Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03916g8.838ON57057026000.0
Kwal_27.102728.838ON55141714210.0
SAKL0D01518g8.838ON5744128811e-110
ABL128W8.838ON4743937032e-85
Ecym_46098.838ON5204176661e-79
TDEL0B005908.838ON5414625824e-67
KLLA0D01617g8.838ON5624135625e-64
ZYRO0G14146g8.838ON5074205299e-60
Kpol_1068.108.838ON6174214877e-53
NCAS0B003108.838ON5643544346e-46
TPHA0I002308.838ON6143624367e-46
YML114C (TAF8)8.838ON5103504089e-43
Smik_13.208.838ON5103103992e-41
Suva_13.298.838ON5093583983e-41
Skud_13.278.838ON5143153824e-39
NDAI0E003008.838ON6644383531e-34
TBLA0D032508.838ON6835153292e-31
KAFR0A028208.838ON4533482861e-26
KNAG0G034108.838ON5263541732e-12
CAGL0B02299g8.838ON6431111681e-11
SAKL0B05566g8.779ON505147780.61
ADL090W7.198ON1271180715.1
NCAS0H024905.509ON89938698.1
Skud_4.588.446ON68730698.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03916g
         (570 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...  1006   0.0  
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   551   0.0  
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   343   e-110
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   275   2e-85
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   261   1e-79
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   228   4e-67
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   221   5e-64
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   208   9e-60
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   192   7e-53
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   171   6e-46
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   172   7e-46
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   161   9e-43
Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   158   2e-41
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   157   3e-41
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   151   4e-39
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   140   1e-34
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   131   2e-31
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   114   1e-26
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    71   2e-12
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    69   1e-11
SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {...    35   0.61 
ADL090W Chr4 (523284..527099) [3816 bp, 1271 aa] {ON} Syntenic h...    32   5.1  
NCAS0H02490 Chr8 (492388..495087) [2700 bp, 899 aa] {ON} Anc_5.5...    31   8.1  
Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON} ...    31   8.3  

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score = 1006 bits (2600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/570 (87%), Positives = 501/570 (87%)

Query: 1   MTKXXXXXXXXXXXELKGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSI 60
           MTK           ELKGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSI
Sbjct: 1   MTKSAPDSPSSSSSELKGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSI 60

Query: 61  SQFAFENLIILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELER 120
           SQFAFENLIILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELER
Sbjct: 61  SQFAFENLIILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELER 120

Query: 121 SQYVRSHNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKN 180
           SQYVRSHNL                                 FFIQDKEILTLVPPTPKN
Sbjct: 121 SQYVRSHNLERVRKVREESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKN 180

Query: 181 TKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESP 240
           TKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESP
Sbjct: 181 TKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESP 240

Query: 241 SEGADSDEIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIA 300
           SEGADSDEIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIA
Sbjct: 241 SEGADSDEIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIA 300

Query: 301 RRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLL 360
           RRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLL
Sbjct: 301 RRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLL 360

Query: 361 REQRKXXXXXXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDPFFGGLGSSDTED 420
           REQRK                         KNSKDYDVLDLDNLNEDPFFGGLGSSDTED
Sbjct: 361 REQRKREVELAEENRRLREEQIRQEREERLKNSKDYDVLDLDNLNEDPFFGGLGSSDTED 420

Query: 421 EKEPPQQEGTNKSGNTAPSATPEISDRANTMSADIPGRSVLDEAESQDLTREADMEFDSE 480
           EKEPPQQEGTNKSGNTAPSATPEISDRANTMSADIPGRSVLDEAESQDLTREADMEFDSE
Sbjct: 421 EKEPPQQEGTNKSGNTAPSATPEISDRANTMSADIPGRSVLDEAESQDLTREADMEFDSE 480

Query: 481 KNKDDTSNEYSFQTAGNPRLSPGGPSSALHDFTSTPPALPSSDNREIHEGTPSTSAPQVP 540
           KNKDDTSNEYSFQTAGNPRLSPGGPSSALHDFTSTPPALPSSDNREIHEGTPSTSAPQVP
Sbjct: 481 KNKDDTSNEYSFQTAGNPRLSPGGPSSALHDFTSTPPALPSSDNREIHEGTPSTSAPQVP 540

