXXXXXXXXXXX-------XXXXXIDITSTEYLQESEGTGFESLGSSSNDADCG---KR 147
                                    ID T  EYL     T +++   SSN++  G    R
Sbjct: 76  NGSFTEEDDTTTEIDGSDADETSASIDRTRVEYL-----TSYDNTQESSNESPKGVARTR 130

Query: 148 TLS-----------GVRRGGLSGKTRMNNNLSAKDEE-SVTHNLLWVPANQHPNIKPENY 195
           +L+            ++   L G   ++N    K+EE SV+  L WVPANQHPN+KPENY
Sbjct: 131 SLNLNYHANSNSDISIKERTLRGSRSLSNLKKPKNEEQSVSDKLFWVPANQHPNVKPENY 190

Query: 196 LELVQDTLHTLK-IEPDNEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSG 254
           LELV++TL+ ++ I  D +   E  ++E++               +LR    S+VRRPS 
Sbjct: 191 LELVKETLNKIRDINTDGKEKSENNSEEEV-----SNKENINENGRLRG---SIVRRPSK 242

Query: 255 LRKSFTXXXXXXXXXXXXTSGGDENAEL----PSADKMPSVRPRIGSRSSSLKDITEELT 310
           LRKS+T                 E+ EL     S +++ S R    S+  SLK+IT EL 
Sbjct: 243 LRKSYTEFSS-------------EDLELLDKALSNNRIISTRNTTNSKRLSLKEITNELV 289

Query: 311 RISNRAGFTDGDAVSLARTLSMASSYYT-DEDG-------ESVGSPEKKPEKEYASSMLT 362
           + SN+AG TD +AV+LARTLS+ASS    +E G       E     E   +  +A++++ 
Sbjct: 290 KHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADDDTFATAVVG 349

Query: 363 KNGLAIPARSSLRRSKFNTYRIR 385
            +       SSLRRSKFNTYR++
Sbjct: 350 NSHSLASNTSSLRRSKFNTYRVK 372

 Score =  165 bits (417), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 85/97 (87%)

Query: 822 PRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLK 881
           P+KL F DV KPER NAPM+F+DS+FGFPLPPLT+STV+M DHRL INVERAIYRLSHLK
Sbjct: 696 PKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSHLK 755

Query: 882 LGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEE 918
           L +  RELRQQV+LSNFMYAYLNLV H+L +++ +++
Sbjct: 756 LSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQD 792

>CAGL0F03421g Chr6 complement(336157..338610) [2454 bp, 817 aa] {ON}
           similar to uniprot|P50111 Saccharomyces cerevisiae
           YMR273c ZDS1
          Length = 817

 Score =  164 bits (414), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 92/115 (80%)

Query: 800 TKSQEPNAPELQAPAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTV 859
           T SQ   A +    A+   + PPRKL F+DV K ++ NAP++F+DS+FGFPLP LT STV
Sbjct: 701 TPSQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAPIEFTDSAFGFPLPELTYSTV 760

Query: 860 VMIDHRLPINVERAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
           +M DHRLPI+VERAIYRLSHLKL + KR LR+QV+LSNFMY+YLNLVNH+LY++Q
Sbjct: 761 IMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSNFMYSYLNLVNHTLYMEQ 815

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 142/284 (50%), Gaps = 47/284 (16%)

Query: 173 ESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXX 232
           + V  NLLWV A+QHPN+KPENY+ELVQD LH ++I+   E   E  +    V       
Sbjct: 148 DEVAQNLLWVRADQHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSN 207

Query: 233 XXXXXXXQLRSGLNS-LVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSV 291
                    RS  N+ LVRRPS LRKS+T             S  + N      D  P  
Sbjct: 208 NK-------RSPNNTGLVRRPSLLRKSYTEFDEVKDSDIKEQSSTNNN-----VDSTP-- 253

Query: 292 RPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESVGSPE-- 349
                ++  +LKDITEELTRISN+AG T+ DAV+LARTLSMAS    DE  +    PE  
Sbjct: 254 ----HNKKFTLKDITEELTRISNKAGLTNNDAVTLARTLSMASVAEEDETDDLQERPEAE 309

