Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03938g8.837ON37637614130.0
SAKL0D01540g8.837ON36538710111e-136
NCAS0C004308.837ON3693849221e-122
Kwal_27.102758.837ON3792288381e-109
Skud_13.4488.837ON3643968041e-104
TDEL0B006008.837ON3692287502e-96
CAGL0M02937g8.837ON3732287469e-96
Kpol_1068.118.837ON3812297321e-93
KAFR0B039008.837ON3792287269e-93
TPHA0I002208.837ON3772296991e-88
TBLA0D032308.837ON3752286963e-88
ZYRO0G14124g8.837ON3692316921e-87
Smik_13.4898.837ON3722306877e-87
YMR276W (DSK2)8.837ON3732306807e-86
Suva_13.4648.837ON3662306772e-85
Ecym_46088.837ON4062256654e-83
NDAI0K004408.837ON4042296602e-82
ABL129W8.837ON3452206421e-80
KLLA0D01859g8.837ON3712286391e-79
KNAG0J002908.837ON3672385823e-71
TBLA0B032408.837ON2842231291e-07
Smik_9.215.701ON124541123e-06
Skud_9.205.701ON125541123e-06
Smik_11.3575.701ON125541123e-06
TDEL0G017504.16ON77541074e-06
NDAI0H002704.16ON77541066e-06
Kwal_YGOB_Anc_5.7015.701ON128711098e-06
KLTH0E01078g5.701ON128711099e-06
ZYRO0G06622g5.701ON128711081e-05
KLLA0A00616g5.701ON128711081e-05
TPHA0E002405.701ON128711081e-05
TPHA0D046005.701ON128711081e-05
TBLA0E021105.701ON128711081e-05
CAGL0G02475g5.701ON128711081e-05
KAFR0D022305.701ON128711081e-05
KAFR0H002205.701ON128711081e-05
Suva_11.3305.701ON128711081e-05
Skud_11.3335.701ON128711081e-05
YIL148W (RPL40A)5.701ON128711081e-05
YKR094C (RPL40B)5.701ON128711081e-05
Kpol_1043.695.701ON128711081e-05
SAKL0E14894g5.701ON128711081e-05
NDAI0E050305.701ON128711081e-05
NCAS0A032105.701ON128711081e-05
NCAS0G002405.701ON128711081e-05
TDEL0B022005.701ON128711081e-05
Suva_10.32singletonON62541031e-05
Kpol_1036.628.311ON77711041e-05
KNAG0J028804.16ON153711082e-05
Ecym_84084.16ON153711082e-05
TPHA0K022504.16ON153711082e-05
AFR285C5.701ON128711052e-05
KNAG0L021205.701ON128711052e-05
Ecym_40195.701ON128711053e-05
TPHA0C008908.311ON77711013e-05
TPHA0C023908.386ON150711063e-05
Suva_10.34singletonON151711063e-05
Suva_9.405.701ON144561054e-05
TBLA0G006704.16ON229711084e-05
NDAI0D049304.16ON229711084e-05
KAFR0I014704.16ON229711084e-05
Kwal_55.206074.16ON231711084e-05
KLTH0F08734g8.386ON150711054e-05
Kwal_23.33118.386ON150711054e-05
NCAS0C029408.386ON152711054e-05
Ecym_41818.386ON152711054e-05
Suva_10.33singletonON254711084e-05
ZYRO0C04026g8.386ON152711055e-05
SAKL0H13926g8.386ON154711045e-05
KLLA0D18304g8.386ON150711045e-05
KAFR0H020008.386ON152711046e-05
YLR167W (RPS31)8.386ON152711046e-05
SAKL0H25784g4.16ON305711086e-05
KLTH0G12540g8.311ON7771996e-05
KLTH0E05852g4.16ON409711096e-05
CAGL0G08173g8.386ON152711046e-05
TDEL0F051008.386ON150711046e-05
NDAI0G022808.386ON152711046e-05
Skud_12.294.16ON381711087e-05
YLL039C (UBI4)4.16ON381711087e-05
ACL062C4.16ON382711087e-05
Suva_10.304.16ON381711087e-05
AGL128W8.386ON152711037e-05
KLLA0E00749g4.16ON381711088e-05
Smik_12.184.16ON460711088e-05
ZYRO0G07854g4.16ON460711088e-05
Kpol_1070.64.16ON533711088e-05
CAGL0D05082g4.16ON533711088e-05
NCAS0C058504.16ON388711089e-05
KNAG0C065805.701ON149711029e-05
TBLA0H031808.386ON152711021e-04
Suva_10.2668.386ON152711021e-04
Skud_12.2348.386ON152711021e-04
Smik_12.2298.386ON152711021e-04
SAKL0D11814g1.480ON400671061e-04
NDAI0F003005.701ON187771031e-04
KNAG0A027308.386ON150711011e-04
TDEL0F043808.311ON7756961e-04
ZYRO0D05962g8.311ON7756962e-04
Kpol_1030.58.386ON152711002e-04
Kpol_1024.168.386ON152711002e-04
AFR358W1.480ON413691052e-04
NCAS0B035208.311ON7771934e-04
KLTH0C03410g1.480ON391531025e-04
Kwal_27.101521.480ON381531015e-04
SAKL0H15818g8.311ON7756917e-04
KAFR0E005301.480ON37963999e-04
NDAI0J010708.311ON7756900.001
Ecym_35721.480ON44369990.001
KAFR0C030008.142ON39750950.003
Suva_5.321.480ON40969950.003
Smik_5.561.480ON39770950.003
NDAI0G003301.480ON42753940.004
TBLA0B021601.480ON40468940.005
Skud_5.531.480ON39769930.006
YEL037C (RAD23)1.480ON39870920.006
CAGL0L01309g1.480ON39273920.007
KLLA0F17974g8.311ON7771830.009
TBLA0D022108.142ON56338900.013
SAKL0H24772g8.142ON41443880.022
NCAS0B045908.142ON44742870.027
CAGL0L06028g8.142ON50538870.032
NDAI0B01850singletonON40344860.041
YDR139C (RUB1)8.311ON7756770.058
CAGL0B01589g8.311ON7756760.084
TPHA0O004401.480ON36959830.094
KLLA0E22133g1.480ON38368830.10
Kwal_56.238838.311ON5249720.15
ZYRO0F05192g1.480ON38462810.16
Smik_7.918.142ON39938790.27
YGL181W (GTS1)8.142ON39638790.27
TDEL0B046908.142ON44238790.29
NCAS0G041201.480ON39258780.37
NCAS0C040908.142ON39655770.54
Suva_10.31singletonON6442680.70
Kpol_370.61.480ON40471760.71
Suva_7.818.142ON40138750.74
NCAS0A053906.343ON7348680.94
Suva_14.3876.343ON7348671.5
Skud_14.3646.343ON7348671.5
CAGL0M10912g6.343ON7351671.5
TDEL0C025901.480ON36862721.7
NDAI0K022306.343ON7348661.8
KNAG0M011706.21ON33956694.5
Skud_7.908.142ON39638679.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03938g
         (376 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   548   0.0  
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   394   e-136
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   359   e-122
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   327   e-109
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   314   e-104
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   293   2e-96
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   291   9e-96
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   286   1e-93
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   284   9e-93
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   273   1e-88
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   272   3e-88
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   271   1e-87
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   269   7e-87
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   266   7e-86
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   265   2e-85
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   260   4e-83
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   258   2e-82
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   251   1e-80
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   250   1e-79
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   228   3e-71
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    54   1e-07
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     48   3e-06
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     48   3e-06
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    48   3e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    46   4e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    45   6e-06
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    47   8e-06
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    47   9e-06
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    46   1e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    46   1e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    46   1e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    46   1e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    46   1e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    46   1e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    46   1e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    46   1e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    46   1e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    46   1e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    46   1e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    46   1e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    46   1e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    46   1e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    46   1e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    46   1e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    46   1e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    46   1e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    44   1e-05
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    45   1e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    46   2e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    45   2e-05
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    45   2e-05
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    45   3e-05
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    44   3e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    45   3e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    45   3e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   4e-05
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    46   4e-05
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              46   4e-05
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    46   4e-05
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    46   4e-05
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    45   4e-05
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    45   4e-05
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    45   4e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    45   4e-05
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    46   4e-05
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    45   5e-05
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    45   5e-05
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    45   5e-05
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    45   6e-05
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    45   6e-05
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    46   6e-05
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    43   6e-05
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    47   6e-05
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    45   6e-05
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    45   6e-05
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    45   6e-05
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    46   7e-05
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    46   7e-05
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    46   7e-05
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    46   7e-05
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    44   7e-05
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    46   8e-05
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    46   8e-05
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    46   8e-05
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    46   8e-05
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    46   8e-05
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             46   9e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    44   9e-05
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    44   1e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    44   1e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    44   1e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    44   1e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    45   1e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        44   1e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    44   1e-04
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    42   1e-04
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    42   2e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    43   2e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    43   2e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    45   2e-04
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    40   4e-04
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    44   5e-04
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    44   5e-04
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    40   7e-04
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    43   9e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    39   0.001
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    43   0.001
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    41   0.003
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    41   0.003
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    41   0.003
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    41   0.004
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    41   0.005
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    40   0.006
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    40   0.006
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    40   0.007
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    37   0.009
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    39   0.013
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    39   0.022
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    38   0.027
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    38   0.032
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    38   0.041
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    34   0.058
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    34   0.084
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    37   0.094
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    37   0.10 
Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON...    32   0.15 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    36   0.16 
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    35   0.27 
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    35   0.27 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    35   0.29 
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    35   0.37 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     34   0.54 
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    31   0.70 
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    34   0.71 
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    33   0.74 
NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa] {O...    31   0.94 
Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON...    30   1.5  
Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON...    30   1.5  
CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa] ...    30   1.5  
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    32   1.7  
NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON...    30   1.8  
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    31   4.5  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    30   9.0  