Query: 541 DNGEQQRQKAPEASVNVNDASAEPQEPRTN 570
           DNGEQQRQKAPEASVNVNDASAEPQEPRTN
Sbjct: 541 DNGEQQRQKAPEASVNVNDASAEPQEPRTN 570

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/417 (65%), Positives = 323/417 (77%), Gaps = 4/417 (0%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           VQL++LP L EIP+  +DDPL+KLLEKA+AIQLK++N++ SISQ AFENLIILVE+MLSN
Sbjct: 19  VQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLSN 78

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           ML+DLHKM NIQRRHCISKKDLLLII+GYNL+ +DLM+ELERS+YVRS +L         
Sbjct: 79  MLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEED 138

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                   FF+ DK++LTLVPP+ K+TK+VPRWLP+FPPDHTYR
Sbjct: 139 SKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTYR 198

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQDTQ 258
           FT+Q+N+PITDERLMKRKLAEEA+LSEKALIHLS LSHEE+ S   DSD I++E+QQ+TQ
Sbjct: 199 FTAQYNKPITDERLMKRKLAEEANLSEKALIHLSMLSHEEASSGPIDSDTIYEEAQQETQ 258

Query: 259 LIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKGA 318
           L+FGP KK K AAIN  +DLLRTLPQQN++VEEYARNRVEIARR+V EYERHQL LQKGA
Sbjct: 259 LLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQLQLQKGA 318

Query: 319 FIKAAHLLSPFAKKR-NCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKXXXXXXXXXXXX 377
           FIKAAHLLSPF+KKR +CKQVEKE+RTLLHRS IGLLKSAP L+E+RK            
Sbjct: 319 FIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALAEENRRL 378

Query: 378 XXXXXXXXXXXXXKNSKDYDVLDLDNLNEDPFFGGLGSSDTEDEKEPPQQEGTNKSG 434
                        K+S ++DVLDL+NLNEDPFFGGLGSSD+EDE+   QQE     G
Sbjct: 379 RDEKLRKEREARSKSSNEFDVLDLNNLNEDPFFGGLGSSDSEDEQ---QQEEKATDG 432

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 189/412 (45%), Positives = 260/412 (63%), Gaps = 10/412 (2%)

Query: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           K ++L+ LP L   P  +L+ P+ K+L +AVAI+LK +N +V++SQFAFENL+ LV + L
Sbjct: 17  KQIRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENL 76

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXX 136
           S ML  LH+ V+IQRR  ISKKDLLL++ GY+L+ ++LM ELE SQY+ S++        
Sbjct: 77  SFMLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIA 136

Query: 137 XXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196
                                     FF +D +IL LVPPT KN +Y+P+WLPEFPPDHT
Sbjct: 137 QKSKELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHT 196

Query: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDE------IF 250
           YRFTSQ+N+P+ DER ++RKL EE   SE+AL++L  L H +S ++   ++E      ++
Sbjct: 197 YRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNL--LKHHDSTNQDLGNNERVEKRSLY 254

Query: 251 KESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERH 310
           +E+Q++T LIFGP +K K      + +LLRTLP +N++VEEYARNRVEIARRKV EYE++
Sbjct: 255 EETQEETFLIFGPERK-KSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYEQY 313

Query: 311 QLLLQKGAFIKAAHLLSPFAKKRNC-KQVEKEVRTLLHRSYIGLLKSAPLLREQRKXXXX 369
           QL LQK  FIKAA+L SP  K     K ++KE++++L RSYIGLL+S P L E +     
Sbjct: 314 QLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKARERE 373

Query: 370 XXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDPFFGGLGSSDTEDE 421
                                +     +VLDL+NLNEDP   G  SSD+E E
Sbjct: 374 LANERRREMLEKLNEERQRQAEAGGGDEVLDLNNLNEDPLLAGFDSSDSEGE 425

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  275 bits (703), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/393 (39%), Positives = 223/393 (56%), Gaps = 16/393 (4%)

Query: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           +G+QL+ LP+L E+ ++   +P++KLL +AV + LK + S+V I+Q  FENL+  VE  L
Sbjct: 17  EGIQLKKLPDLTEVTKS---NPMQKLLAQAVGLHLKTMRSDVGITQLGFENLVQFVELQL 73