Query: 350 -------KKPEKEYASSMLT-KNGLAIPARSSLRRSKFNTYRIRNTSGGSTAPSNLRSPS 401
                  +  +  YAS+ML   + L     S+L+RSK+ TY IR        P+   S  
Sbjct: 310 DDYARQSRNNDDNYASTMLLPTDSLIKSEHSTLKRSKY-TYHIRTQEDKD--PTIPVSTE 366

Query: 402 AEHNELDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFDSS 445
           ++H ++  +            SP S+ND   IYDHYR+ S D S
Sbjct: 367 SQHQDVIEA------------SPGSIND---IYDHYREPSGDWS 395

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%)

Query: 38 SEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEF 75
          SEV IAAQSLD EL+ VKNLKR+SIGSMD+L+DPEM+ 
Sbjct: 6  SEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDM 43

>KAFR0B03860 Chr2 complement(798642..801173) [2532 bp, 843 aa] {ON}
           Anc_8.831 YMR273C
          Length = 843

 Score =  160 bits (406), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 69/96 (71%), Positives = 84/96 (87%)

Query: 819 VLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLS 878
           +LPPRKL F DV KPE+ N PM+++DS+FGFPLP LTVSTV+M D RL  NVERAIYRLS
Sbjct: 715 ILPPRKLTFDDVKKPEKVNGPMQYTDSAFGFPLPLLTVSTVIMYDCRLATNVERAIYRLS 774

Query: 879 HLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
           HLKLG+ KR LR+QV++SNFMYAYLNLVNH+L+++Q
Sbjct: 775 HLKLGNRKRPLREQVLVSNFMYAYLNLVNHTLFMEQ 810

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 107/360 (29%), Positives = 161/360 (44%), Gaps = 31/360 (8%)

Query: 34  EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSP-SPSQPAPTTDTSH 92
           E+R S + +AAQSL  E+Q+V +LKR+S+GS+DML D ++EF  +    +  A  T    
Sbjct: 9   EQRNSRIYLAAQSLGHEVQNVNHLKRLSVGSIDMLTDTDVEFSFNKLQRNISAKKTQEIL 68

Query: 93  DQQXXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSSNDADCGKRTLSGV 152
            Q+                     D    +   ESE T   +  S + D        +  
Sbjct: 69  SQKRTSTETESVSYNTLLEGFYGSD----DAEDESEKTTRNTSISETRDKSPSVPARARG 124

Query: 153 RRGGLSGKTRMNNNLSAKD--EESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEP 210
           R+ G   ++    NL  K   ++ ++  LLWV A+ HPN+KPENY+ELVQDTL       
Sbjct: 125 RKVGAVSRSSRTANLGKKGGYDKEISKGLLWVSADVHPNVKPENYIELVQDTLEQYN-SS 183

Query: 211 DNEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXX 270
           D   S     D++++                    +SLVR+PS LRKS+           
Sbjct: 184 DYSISERLPEDKQVLLSAFRAKKS-----------HSLVRKPSKLRKSYISIESNNTPAE 232

Query: 271 XXTSGGDENAELPSADKMPSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTL 330
              +         S D + S        + SLK+++EEL +IS+ AG T  DA++LA TL
Sbjct: 233 NNDANAHRKPLGSSRDPVVS--------TISLKELSEELAKISSSAGLTKDDAITLATTL 284

Query: 331 SMASSYYTDEDGESVGSPEKKPE--KEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTS 388
            +  S    ++  ++ S +        +A+S      L IP RS LR    N+ R RN S
Sbjct: 285 WLTHSLLHSDNVTTIKSSQDIDGYINSFATSFSRSGPLEIPKRSVLRVK--NSARKRNVS 342

>Ecym_2710 Chr2 (1373818..1376508) [2691 bp, 896 aa] {ON} similar to
           Ashbya gossypii AAL185W
          Length = 896

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/288 (41%), Positives = 151/288 (52%), Gaps = 38/288 (13%)

Query: 173 ESVTHNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXX 232
           E  + NLLWVPA+QHPN+K ENYLELV DTLH L++    +      ++ ++        
Sbjct: 123 EPFSSNLLWVPADQHPNVKLENYLELVTDTLHNLQLVGREQLEKNPNSNYQLSQTNSTSA 182

Query: 233 XXXXXXXQLRSGLNSLVRRPSGLRKSFTXXXXXXXXXXXXTSGGDENAELPSADKMPSVR 292
                        NSLVR+PS LRKSFT             S  D N E P + +     
Sbjct: 183 HEAIPSK------NSLVRKPSRLRKSFTEAENIDDP----NSDEDLNTETPISKR----- 227