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/376 (75%), Positives = 285/376 (75%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KILDDHSVHLVKSGGSKK                                 NLSTGQGNG
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLXXXXXXXXXXXX 240
           MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML            
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDSAAGGGSSF 240

Query: 241 XXXXXXXEXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXNPFLSMLGGGSA 300
                  E                      F                 NPFLSMLGGGSA
Sbjct: 241 PAPGTPAEADAPSQPAANPSAAPSAGTANPFASLLGGQAGASGASPAANPFLSMLGGGSA 300

Query: 301 GTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRS 360
           GTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRS
Sbjct: 301 GTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRS 360

Query: 361 GGSVQGALDALLNGDV 376
           GGSVQGALDALLNGDV
Sbjct: 361 GGSVQGALDALLNGDV 376

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  394 bits (1011), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 215/387 (55%), Positives = 248/387 (64%), Gaps = 33/387 (8%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV+I+P++T+ + K AI+  SEI P NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI DDH+VHLV+SGG K                                  N+S+GQ  G
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPS----------NISSGQTGG 110

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPL+DLT ARYAG+ NLPSAD FGPDGG+T+APNSD++L ML+NP++QSQMNEMLSNPQ
Sbjct: 111 FNPLADLTGARYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQ 170

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLXXXXXXXXXXXX 240
           M+DF+IQQ+PQLQ+MGP+AR LLQS +FRQMMTNPDMIRQSMQF+ M             
Sbjct: 171 MVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAF 230

Query: 241 XXXXXXXEXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXNPFLSMLGGGS- 299
                  +                                        NPF S+  G + 
Sbjct: 231 PAPGTATQTASTEGGPAGT------------TASPSTTGNGSANSEAANPFASLFNGQAN 278

Query: 300 -------AGTPPALDPMVLSSILGGAGAA---NQQPQDTRPPEERYEHQLRQLNDMGFFE 349
                   G  P  DP +LSS LGG  AA    QQPQD RPPEERYE QLRQLNDMGFF+
Sbjct: 279 PFASMFPNGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFD 338

Query: 350 FDRNVAALRRSGGSVQGALDALLNGDV 376
           FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 339 FDRNVAALRRSGGSVQGALDALLNGDV 365

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  359 bits (922), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 233/384 (60%), Gaps = 23/384 (5%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQN W V+IDP+STI Q K  IA  SE+   NQRLI+SGKILKDDQTVE Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KILD  S+H+VKSGG                                    N++ G+  G
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAP--------------NMAAGETGG 106