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXX 136
            +ML  LH+  N+QRR+ +S KD+ L + G  +    L  E  RSQYVR  +        
Sbjct: 74  DDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQHAGAVRSIE 133

Query: 137 XXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196
                                     FF +D +IL LVPPT  N  YVP+WLPEFPPDHT
Sbjct: 134 EQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPKWLPEFPPDHT 193

Query: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKESQQD 256
           Y+FTS +N+PITDER MKRKL EE+ LSEKAL+H+   + ++  ++ A   +I  + QQ+
Sbjct: 194 YKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQLPQIISDGQQE 253

Query: 257 TQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQK 316
             LI+GP ++ ++A            P + +N+E+YAR RVE+ARR+VEE+E+ +L +QK
Sbjct: 254 NLLIYGPERR-RLAP--------EPAPTRGFNIEDYARCRVELARRRVEEFEQQKLQVQK 304

Query: 317 GAFIKAAHLLSPFAKKR-NCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKXXXXXXXXXX 375
             FI+AA   SP+A  R + K +E+E   LLHRSYIG+L + P LR  +           
Sbjct: 305 NPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAAAYERE 364

Query: 376 XXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDP 408
                             + + VLDL  L++DP
Sbjct: 365 RARQESMRNNTDL---TQQQHGVLDLSALHDDP 394

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  261 bits (666), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 231/417 (55%), Gaps = 22/417 (5%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           +QL+ LP L+E+   A  +P++ LL ++VA+QLK + S+ SI++  F N++  +E  +++
Sbjct: 19  IQLKKLPGLQEV---AKHNPMQILLSQSVALQLKTMKSDFSITELGFNNMMQFIEMQMND 75

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           M   LH+  NIQRR+ IS KDL L + G  +    L  E E+S+Y++             
Sbjct: 76  MFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTYEAEFKNIERQ 135

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                   FF +D +IL LVPPT  N  YVP WLPEFPPDHTY+
Sbjct: 136 SLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWLPEFPPDHTYK 195

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDE----IFKESQ 254
           FT+ +N+PI+DER MKR L EE  LSEKAL+++  L   ++     + +E     +KESQ
Sbjct: 196 FTAIYNKPISDERQMKRMLFEEGKLSEKALLNM--LGSAQAKMLKVEDEETIAQTYKESQ 253

Query: 255 QDTQLIFGPAK---KTKIAAINGAS----DL-LRTLPQQNYNVEEYARNRVEIARRKVEE 306
           ++TQLI+G  K   + + A + G S    DL L +   + +N++EYAR+R+ +ARRKVEE
Sbjct: 254 EETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIGLARRKVEE 313

Query: 307 YERHQLLLQKGAFIKAAHLLSPF--AKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQR 364
           +E H+L  QK  FI+A+ + SP+  A+K   K  E+E   LL RSY+G+LKS P LR+ +
Sbjct: 314 FENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKSIPKLRQLK 373

Query: 365 KXXXXXXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDPFFGGLGSSDTEDE 421
                                     K      V+DL+ L+ED     L S+D+ED+
Sbjct: 374 ---ANEMAAAIERERIKQKEREMELEKKHLQQGVVDLNALHEDALLADLDSTDSEDD 427

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  228 bits (582), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 162/462 (35%), Positives = 239/462 (51%), Gaps = 57/462 (12%)

Query: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           + +QL HLP L+EI     +  + K+L KAVA+QLK + ++  IS+FAFE+L+IL++  L
Sbjct: 8   RHIQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKAD--ISKFAFEHLMILIDDQL 65

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRS---------H 127
           ++M+  LH+  N+QRR  I+K D+ L + GYNLT ADL  + + SQY            H
Sbjct: 66  NDMIGQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSLH 125

Query: 128 NLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRW 187
           +L                                        I  LV P     +Y+P+W
Sbjct: 126 SLKETFTDAVVDEDNGSEDV----------------------INELVRPNNPLIRYIPKW 163

Query: 188 LPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPS---EGA 244
           +P FPPDHTY+FT Q+N+PITDE +++R++ +E   SE AL+HL K  +  +PS   +GA
Sbjct: 164 MPAFPPDHTYKFTPQYNQPITDETIIRRRIVDEGKQSEVALLHLLKNMNPPTPSSDADGA 223