Query: 293 PRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDE---DGESVGSPE 349
                R SSLK+ITEELTRISN AG TD DA++LARTL + +   TD        V S +
Sbjct: 228 ----KRVSSLKEITEELTRISNNAGLTDSDAITLARTLGIGTPAATDRRNFTNTDVASND 283

Query: 350 KKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSG--------GSTAPSNLRSPS 401
           +  E EYAS++LTKNGL+I   SSLRRSKF TYRIR+ SG        GS  PS L   +
Sbjct: 284 EIDE-EYASNILTKNGLSISQGSSLRRSKFATYRIRSPSGDSLPLLESGSLLPS-LPEYA 341

Query: 402 AEH--NELDRSPIRVDQKNAQLQ----SPTSVNDFNEIYDHYRQSSFD 443
            E   N L  + +  + +  Q      +P S N  N+IYDHY  +  D
Sbjct: 342 QEQVANHLKDAHVFKEGQPPQSWDASITPQSPNSINDIYDHYNTTDTD 389

>TPHA0C04720 Chr3 complement(1017585..1020803) [3219 bp, 1072 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1072

 Score =  157 bits (398), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/116 (63%), Positives = 88/116 (75%), Gaps = 4/116 (3%)

Query: 812  APAAGGYVLPPRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVE 871
             PA     LP RKL F+DV    R N P++F DS+FGFPLP LT ST++M ++RLPI+VE
Sbjct: 930  GPAPVTSTLPLRKLTFADVPPTGRANGPVQFMDSTFGFPLPLLTRSTIIMFENRLPISVE 989

Query: 872  RAIYRLSHLKLGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAG 927
            RAIYRLSHLKLGD K+ELRQQV+LSNFMYAYL+LVNHSLYL+Q       G D +G
Sbjct: 990  RAIYRLSHLKLGDTKKELRQQVLLSNFMYAYLHLVNHSLYLEQYG----LGADGSG 1041

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 142/356 (39%), Gaps = 106/356 (29%)

Query: 171 DEESV--THNLLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXX 228
           +EE V  T+ + WV A+QHPN+ P   L  V + LH   IE           D+++    
Sbjct: 138 NEEKVDSTNAVKWVRADQHPNVSPSKQLNEVLENLH---IE-----------DKQVT--- 180

Query: 229 XXXXXXXXXXXQLRSGLNSLVRRPSGLR-----KSFTXXXXXXXXXXXXTSGGDEN-AEL 282
                        +   +S+VRRPS LR     +SF              +   EN +  
Sbjct: 181 ----KKDRLSITYKKNKSSIVRRPSKLRHSSNDESFDSDIEDPSFTKDHDTFSFENESSF 236

Query: 283 PSADKMPSVRPRIGSRSS-----------SLKDITEELTRISNRAGFTDGDAVSLARTLS 331
            + D+      R  SR +           SLK+IT+ELTRISN AG  D DA++LA++L 
Sbjct: 237 STNDQTDISITRFDSRDTINSNGNSNHRLSLKNITDELTRISNDAGLVDSDAINLAQSLG 296

Query: 332 MASSY-------YTDE-------------DGESVGSPEKKPEKEYASS---MLTKNGLAI 368
           + SSY       Y D+             + E+    +K       +S       NG+ +
Sbjct: 297 LTSSYQNNINDFYDDKNLAIYDSTINESSNMETFNEQDKILNLNSENSKGGTFAVNGMKV 356

Query: 369 PARSSLRRSKFNTYRI-RNTSGGSTAPSN-------LRSPSAEHNELDRSPIRVDQKNAQ 420
           P RSSLRRSKFNTYR  RN    S  P         + S      + D + I+V   N Q
Sbjct: 357 PMRSSLRRSKFNTYRYSRNNQKDSDIPEKKEIENPYMGSQHISEEKSDVTEIQVALSNNQ 416

Query: 421 --LQSP---------------------------------TSVNDFNEIYDHYRQSS 441
             L SP                                 + V+DF +IYDHYRQ S
Sbjct: 417 NALVSPERNNDKISFKDSQKDYLTKPIEEKADADEQSGSSPVSDFQDIYDHYRQPS 472