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMT-SAPNSDDVLRMLENPVMQSQMNEMLSNP 179
           FNPLSDLTSARYAG+LNLPSAD+FGPDGG+  S PN D++LRML+NPV QSQMNEMLSNP
Sbjct: 107 FNPLSDLTSARYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNP 166

Query: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLXXXXXXXXXXX 239
           QM+DF+IQ +PQLQ+MGPQAR +LQ+P FRQM+TNPDMIRQSMQ +  +           
Sbjct: 167 QMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQ 226

Query: 240 XXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXNPFLSMLGGGS 299
                                                            NP ++    G 
Sbjct: 227 ANTSSDFPAPGGDDDNTVSENTPSTTNTASTNPSSTATTNAANPFASLFNPAMNPFAAGM 286

Query: 300 A-------GTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDR 352
           A       G PPA DP   +S+     A  QQ +DTRPPEERYEHQLRQLNDMGFF+FDR
Sbjct: 287 ANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQ-EDTRPPEERYEHQLRQLNDMGFFDFDR 345

Query: 353 NVAALRRSGGSVQGALDALLNGDV 376
           NVAALRRSGG+V+ AL+ALLNGDV
Sbjct: 346 NVAALRRSGGNVESALNALLNGDV 369

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  327 bits (838), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/228 (72%), Positives = 182/228 (79%), Gaps = 6/228 (2%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSITVH+KSGQ+KWDV++D  ST+AQFK+AIA  S+IAPENQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KILD H+VHLVKSG                                     +LS+GQ  G
Sbjct: 61  KILDGHAVHLVKSG------TKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGG 114

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPLSDLTSARYAG+LNLPSADSFGPDGGMTSAPNSDD+LRMLENPVMQSQMNEMLSNPQ
Sbjct: 115 FNPLSDLTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQ 174

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           MIDFLIQQSPQLQSMGPQAR +LQSPFFRQMMTNP+MIRQSMQFS +L
Sbjct: 175 MIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVL 222

 Score =  145 bits (367), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 79/91 (86%), Gaps = 3/91 (3%)

Query: 289 NPFLSMLG--GGSAGTPPALDPMVLSSILGGAGA-ANQQPQDTRPPEERYEHQLRQLNDM 345
           NPFLSMLG     AG  PA DP +LS++LGGAG  A+QQPQDTRPPEERYE QLRQLNDM
Sbjct: 289 NPFLSMLGQQAPGAGGLPAFDPAMLSALLGGAGNNASQQPQDTRPPEERYEQQLRQLNDM 348

Query: 346 GFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           GFFEFDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 349 GFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  314 bits (804), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/396 (47%), Positives = 223/396 (56%), Gaps = 52/396 (13%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+VA+ P  T+ QFK AI+  + I   NQRLIYSGKILKDDQTV+SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KILDDHSVHLVKS------GGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLS 114
            I D HSVHLVKS      GG+                                   N+S
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATP----------------NMS 104

Query: 115 TGQGNGFNPLSDLTSARYAGFLNLPSADSFGPDGGM--TSAPNSDDVLRMLENPVMQSQM 172
           +GQ  GFNPL+DLTSARYAG+LN+PSAD FGPDGG     + N D++LRM+ENP+ QSQM
Sbjct: 105 SGQSAGFNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQM 164

Query: 173 NEMLSNPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLXXXX 232
           NEMLSNPQM+DF+IQ +PQLQ+MGPQA         RQM+ +P        F  ML    
Sbjct: 165 NEMLSNPQMLDFMIQSNPQLQAMGPQA---------RQMLQSP-------MFRQMLTNPE 208

Query: 233 XXXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXNPFL 292
                                                                   NPF 
Sbjct: 209 MMRQSMQFARMMDPNADNSAASAFPAPGGDASEEGANTNAVPSSNAGTNGSANAAANPFA 268

Query: 293 SML---------GGGSAGTP-PALDPMVLSSILGGAGAANQ--QPQDTRPPEERYEHQLR 340
           S+L          G +A T  PA DP +L+S+     A+ Q  QP+D+RPPEERYEHQLR
Sbjct: 269 SLLNPALNPFANAGNTAPTGMPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLR 328

Query: 341 QLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           QLNDMGFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 329 QLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  293 bits (750), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 143/228 (62%), Positives = 167/228 (73%), Gaps = 8/228 (3%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSITV +K GQ+KW+V+++P  T+A+FK  IA  SEI   NQRLIYSGKILKDDQ VESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI D H++HLVKSGG                                    N+++GQ  G
Sbjct: 61  KIQDGHAIHLVKSGGG--------GGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGG 112

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPLSDLTSARYAGF NLPSAD FGPDGG+T+ PN DD+L MLENP+ QSQMNEMLSNPQ
Sbjct: 113 FNPLSDLTSARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQ 172

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           M+DF+IQ +PQLQ+MGPQAR LLQSPFFRQM+TNP M+RQSMQFSSM+
Sbjct: 173 MVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMM 220

 Score =  118 bits (296), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 67/93 (72%), Gaps = 5/93 (5%)

Query: 289 NPFLSMLGGGSAGTPP-----ALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLN 343
           NP  SM G    G          DP +L+S+LGG  A  +  QD RPPEERYE QLRQLN
Sbjct: 277 NPLASMFGNQGVGAADNQQNQPFDPSMLASLLGGGAAQQRAEQDNRPPEERYEQQLRQLN 336

Query: 344 DMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           DMGFF+F++NVAALRRSGGSVQGALD+LLNGDV
Sbjct: 337 DMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  291 bits (746), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 141/228 (61%), Positives = 168/228 (73%), Gaps = 12/228 (5%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV+IDPS TI   K  IA  SEI   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
            I DDH++H+VKSGG+                                   N+++GQ  G
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPS------------NIASGQTGG 108

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPL+DLT ARYAG+ NLPSAD FGPDGG+ +AP+ D++LRM+ENP+ QSQMNEMLSNP+
Sbjct: 109 FNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPE 168

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           M+DF+IQ +PQLQ+MGPQAR +LQSPFFRQM+TNP MIRQSMQF+ M+
Sbjct: 169 MLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMM 216