Query: 245 DSDEIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKV 304
             DE     +++T  I+G  +K +    + +SDLL  LPQ N+++EEYAR+RVEIAR+KV
Sbjct: 224 SYDEAL--VREETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKV 281

Query: 305 EEYERHQLLLQKGAFIKAAHL-LSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQ 363
            EYE  Q+ LQ+  FIK + + LS  + K   +Q  +E+ ++L RS   L+KS P L+  
Sbjct: 282 VEYEERQMKLQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMT 341

Query: 364 RKXXXXXXXXXXXXXXXXXXXXXXXXXKN-------SKDYDVLDLDNLNEDPFFGGLGSS 416
           ++                         KN       + D ++LDLD  N+D FF   GS 
Sbjct: 342 KQDARRKAEQKRDERLQELRDKKAQKLKNFTDQQLENGDINLLDLDENNDD-FFNYSGSE 400

Query: 417 DTEDEKEPPQQEGTNKSGN------TAPSATPEISDRANTMS 452
           D    ++ PQ E  N S          P+  PE   RA   S
Sbjct: 401 D----EDLPQAEFENPSMTNDIPVPNLPTPAPEEHSRAEAQS 438

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  221 bits (562), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 145/413 (35%), Positives = 207/413 (50%), Gaps = 25/413 (6%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           V+L  LPNL E+P     +P+ +L  +AV +QLK +N NV ISQ AF++L  +    L +
Sbjct: 21  VRLDKLPNLNEVPHA---NPMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSLLQLDD 77

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           +L  L K+  +QRR  ISK DL L   G  +   DL  ++E S +V              
Sbjct: 78  LLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEANALNET 137

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                   FF+QD +IL L+P + K+ KYVP WLPE PPDHTY+
Sbjct: 138 VLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPPDHTYK 197

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESP--SEGADSD--------- 247
           FTS + RPITDERLMK+KL EE  LSEKAL+++      + P  +   DSD         
Sbjct: 198 FTSLYKRPITDERLMKKKLLEEGRLSEKALLNMLSQVVNQDPLVALNKDSDQSANNAALS 257

Query: 248 EIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTL------PQQNYNVEEYARNRVEIAR 301
           E  KESQ +T LIF P K        G + +L  +      P +N+NV EY + R  I +
Sbjct: 258 EHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVLEYCKKRDAIVK 317

Query: 302 RKVEEYERHQLLLQKGAFIKAAHLLSPFAK--KRNCKQVEKEVRTLLHRSYIGLLKSAPL 359
           R+ E  E      ++  FI+ A + SP+ +   ++ K VE +++T+L RSY+GL+ S P 
Sbjct: 318 RRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRRSYLGLIDSIPR 377

Query: 360 LREQRKXXXXXXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDPFFGG 412
           ++E R+                         K   + ++LDL+NL  DP   G
Sbjct: 378 VKEVRE---RARKEAEERERLLQEQRRIEKEKKMAEQEILDLNNLQTDPLLHG 427

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  208 bits (529), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 224/420 (53%), Gaps = 45/420 (10%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           +Q+  LP L+E+     +  + K+L K+VA+QLK +N+   I+QFAF+ L+ LV+  L++
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQ--ITQFAFDRLLQLVDGQLND 62

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           M+  LH+M N+QRR  I+K D+ ++++G+N++ + + ++   S++               
Sbjct: 63  MISQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSL 122

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEIL------TLVPPTPKNTKYVPRWLPEFP 192
                                      +D+E +       LVPPT     ++P+WLP+FP
Sbjct: 123 RDLQSSLAHEMVP-------------FEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFP 169

Query: 193 PDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKE 252
           PDHTY+FT Q++ PITDE  ++R++ EEA  SE AL HLS+   +++P     +D+I   
Sbjct: 170 PDHTYKFTPQYSHPITDETTIRRQIVEEAKQSELALSHLSQ---KKNP-----TDDIVNR 221

Query: 253 SQQDTQL-------IFGP---AKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARR 302
           SQ D++L       I+G     +KT+    N A DLL  LPQ N++VEEYA NR+E+AR+
Sbjct: 222 SQYDSELAEQETLAIYGSQLKKRKTQHPQANSA-DLLSKLPQTNFSVEEYAHNRIEVARK 280