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 35/45 (77%)

Query: 34 EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVS 78
          E R   +L A Q LD E+++V +LKR SIGSMDMLIDPE+E+R+S
Sbjct: 12 ESRNPAMLKAVQYLDREIKNVNHLKRFSIGSMDMLIDPELEYRIS 56

>TBLA0D03190 Chr4 complement(776722..781770) [5049 bp, 1682 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1682

 Score =  158 bits (400), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 87/104 (83%)

Query: 824  KLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLKLG 883
            KL F+DV +  +PN+ M F +S+FGFPLPPLT ST++MID+RLPINVERAIYRLSHLKL 
Sbjct: 1430 KLTFADVKRNLQPNSSMIFQESAFGFPLPPLTNSTIIMIDNRLPINVERAIYRLSHLKLS 1489

Query: 884  DPKRELRQQVILSNFMYAYLNLVNHSLYLQQLDEEGPTGVDAAG 927
            DPKRELR+QV+LSNFMY+YL+LVNH+LYL+Q+ +    G +  G
Sbjct: 1490 DPKRELREQVLLSNFMYSYLHLVNHTLYLEQVTQGNGDGEETTG 1533

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 140/339 (41%), Gaps = 87/339 (25%)

Query: 179 LLWVPANQHPNIKPENYLELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXXXXXXXX 238
           L W   N+  ++KP+NY+ELV D +++         S    N    +             
Sbjct: 368 LSWSSVNKRSSLKPDNYIELVNDAINSSNNVSVTTNSTPTANK---IEQGDSYYDNIPDS 424

Query: 239 XQLRSGLNSLVRRPSGLRKSFT------XXXXXXXXXXXXTSGGDE----NAELPSADKM 288
            +++   NS VRRPS LR S+T                  ++  DE    + +L   D  
Sbjct: 425 RKVKYRRNSNVRRPSSLRNSYTDLDFNLADYEDNLNISNVSNSIDEVSNNDHQLTPDDSF 484

Query: 289 ---PSVRPRIGSRSSSLKDITEELTRISNRAGFTDGDAVSLARTLSMASSYYTDEDGESV 345
               +V     + + +LKD+T+ELT++SN AG TD DA++LA+TLS+      +    + 
Sbjct: 485 NFDANVTNNSVASNLTLKDLTDELTKLSNNAGLTDSDAITLAKTLSLNERLLDNTTTVNS 544

Query: 346 GSPEKK-----------------------------PEKEYASSMLTKNGLAIPARSSLRR 376
            +  K+                              +KEYAS++   + + I  RS+L+R
Sbjct: 545 NTNVKRYKSNKINLFNEDNINNIPNNMNQDEEIVEDDKEYASNLNYDDNINISNRSTLKR 604

Query: 377 SKFNTYRIRNTSGGSTAPSNL--------RSPS---------------------AEHNE- 406
           +KF +   R   G S+  SNL        R PS                     AE N  
Sbjct: 605 NKFKSATSR---GNSSEESNLQLDLETIKRDPSNNMPNIIISKSTIDVNDSIDNAESNNK 661

Query: 407 --LDRSPIRVDQKNAQLQSPTSVNDFNEIYDHYRQSSFD 443
             LD + +  +Q N    SP++    +EIYDHYRQ+S D
Sbjct: 662 KFLDSNEMLNNQLNV---SPSA----SEIYDHYRQTSGD 693

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 11/59 (18%)

Query: 30 PGRS-----------EKRKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRV 77
          PGRS           +KR S+V IAAQSLD ++Q+VK LKR SIGS+D+L DP++E  V
Sbjct: 18 PGRSKSQNRKSLLDRQKRNSDVRIAAQSLDLQVQNVKKLKRQSIGSIDLLADPDLELVV 76

>TBLA0B03200 Chr2 complement(743165..746425) [3261 bp, 1086 aa] {ON}
            Anc_8.831 YMR273C
          Length = 1086

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 82/93 (88%)

Query: 822  PRKLAFSDVIKPERPNAPMKFSDSSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLK 881
            P KL+FSDV + ++PN  M F+DS+FGFPLP LT STV+M D+RLPI+VERAIYRLSHLK
Sbjct: 968  PHKLSFSDVKRLDKPNGTMIFTDSAFGFPLPLLTNSTVIMFDYRLPISVERAIYRLSHLK 1027