 Score =  125 bits (314), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (77%), Gaps = 7/94 (7%)

Query: 289 NPFLSMLG------GGSAGTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQL 342
           NPF +M+G      GG+    PA DP +L+S+LGG   A  Q +D RPPEERYE QLRQL
Sbjct: 281 NPFAAMMGNMNNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQ-EDNRPPEERYEQQLRQL 339

Query: 343 NDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           NDMGFF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 340 NDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 373

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  286 bits (732), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 144/229 (62%), Positives = 167/229 (72%), Gaps = 8/229 (3%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I +HIKSGQNKW+V +D S+T+ Q K  IA  SEI  ENQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI D+HS+HLVKSGG+ K                                 N++ GQ  G
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPS-------NIAAGQSGG 113

Query: 121 FNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179
           FNPLSDLTSARYAG+ LNLPSAD FGPDGGM S PN DD+LRMLENPV QSQMNEMLSNP
Sbjct: 114 FNPLSDLTSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNP 173

Query: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           QMIDF+IQ +PQLQ+MGP+AR + QSPFFRQM+TNP+MIRQSMQ ++M+
Sbjct: 174 QMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMM 222

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 1/73 (1%)

Query: 304 PALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGS 363
           PA DP + +S+        Q+ QD RPPEERYE QLRQLNDMGFF+FDRNVAALRRSGGS
Sbjct: 310 PAFDPSLFASMFQPPQQQQQE-QDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGS 368

Query: 364 VQGALDALLNGDV 376
           VQGALDALL+ DV
Sbjct: 369 VQGALDALLSNDV 381

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  284 bits (726), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 166/228 (72%), Gaps = 7/228 (3%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSIT+HIKSGQNKWDV  + S +IA  K  I+  SEI   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI + HS+HLVKSGG+                                   N+++GQ  G
Sbjct: 61  KIEEGHSIHLVKSGGN-------VARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGG 113

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPL+DLTSARYAG+LN+PSAD FGPDGG+ S P+ DD+LRML+NPV QSQMNEMLSNPQ
Sbjct: 114 FNPLNDLTSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQ 173

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           MIDF+IQ +PQLQ+MGPQAR +LQSP FRQM+ NPDMIRQSMQF+ M+
Sbjct: 174 MIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMM 221

 Score =  117 bits (292), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 70/92 (76%), Gaps = 5/92 (5%)

Query: 289 NPFLSMLGGGSAGTP--PALDPMVLSSILGGAGAANQQP--QDTRPPEERYEHQLRQLND 344
           NPF +M    +   P  PA DP +L+S+LG    + Q P  QD RPPEERYE QLRQLND
Sbjct: 289 NPFGAMSSNTNGSQPQQPAFDPALLASMLG-MPQSQQTPAQQDNRPPEERYEAQLRQLND 347

Query: 345 MGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           MGFF+FDRNVAALRRSGGSVQGALDALLNGDV
Sbjct: 348 MGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  273 bits (699), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 137/229 (59%), Positives = 167/229 (72%), Gaps = 8/229 (3%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSI+V IKSGQNKWDVA++PS+TI +FK  I+  S+I   NQRLIYSGKILKD +TVESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI D HS+HLVKSG +                                   N+++GQ NG
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPT-------NITSGQTNG 113

Query: 121 FNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179
           FNPL+DLTSARYAG+ L +PSAD FGPDGGMT+ PN DD+L MLENPV QSQMNEMLSNP
Sbjct: 114 FNPLADLTSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNP 173

Query: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           QM++++I  +PQLQ++GPQAR + QSPFFRQM+TNPDMIRQSM+ + M+
Sbjct: 174 QMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMM 222

 Score =  108 bits (270), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 65/86 (75%), Gaps = 14/86 (16%)

Query: 298 GSAGTP--PALDPMVLSSILGGAGAANQQP-----QDTRPPEERYEHQLRQLNDMGFFEF 350
           G+ GTP  P  +P +L+S+L       QQP     +DTRPPE RYE QLRQLNDMGFFEF
Sbjct: 299 GAPGTPQYPGFNPSMLASML-------QQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEF 351

Query: 351 DRNVAALRRSGGSVQGALDALLNGDV 376
           DRN+AALRRSGGSVQGALDALLN DV
Sbjct: 352 DRNIAALRRSGGSVQGALDALLNNDV 377

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  272 bits (696), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 138/228 (60%), Positives = 162/228 (71%), Gaps = 10/228 (4%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M+I+VHIKSGQN WDV I+ SSTI  FK  IA  SEI   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI D HS+H+VKSG                                      +STG+G+G
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSS----------GMSTGRGSG 110

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPLSDLTSARYAG+ NLPSAD FGPDGG  ++ + DD+L MLENPV QSQMNEMLSNP+
Sbjct: 111 FNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPE 170

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           ++DFLI  +PQLQS+GPQART+ QSP FRQM+TNPDMIRQSM+ + M+
Sbjct: 171 IVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMM 218

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%)

Query: 323 QQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL 372
           Q+P+D RPPEERYEHQLRQLNDMGFF+FD+NVAALRRSGGSVQGA++ALL
Sbjct: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  271 bits (692), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 161/231 (69%), Gaps = 4/231 (1%)

Query: 2   SITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61
           +ITV IKSGQNKW+V +DP ST++ FK  I+  SEI   +QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  ILDDHSVHLVKS----GGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQ 117
           + D HSVHLVKS    G +                                   NLS GQ
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 118 GNGFNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLS 177
             GFNPL+DLTSARYAGF +LPSAD FGPDGG T+ PN +D+L ML+NP+ QSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 178 NPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           NPQM+DF+IQ +PQLQ+MGPQAR + QSPFFRQM+TNP MIRQSMQF+ M+
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMM 233

 Score =  115 bits (288), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 1/70 (1%)

Query: 307 DPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQG 366
           DP +L+S+LG A +  QQPQD RPPEERYE QLRQLN+MGFF+FDRNVAALRRSGGSVQG
Sbjct: 301 DPQLLASMLG-APSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQG 359