Query: 303 KVEEYERHQLLLQKGAFIKAAHL-LSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLR 361
           KV E+E  QL  Q+  F+K + +  +    K   KQV +E +  L RS+I L+KS P L 
Sbjct: 281 KVLEFEERQLQSQQDPFLKLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPEL- 339

Query: 362 EQRKXXXXXXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNL--NEDPFFGGLGSSDTE 419
           E+ K                         +   + DVLDLD L  N++ FF  + SSD E
Sbjct: 340 ERNKLETEEKAKEERSKRLQELRAQREEQEKKGERDVLDLDELDQNQEDFF-AMESSDEE 398

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  192 bits (487), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 207/421 (49%), Gaps = 31/421 (7%)

Query: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           K +QL  LP L E      +  + K+L KAVA+QLK++N + SI++FAFE+L+ LV   +
Sbjct: 7   KYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSLVVGQI 66

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXX 136
            +M+++LH++ ++QRR+ ++K D+ + + G+NLT  DL  + ++SQY+            
Sbjct: 67  DDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYL-----------S 115

Query: 137 XXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILT-----LVPPTPKNTKYVPRWLPEF 191
                                       +  K+  T     LVP +    K +P WLP+F
Sbjct: 116 KLYDKDYESLTKIATTTTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDF 175

Query: 192 PPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFK 251
           PPD+TY+FT Q+N PITDE +++RK+ EE   SEKAL++L +   E+  S     D  F 
Sbjct: 176 PPDYTYKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISR----DLKFS 231

Query: 252 ESQQDTQLIFGPAKKTKIAAING-ASDLLRTLPQQN-YNVEEYARNRVEIARRKVEEYER 309
            S+ +       A  + I   N   +      P QN  NVEEYAR RVEI R+KV  YE 
Sbjct: 232 SSEMELATEETLATYSAITLRNKHLTSFFEKEPIQNSLNVEEYARTRVEIERKKVLGYEE 291

Query: 310 HQLLLQKGAFIKAAHLLSPFAKKRNCKQV-EKEVRTLLHRSYIGLLKSAPLLREQRKXXX 368
            QL +Q+  F+K + L+S     +  K V   E+R  L RS +  + S P  +++RK   
Sbjct: 292 RQLQIQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQERKEAR 351

Query: 369 XXXXXX-----XXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNEDP---FFGGLGSSDTED 420
                                      K S D+++LDL N   D    FF  L SSD E 
Sbjct: 352 ERAEEEKERRLAEIKALKEEKLKEMEAKKSSDFNLLDLSNYPNDSHGGFFAALESSDEER 411

Query: 421 E 421
           E
Sbjct: 412 E 412

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  171 bits (434), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 189/354 (53%), Gaps = 22/354 (6%)

Query: 21  LRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNML 80
           +  L N  EIP  + D+ +RKLL K++A+QLK +N  + +SQ AF  L +LV   L  ++
Sbjct: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLN--LELSQLAFNELSLLVNDQLDFLI 87

Query: 81  VDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXXXX 140
            +LH+M  IQRR+  +K D+ L++ G NL  ++L  +L+ S +++S N            
Sbjct: 88  SELHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKN-------GKDYD 140

Query: 141 XXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYRFT 200
                                   + +   + + P  P     +P WLP FPPDHTY+FT
Sbjct: 141 TLIKDSSTIFDSSDTMANPGHDSMVNNPSNILIKPNNPFEIS-IPNWLPAFPPDHTYKFT 199

Query: 201 SQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGADSDEIFKE-SQQDTQL 259
            QFN+PITD+ L+K+KL EE   SEK+L++L     E+S  E  ++     E ++++   
Sbjct: 200 PQFNKPITDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETSNFDSELAREENIA 259

Query: 260 IFG----PAKKTK---IAAINGASDLLRTLPQ--QNYNVEEYARNRVEIARRKVEEYERH 310
           I+G      KK K   + +I+         PQ  +++NV  YA  RVE+ R++VEE+E  
Sbjct: 260 IYGYDAMSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELE 319

Query: 311 QLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQR 364
           QL  +K  F++ + +++   KK +   ++ E++  L RSY  + ++ P L+++R
Sbjct: 320 QLKWEKNPFLRLSRMIND--KKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQER 371