Query: 882  LGDPKRELRQQVILSNFMYAYLNLVNHSLYLQQ 914
            L +PKR LRQQV+LSNFMYAYL+LVNH+LY+++
Sbjct: 1028 LSEPKRTLRQQVLLSNFMYAYLHLVNHTLYMEK 1060

 Score =  142 bits (358), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 127/409 (31%), Positives = 181/409 (44%), Gaps = 106/409 (25%)

Query: 36  RKSEVLIAAQSLDSELQHVKNLKRISIGSMDMLIDPEMEFRVSPSPSQPAPTTDTSHDQQ 95
           R+ E+LIAAQ+LD E+Q VK LKR SIGS D++ DPE+EFRV+                 
Sbjct: 36  REDELLIAAQTLDFEVQSVKELKRFSIGSNDLVGDPELEFRVN----------------- 78

Query: 96  XXXXXXXXXXXXXXXXXXXXIDITSTEYLQESEGTGFESLGSSSNDADCGKRTL-SGVRR 154
                                  T+   L  ++ +  +   S S  +   KRT  + +RR
Sbjct: 79  -----------------------TNVNDLSTNDVSLVKRSASLSRGSTISKRTANTSLRR 115

Query: 155 GGLSGKTRMNNNLSAK-----------------DEESV--THNLLWVPANQHPNIKPENY 195
           G  + K   N  +S                   D E+V  + NLLWVPA+QHPN KP+N 
Sbjct: 116 GQSTSKVSYNGRISYNKSSMPKQHTHQTLDDDIDNENVPISKNLLWVPASQHPNAKPKN- 174

Query: 196 LELVQDTLHTLKIEPDNEGSVEGGNDEKIVHXXXXXXXXXXXXXQLRSGLNSLVRRPSGL 255
             + QD+L        N G V+  N +                   R   NSLVR+PS L
Sbjct: 175 --INQDSLL-------NNGLVQDSNSDLDTQEELQRNKSYLNS---RRKNNSLVRKPSTL 222

Query: 256 RKSFTXXXXXXXXXXXXTSGGDENAELPSAD-KMPSVRPRIGSRSS-----SLKDITEEL 309
           RKS+T                  N    ++D +M +++   G+  S     SL DI EEL
Sbjct: 223 RKSYTDFTDDDSDYNRSREANTSNNSRNTSDNEMNNLKASHGNSPSADSTFSLNDIKEEL 282

Query: 310 TRISNRAGFTDGDAVSLARTLSMASSYYT----DEDGESVGSPE---------------- 349
           ++ISN AG T+ +A +LAR+LS+   Y      +ED E+  S +                
Sbjct: 283 SKISNSAGLTETNAATLARSLSITGKYINRELLEEDDEASTSDDNNDANDINTSIEDKST 342

Query: 350 -------KKPEKEYASSMLTKNGLAIPARSSLRRSKFNTYRIRNTSGGS 391
                   + + E+AS +L    + +P RSSLRR KFNTYR+R++S  S
Sbjct: 343 LKQIPDLNEVDGEFASHILLTKNVNVPVRSSLRRKKFNTYRVRSSSTTS 391

>KLLA0C17644g Chr3 (1557138..1561868) [4731 bp, 1576 aa] {ON}
           similar to uniprot|P32660 Saccharomyces cerevisiae
           YER166W DNF1 Non-essential P-type ATPase that is a
           potential aminophospholipid translocase localizes to the
           plasma membrane and late exocytic or early endocytic
           membranes likely involved in protein transport
          Length = 1576

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 6/88 (6%)

Query: 665 SPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQPSVSLTPKSRPPLTQDKPKQ 724
           +P+ +  S    R S++ +FG      +    K+ L  L PS+ + P  +    +D  K 
Sbjct: 392 TPRNSLDSVGSYRNSMESEFGG----DLTERGKDDLCLLDPSLPVLPDCK--FAKDYWKS 445

Query: 725 NNVGEDLRLNNQDKHRADSVLDSDSEPE 752
            +VG+ +R++N D+  AD +L S S+ +
Sbjct: 446 VSVGDIVRVHNNDEIPADIILLSSSDSD 473