Query: 367 ALDALLNGDV 376
           ALD+LLNGDV
Sbjct: 360 ALDSLLNGDV 369

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  269 bits (687), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 135/230 (58%), Positives = 165/230 (71%), Gaps = 12/230 (5%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V++ P ST++QFK AI+  + +   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
            I D HSVHLVKS    +                                 N+S+GQ  G
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATP----------NMSSGQSAG 110

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGM--TSAPNSDDVLRMLENPVMQSQMNEMLSN 178
           FNPL+DLTSARYAG+LN+PSAD FGPDGG     + N D++LRM+ENP+ QSQMNEMLSN
Sbjct: 111 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSN 170

Query: 179 PQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           PQM+DF+IQ +PQLQ+MGPQAR +LQSP FRQM+TNPDMIRQSMQF+ M+
Sbjct: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220

 Score =  123 bits (309), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 73/91 (80%), Gaps = 5/91 (5%)

Query: 289 NPFLSMLGGGSAGTP-PALDPMVLSSILGGAGAANQ--QPQDTRPPEERYEHQLRQLNDM 345
           NPF S   G + GT  PA DP +L+S+     A+ Q  QP+DTRPPEERYEHQLRQLNDM
Sbjct: 284 NPFAS--AGNATGTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDM 341

Query: 346 GFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           GFF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 342 GFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  266 bits (680), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 162/230 (70%), Gaps = 12/230 (5%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MS+ +HIKSGQ+KW+V + P ST+ QFK AI   + I   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
            I D HSVHLVKS    +                                 N+S+GQ  G
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATP----------NMSSGQSAG 110

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGM--TSAPNSDDVLRMLENPVMQSQMNEMLSN 178
           FNPL+DLTSARYAG+LN+PSAD FGPDGG     + N D++LRM+ENP+ QSQMNEMLSN
Sbjct: 111 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSN 170

Query: 179 PQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           PQM+DF+IQ +PQLQ+MGPQAR +LQSP FRQM+TNPDMIRQSMQF+ M+
Sbjct: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 220

 Score =  118 bits (296), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 2/88 (2%)

Query: 289 NPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFF 348
           NPF +     S G P A DP +L+S+      A+Q  +DTRPPEERYEHQLRQLNDMGFF
Sbjct: 288 NPFANAGNAASTGMP-AFDPALLASMFQPPVQASQA-EDTRPPEERYEHQLRQLNDMGFF 345

Query: 349 EFDRNVAALRRSGGSVQGALDALLNGDV 376
           +FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 346 DFDRNVAALRRSGGSVQGALDSLLNGDV 373

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  265 bits (677), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 164/230 (71%), Gaps = 11/230 (4%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MS+ V++KSGQ+KW+V++ P ST+ QFK AI+  + I   NQRLIYSGKILKDDQTVESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
            I D HSVHLVKS    +                                 N+S+GQ  G
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATP---------NMSSGQSAG 111

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGM--TSAPNSDDVLRMLENPVMQSQMNEMLSN 178
           FNPL+DLTSARYAG+LN+PSAD FGPDGG     + N D++LRM++NP+ QSQMNEMLSN
Sbjct: 112 FNPLADLTSARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSN 171

Query: 179 PQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           PQM+DF+IQ +PQLQ+MGPQAR +LQSP FRQM+TNPDMIRQSMQF+ M+
Sbjct: 172 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMM 221

 Score =  112 bits (279), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/90 (67%), Positives = 69/90 (76%), Gaps = 2/90 (2%)

Query: 289 NPFLSMLGGGSAGTPPALDPMVLSSILGGAGAANQQP--QDTRPPEERYEHQLRQLNDMG 346
           NPF +     +A   PA DP +L+S+     AA Q P  +DTRPPEERYE QLRQLNDMG
Sbjct: 277 NPFANAGNSAAATGMPAFDPALLASMFQPQQAAAQAPQPEDTRPPEERYEQQLRQLNDMG 336

Query: 347 FFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           FF+FDRNVAALRRSGGSVQGALD+LLNGDV
Sbjct: 337 FFDFDRNVAALRRSGGSVQGALDSLLNGDV 366

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  260 bits (665), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 156/225 (69%), Gaps = 1/225 (0%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           MSI++H+KSGQNKW V+ DPSS+I   K  IA  S I  ENQRLIYSGKILKDDQTVESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XNLSTGQGN 119
           KI D HS+HLV+SGG K                                   N++ GQ  
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 120 GFNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNP 179
           GFNPL+DLT ARYAG+ NLPS D FGPDGG+ SA   +++L ML+NP+ QSQ+NEML+NP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQF 224
           QMIDFLIQQ P LQ+MGP AR +LQSPFFRQMMTNPD+IRQ  +F
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF 225

 Score =  107 bits (268), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/75 (70%), Positives = 61/75 (81%), Gaps = 2/75 (2%)

Query: 304 PALDPMVLSSILGGAGAAN--QQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSG 361
           P LDP +LS++L G   A   QQ +D RPPEERY+ QL QLN+MGF +FDRNVAALRRSG
Sbjct: 332 PPLDPAMLSALLSGGFTATGRQQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSG 391

Query: 362 GSVQGALDALLNGDV 376
           GSVQGAL+ALLNGDV
Sbjct: 392 GSVQGALNALLNGDV 406

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  258 bits (660), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 161/229 (70%), Gaps = 16/229 (6%)

Query: 2   SITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61
           +I++HIKSGQN W V+ID +++IA  K  IA  SEI   NQRLIYSGKILKDDQ V+ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  ILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNGF 121
           I D HSVHLV+SG  KK                                 N+S GQ  GF
Sbjct: 63  IQDGHSVHLVRSG--KKSTPTPATTNTTTNASNNTVPS------------NISAGQTGGF 108

Query: 122 NPLSDLTSARYAGF-LNLPSADSFGPDGGMT-SAPNSDDVLRMLENPVMQSQMNEMLSNP 179
           NPL+DLTSARYAG+ LNLPSAD+FGPDGGM  S  N D+ L ML+NP++QSQMNEMLSNP
Sbjct: 109 NPLADLTSARYAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNP 168

Query: 180 QMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           QMIDF+IQ +PQLQ+MGPQAR + QSP FRQM+TNPDMIRQSMQ ++M+
Sbjct: 169 QMIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMM 217

 Score =  124 bits (311), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 74/100 (74%), Gaps = 12/100 (12%)

Query: 289 NPFLSMLG----------GGSAGTPPALDPMVLSSILGGAGAANQQPQ--DTRPPEERYE 336
           NPFL+ML            G+ GT P  DP + +S+ GGAGA +  PQ  DTRPPEERYE
Sbjct: 305 NPFLAMLNNAGAGSGTNNAGATGTLPPFDPSMFASLFGGAGAPSTTPQQQDTRPPEERYE 364

Query: 337 HQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
            QLRQLNDMGFF+FDRN+AALRR+GGSV+ A++ALLNGDV
Sbjct: 365 TQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNGDV 404

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  251 bits (642), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 155/220 (70%), Gaps = 10/220 (4%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M+I + +KSGQN+W+V+++ S ++ + K  IA  SEI  ENQRLIYSGKILKDDQTVESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNG 120
           KI D H++HLVKSGG+K                                  ++S GQ  G
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPS----------SISAGQSGG 110

Query: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           FNPL+DLT ARYAG+ NLPS D FGPDGG+ SA   ++++ MLENP+ QSQMNEML+NPQ
Sbjct: 111 FNPLADLTGARYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQ 170

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQ 220
           MIDFLIQQ P LQ+MGP AR +LQSPFFRQM+TNPD+IRQ
Sbjct: 171 MIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIRQ 210

 Score =  106 bits (264), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 1/73 (1%)

Query: 304 PALDPMVLSSILGGAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGS 363
           P LDP +LSS+ G   A+     D RPPEERYE QLRQLNDMGFF+FDRNVAALRR+GGS
Sbjct: 274 PPLDPAMLSSLFGAGAASPAP-ADNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGS 332

Query: 364 VQGALDALLNGDV 376
           VQGALDALLNGDV
Sbjct: 333 VQGALDALLNGDV 345

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  250 bits (639), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 159/228 (69%), Gaps = 12/228 (5%)

Query: 3   ITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKI 62
           I+VH+KSGQN W V I+ ++TI  FK  I+  S +  +NQRLIYSGKILKD +TVESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  LDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNGFN 122
            D HSVH+VKSGG+                                   N+S GQ  GFN
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPS----------NISAGQTGGFN 113

Query: 123 PLSDLTSARYAGFLNLPSADSFGPDGGMTSA--PNSDDVLRMLENPVMQSQMNEMLSNPQ 180
           PL+DLT ARYAG  NLPSAD FGPDGG+ S+   N + +L+MLENP+ QSQMNEMLSNPQ
Sbjct: 114 PLADLTGARYAGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQ 173

Query: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           M+DFLIQQ+PQLQ++GP+AR +LQSPFFRQMMT+P MIRQSMQ ++ +
Sbjct: 174 MVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM 221

 Score =  108 bits (270), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 66/90 (73%), Gaps = 5/90 (5%)

Query: 289 NPFLSMLGGGSAGTPPALDPMVLSSILGG-AGAANQQPQ-DTRPPEERYEHQLRQLNDMG 346
           NPF  +  GG     P  +  +L+S+ GG + A    P  D RPPEERYE QLRQLNDMG
Sbjct: 285 NPFAGLFPGGQQ---PQFNQELLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMG 341

Query: 347 FFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           FF+FDRNVAALRR+GGSVQGALDALLNGDV
Sbjct: 342 FFDFDRNVAALRRAGGSVQGALDALLNGDV 371

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  228 bits (582), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 163/238 (68%), Gaps = 18/238 (7%)

Query: 1   MSITVHIKSGQNKWDVAI--DP-SSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTV 57
           M ITV +K GQN+WDVA+  +P  +T+AQFK  +A  + +  ENQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKILDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQ 117
           E YKI D H+VHLVKSGG+K                                  +++ GQ
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGA--------SMAAGQ 112

Query: 118 GNGFNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAPNS------DDVLRMLENPVMQS 170
             GFNPL+DLTSARYAG+ L +PSAD FGPDGG+TS          +++L MLENP+ QS
Sbjct: 113 QPGFNPLADLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQS 172

Query: 171 QMNEMLSNPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSML 228
           QMNEM SNPQM+DFLIQ +PQLQ+MGPQAR +LQSP FRQM+TNPDM+RQSMQFS M+
Sbjct: 173 QMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMM 230

 Score =  110 bits (274), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 65/96 (67%), Gaps = 8/96 (8%)

Query: 289 NPFLSMLGGGSA------GTPPALDPMVLSSILG--GAGAANQQPQDTRPPEERYEHQLR 340
           NPF S+ GG  A       + P  D       +   GA A    PQDTRPPEERYE QLR
Sbjct: 272 NPFSSLFGGAPAPAAQPFQSAPGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLR 331

Query: 341 QLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           QLNDMGF +FDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 332 QLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 95/223 (42%), Gaps = 22/223 (9%)

Query: 3   ITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKI 62
           I+V+IK  + K+ +  +    I+     I    +I P NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  LDDHSVHLVKSGGSKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLSTGQGNGFN 122
            D H + ++     K                                  N  T  G G N
Sbjct: 62  KDGHCIIVIIHKEEKN-------NLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEG-N 113

Query: 123 PLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSD-DVLRMLENPVMQSQMNEMLSNPQ- 180
            ++  T+          S D +G        P  + ++L++L++P    Q NEML N Q 
Sbjct: 114 IITITTT----------SPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNNQN 162

Query: 181 MIDFLIQQSPQLQSMGPQ-ARTLLQSPFFRQMMTNPDMIRQSM 222
           ++ FLIQ +P L+ M    AR +L+ P  ++   + + + Q +
Sbjct: 163 LLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQI 205

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 13 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 14 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 45.4 bits (106), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 34/54 (62%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 3  VEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M + V   +G+ +  V I  S  +   K  +  +  I P  QRLI+ GK + D+QTV+S 
Sbjct: 1  MYVKVKTLTGK-EISVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSA 59