>TPHA0B03400 Chr2 complement(787511..792292) [4782 bp, 1593 aa] {ON}
           Anc_8.231 YER166W
          Length = 1593

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 53/111 (47%), Gaps = 17/111 (15%)

Query: 645 NAVKVLKTRTSSTNLRKNRLSPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKLQ 704
           N + V +TR +S N R +  S +  R S +  R S+        DY V     EP     
Sbjct: 339 NKLHVQRTREASGNPRNSLDSMESYRGSAEYGRPSL--------DYDV----DEPYDMYA 386

Query: 705 PSVSLTPKSRPP-----LTQDKPKQNNVGEDLRLNNQDKHRADSVLDSDSE 750
            + ++  KS PP      ++D  K  NVG+ +R++N D+  AD +L S S+
Sbjct: 387 NNGTVIDKSLPPREDCKFSKDYWKNVNVGDIVRIHNDDEIPADIILLSTSD 437

>NCAS0A03670 Chr1 complement(732993..737768) [4776 bp, 1591 aa] {ON}
           Anc_8.231
          Length = 1591

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 64/136 (47%), Gaps = 16/136 (11%)

Query: 649 VLKTRTSSTN----LRKNRL-SPKKTRLSGDGRRESVKEDFGSTQDYKVVREEKEPLAKL 703
           +L+++T++ N    + +N L S    R+SGD  R S++ D   T     ++ +   +   
Sbjct: 343 ILRSQTAAINGGIDMARNSLDSIGSYRMSGDYGRPSLEYD---TVGQSALKTDNANIM-- 397

Query: 704 QPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVL----DSDSEPELEADEEA 759
               SL P+S    ++D  K   VG+ +R++N D+  AD +L    DSD    LE     
Sbjct: 398 --DRSLPPRSDCKFSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLD 455

Query: 760 GPRTDAIHEGITESNT 775
           G     + E +  S++
Sbjct: 456 GETNLKVRESLKCSHS 471

>KLTH0F03564g Chr6 (309896..314143) [4248 bp, 1415 aa] {ON} weakly
            similar to uniprot|P25300 Saccharomyces cerevisiae
            YCR038C BUD5 GTP/GDP exchange factor for Rsr1p (Bud1p)
            required for both axial and bipolar budding patterns
            mutants exhibit random budding in all cell types
          Length = 1415

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 845  SSFGFPLPPLTVSTVVMIDHRLPINVERAIYRLSHLK----LGDPKRELRQQVILSNFMY 900
            SS   PLPPL V T  ++  R   ++ER +     L     LG    ELR    L N + 
Sbjct: 1037 SSISIPLPPLNVGTSSLLSKRNLNDIERILKHYHSLTSRTILGSSSNELRDNCDLENMIQ 1096

Query: 901  AYLNLVNHS 909
             + +LVN S
Sbjct: 1097 KWSSLVNAS 1105

>KLLA0C08723g Chr3 (762625..765501) [2877 bp, 958 aa] {ON} similar
           to uniprot|P11655 Saccharomyces cerevisiae YNR026C SEC12
           Guanine nucleotide exchange factor (GEF) glycosylated
           integral membrane protein of the endoplasmic reticulum
           important for the initiation of transport vesicle
           budding from the endoplasmic reticulum through
           activation of the GTPase Sar1p
          Length = 958

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 5/90 (5%)

Query: 694 REEKE-PLAKLQPSVSLTPKSRPPLTQDKPKQNNVGEDLRLNNQDKHRADSVLD----SD 748
           +EE E  + K +PS+ + P+      Q   ++NN+G +  +       A+ V+     +D
Sbjct: 604 KEETEVAIEKTEPSIDILPEEATQQEQTDHEENNIGIENNVEVALDITAEEVVSQDKTAD 663

Query: 749 SEPELEADEEAGPRTDAIHEGITESNTQAE 778
             P+LE + EA    D I E +TE+ T  E
Sbjct: 664 EGPDLEIENEAEIAADIIAEKVTENRTDDE 693

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,308,937
Number of extensions: 3939264
Number of successful extensions: 14441
Number of sequences better than 10.0: 171
Number of HSP's gapped: 14988
Number of HSP's successfully gapped: 228
Length of query: 935
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 816
Effective length of database: 39,836,145
Effective search space: 32506294320
Effective search space used: 32506294320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 71 (32.0 bits)