Query: 61 KILDDHSVHLV 71
          K+ D   +HLV
Sbjct: 60 KLTDGMQLHLV 70

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+ +  + +  S  +   K  +  +  I P  QRLI+ GK + D+QTVES 
Sbjct: 1  MQIKVKTLTGK-EIAIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KILDDHSVHLV 71
           ++D   +HLV
Sbjct: 60 NLIDGMQLHLV 70

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y I  + ++HLV
Sbjct: 31 LEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M +TV   +G+ +  V +DP   + + K  +  +  I P  QRLI+ GK + DD++V S 
Sbjct: 1  MKLTVKTLTGK-EIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KILDDHSVHLV 71
           +     +HLV
Sbjct: 60 NLSSGMQLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 105 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 164 NIQKESTLHLV 174

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 181 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 240 NIQKESTLHLV 250

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 257 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 316 NIQKESTLHLV 326

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 333 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 392 NIQKESTLHLV 402

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++ K L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 155 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 214 NIQKESTLHLV 224

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 231 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 290 NIQKESTLHLV 300

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 309 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 368 NIQKESTLHLV 378

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 385 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 444 NIQKESTLHLV 454

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 440 NIQKESTLHLV 450

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 516 NIQKESTLHLV 526

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 440 NIQKESTLHLV 450

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 516 NIQKESTLHLV 526

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 136 NIQKESTLHLV 146

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 212 NIQKESTLHLV 222

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 288 NIQKESTLHLV 298

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
           M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KILDDHSVHLV 71
            I  + ++HLV
Sbjct: 364 NIQKESTLHLV 374

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   KS I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 3  ITVHIKS-GQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61
          IT++ K   + K  + +DP+ST+ Q K  +A+      +  +LI+SGK+L+D +T+E  K
Sbjct: 2  ITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECK 61

Query: 62 ILDDHSV 68
          + D   V
Sbjct: 62 LKDGDQV 68

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 6/77 (7%)

Query: 1   MSITVHIKSGQNK------WDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDD 54
           + + +HIK    K        + ++ S TI   KS I  +  I P+ QRLI++GK L+D 
Sbjct: 53  LLLHIHIKYSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDG 112

Query: 55  QTVESYKILDDHSVHLV 71
           +T+  Y I  + ++HLV
Sbjct: 113 RTLSDYNIQKESTLHLV 129

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          V +   + I + K  +  +  I P  QRLI+ GK + D QT+E+ K++D   +HLV
Sbjct: 15 VELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 31/56 (55%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          V ++    I + K  +  +  I P  QRLI+ GK + D QTV S K++D   +HLV
Sbjct: 15 VELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+    + ++ S TI   K+ I  +  I P+ QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGKT-ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KILDDHSVHLV 71
           I  + ++HLV
Sbjct: 60 NIQKESTLHLV 70

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1  MSITVHIKS-GQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVES 59
          M+IT+H K   + +  + + PS+TIA+ K  +A   +      ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKILDDHSV 68
           K+ D   V
Sbjct: 61 CKLKDGDQV 69

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M I V   +G+ +  V I  +  + + K  +  +  I P  QRLI+ GK + D+QTV S 
Sbjct: 1  MIIKVKTLTGK-EIPVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSA 59

Query: 61 KILDDHSVHLV 71
           ++D   +HLV
Sbjct: 60 NLIDGMQLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSV 68
          + +D  STI++ K  +A   +      +LIYSGKIL+DD+T+  YK+ D   V
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSV 68
          + ++ SST+ + K  +A   E      +LIYSGKIL+DD+T+  YK+ D   V
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          ++++    + + K  +  +  I P  QRLI+ GK ++DDQTV+S  +     +HLV
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          + K  V ++ SSTI   K+ +A+      +  +LI+SGK+LKDDQTV S  + D+  V +
Sbjct: 10 KEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIM 69

Query: 71 VKS 73
          + S
Sbjct: 70 MIS 72

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 39.3 bits (90), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          V I  +  + + K  +  +  I P  QRLI+ GK + D+Q+V S  ++D   +HLV
Sbjct: 15 VEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query: 1  MSITVHIKS-GQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVES 59
          M IT++ K   + K  + + P++TIA+ K  +A + +      ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKILDDHSV 68
           K+ D   V
Sbjct: 61 CKLKDGDQV 69

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 322 NQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           +Q+  D    E  Y  Q+RQL +MGF + ++N+ AL++S G++  A+D L
Sbjct: 177 DQEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + ++PS+TI + K+ +A  S       +LIYSGK+L+D +TV    + D D  V 
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 70 LVKSGGSKK 78
          ++    S K
Sbjct: 71 MISQKKSTK 79

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQ-RLIYSGKILKDDQTVESYKILD-DHSV 68
          + K  + ++PS+TI + KS +A QS    E+Q +LIYSGK+L+D +TV    + D D  V
Sbjct: 11 KEKVPLDLEPSNTIFEVKSKLA-QSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVV 69

Query: 69 HLVKSGGSKK 78
           +V    S K
Sbjct: 70 FMVSQKKSAK 79

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 37/53 (69%), Gaps = 2/53 (3%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQ-RLIYSGKILKDDQTVESYKI 62
          + K  + ++PS+TI   KS +A Q++   E+Q ++IYSGK+L+D QTVE  ++
Sbjct: 11 KEKIPLDLEPSNTILDVKSQLA-QAKACEESQIKIIYSGKVLQDGQTVEECQL 62

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + +D  STI   K  IA++     +  +LIYSGKILK+D T+ +  + D DH + 
Sbjct: 11 KEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIF 70

Query: 70 LVKSGGSK 77
          ++     K
Sbjct: 71 MISKKKKK 78

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + ++PS+TI + K+ +A  +       +LIYSGK+L+D +TV    + D D  V 
Sbjct: 11 KEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVF 70

Query: 70 LVKSGGSKK 78
          ++    S K
Sbjct: 71 MISQKKSTK 79

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQ-RLIYSGKILKDDQTVESYKILD-DHSV 68
          + K  + ++PS+TI + K+ +A QS    E+Q +LIYSGK+L+D +TV    + D D  V
Sbjct: 11 KEKVPLDLEPSNTILETKTKLA-QSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVV 69

Query: 69 HLVKSGGSKK 78
           +V    S K
Sbjct: 70 FMVSQKKSTK 79

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 3  ITVHIKS-GQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYK 61
          ++V  K+  + K+ + ++ S +I   K A++ +    P   +LI+SGK+LKD  +VES  
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 62 ILDDHSVHLVKSG 74
            D + V  + S 
Sbjct: 62 FKDGNEVIFMVSA 74

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60
          M + V   +G+ +  V +  S T+   K  +  +  I P  Q+LI+ GK + D+ T+ S 
Sbjct: 1  MQLKVKTLTGK-EISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KILDDHSVHLV 71
           + D   +HLV
Sbjct: 60 DLQDGSLLHLV 70

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           +Y  QL++LNDMGF   D N  AL  S G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376
           R+ HQLR L ++G+ + D NV AL  + G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGD 375
           +Y  QLR L DMGF + D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           +Y  +LRQL ++GF    +N+ A+  S G V GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL--NGD 375
           +Y  +LR+L +MGF + D N  AL  + G + GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 34.3 bits (77), Expect = 0.058,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          V +  S  +   K  +  +  I P  QRLI+ GK + D  TV    +++   +HLV
Sbjct: 15 VELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 33.9 bits (76), Expect = 0.084,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 16 VAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLV 71
          V +     +   K  +  +  I    QRLI+ GK + +D T+ + K+ D   +HLV
Sbjct: 15 VEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 12 NKWDVAID--PSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSV 68
           K  +++D   SST+   K  +A Q E      +LIYSGK+L+D  ++E   + D   V
Sbjct: 10 KKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          + K  + +   +TI+  K  IA Q +      +LIY+GKIL+D +TV    + +   V  
Sbjct: 10 KEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQVIF 69

Query: 71 VKSGGSKK 78
          + S   KK
Sbjct: 70 MISKTKKK 77

>Kwal_56.23883 s56 complement(755602..755760) [159 bp, 52 aa] {ON}
          YDR139C (RUB1) - ubiquitin-like protein [contig 171]
          FULL
          Length = 52

 Score = 32.3 bits (72), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1  MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGK 49
          M +TV   +G+ +  V +DPS  + + K  +  +  I P  Q+LI+ GK
Sbjct: 1  MKLTVKTLTGK-EIAVVVDPSDKVYRIKEYLEEKEGIPPTQQKLIFQGK 48

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + +DPSS++   K  +A +        +LIYSGK+L+D + ++   + D D  + 
Sbjct: 11 KEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           RY  +LR L +MG+ + D N  AL  + G +  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSV 68
          + K  +A++ ++T+   K+ +A          +LIYSGK+L+D +T+E   + D   V
Sbjct: 11 KEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 318 AGAANQQPQDTRPPEERYEHQLRQLNDMGF-FEFDRNVAALRRSGGSVQGALDAL 371
            G+    P D+R    +Y  QL +L DMG+  +  R   AL R+ G +  +LD +
Sbjct: 182 GGSNRHHPHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 30.8 bits (68), Expect = 0.70,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 18 IDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVES 59
          ++ S TI   KS I  +  I P+ QRLI++GK L  ++  ++
Sbjct: 17 VESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLGMEELCQT 58

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + ++ S T+   K  IA + +      +LIYSGK+L++D T+    + D D  + 
Sbjct: 11 KEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQVIF 70

Query: 70 LV---KSGGSK 77
          ++   KS G+K
Sbjct: 71 MISKKKSTGTK 81

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           RY  QL +L DMGF + ++N+ AL  + G++  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.8 bits (68), Expect = 0.94,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 23 TIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          ++  FK  ++ Q    P    L   G +LKD  T+E Y+I D+ ++ L
Sbjct: 23 SVGDFKKVLSIQLGTQPNKIVLQKGGNVLKDHITLEDYEIHDNTNLEL 70

>Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 23 TIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          T+  FK  ++ Q    P    L   G +LKD  ++E Y++ D+ ++ L
Sbjct: 23 TVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 23 TIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          T+  FK  ++ Q    P    L   G +LKD  ++E Y++ D+ ++ L
Sbjct: 23 TVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>CAGL0M10912g Chr13 complement(1083434..1083655) [222 bp, 73 aa]
          {ON} highly similar to uniprot|Q6Q546 Saccharomyces
          cerevisiae YNR032ca HUB1
          Length = 73

 Score = 30.4 bits (67), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 23 TIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHLVKS 73
          T+  FK  ++ Q  + P    L   G +LKD  T+  Y++ D+ ++ L  S
Sbjct: 23 TVGDFKKVLSVQLGMQPSKIVLQKGGSVLKDHITLYDYEVHDNTNLELYYS 73

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 11 QNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILD-DHSVH 69
          + K  + +D SS++   K  +A + E      +LIYSGK+L+D ++++   + D D  + 
Sbjct: 11 KEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQVIF 70

Query: 70 LV 71
          ++
Sbjct: 71 MI 72

>NDAI0K02230 Chr11 complement(504359..504580) [222 bp, 73 aa] {ON}
          Anc_6.343 YNR032C-A
          Length = 73

 Score = 30.0 bits (66), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 24/48 (50%)

Query: 23 TIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKILDDHSVHL 70
          TI  FK  ++ Q    P    L   G +LKD  T+  Y+I D+ ++ L
Sbjct: 23 TIGDFKKVLSLQLAAQPNKIVLQKGGNVLKDHITLGDYEIHDNTNLEL 70

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 162 MLENPVMQSQMNEMLSNPQMIDFL--IQQSPQLQSMGPQARTLLQSPFFRQMMTNP 215
           ++ NP M      M+SNP  ++ +  + Q+P +Q M  Q +    +P F +MM NP
Sbjct: 259 LMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFKG-GNTPDFSEMMNNP 313

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 30.4 bits (67), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 334 RYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDAL 371
           RY  QL +L DMG+ +  +N+ AL  + G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,210,801
Number of extensions: 1045328
Number of successful extensions: 2709
Number of sequences better than 10.0: 153
Number of HSP's gapped: 2730
Number of HSP's successfully gapped: 256
Length of query: 376
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 265
Effective length of database: 40,753,473
Effective search space: 10799670345
Effective search space used: 10799670345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)