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  172 bits (436), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 114/362 (31%), Positives = 181/362 (50%), Gaps = 21/362 (5%)

Query: 17  KGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           K VQL  LP L E        P+  +L KA+A+QLK +N + +I++FAF +L  LV++ L
Sbjct: 44  KYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDEQL 103

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXX 136
           S+M+  + K+  +QRR  ++KKD+ L + G+NL  +DL +  ++S+Y++           
Sbjct: 104 SDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTLLN 163

Query: 137 XXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHT 196
                                           E L LVP T      +P WLP FPPD+T
Sbjct: 164 RLATDTNEVLTVFKKTDKTLKDDSTL------ETLKLVPITNTLENIIPDWLPSFPPDYT 217

Query: 197 YRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPS------EGADSDEIF 250
           Y+FT QFN+ ITD  ++++K+A E   SEKAL+HL  L  E+  +      +  DSD++ 
Sbjct: 218 YKFTPQFNKHITDATVIRKKVAAEGKKSEKALLHL--LESEKITTSKLLNLDKFDSDDMD 275

Query: 251 KESQQDTQLIFGPA--KKTKIAAINGASDLL----RTLPQQNYNVEEYARNRVEIARRKV 304
               +   L  G +  +K + A      D +           +++E+Y   R+ I R KV
Sbjct: 276 TAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIVRNKV 335

Query: 305 EEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQV-EKEVRTLLHRSYIGLLKSAPLLREQ 363
           ++YE  QL LQ   F+K   LLS    K+  ++V    +  +L RS++ L+ S P L + 
Sbjct: 336 KQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPTLNQN 395

Query: 364 RK 365
           +K
Sbjct: 396 KK 397

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  161 bits (408), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 180/350 (51%), Gaps = 17/350 (4%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           VQLR+LP+L EI    +D P+ ++L+K V  QL ++N  + IS FA + L+ LV   +  
Sbjct: 17  VQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVTVQMDG 74

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           M  +LH +  +QRR   S+ DL L++  +NL    L  + + S++++S +          
Sbjct: 75  MFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFIKSKHSTEYEKLMSW 134

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                      Q  EI  L+PP+    K +P WLP FPPDHTY+
Sbjct: 135 SSLAALPHNEEDEEDELNNIEE-----QQNEINVLLPPSNPLEKQIPSWLPNFPPDHTYK 189

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-LSHEESPSEGADSDEIFKESQQDT 257
           FT +FN PITD + +K+++ +E+  SEKAL++L+K LSH  S S       +  E   + 
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPGLDDEDAIEQ 249

Query: 258 QL-IFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQK 316
           QL I+G A + +   I   S           N+E+YA+ RVE+AR +V ++E +QL   K
Sbjct: 250 QLEIWGNALEERKPTITEKS-------FNENNIEQYAKYRVELARERVTKFEVNQLKRTK 302

Query: 317 GAFIKAAHLLS-PFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRK 365
             F+K +  L  P +  ++ K ++K +     +S    + + P +++ +K
Sbjct: 303 NPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKK 352

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  158 bits (399), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 162/310 (52%), Gaps = 16/310 (5%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           VQLR LP+L EI    +D P+ ++L+K V  QL ++N  + IS FA + L+ LV   +  
Sbjct: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDG 74

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           M  +LH +  +QRR   S+ DL L+   +N+  A L  + + S++++S++          
Sbjct: 75  MFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRL 134

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                      Q  EI  L+PP+    K +P WLP FPPDHTY+
Sbjct: 135 SSFPALAHNEEDEEDELSNIEE-----QQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYK 189

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-LSHEESPSEGADSDEIFKESQQDT 257
           FT +FN PITD + +K+++ +E++ SEKAL++L+K LSH  S S  +    +      + 
Sbjct: 190 FTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPVLDDADATEQ 249

Query: 258 QL-IFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQK 316
           QL I+G A + +   I   S           N+E+YA+ RVE+AR +V ++E +QL   K
Sbjct: 250 QLEIWGNALQERKPTITATS-------LNESNIEQYAKYRVELARERVAKFELNQLKRTK 302

Query: 317 GAFIKAAHLL 326
             F+K +  L
Sbjct: 303 NPFLKLSETL 312

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  157 bits (398), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 183/358 (51%), Gaps = 34/358 (9%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           VQL +LP+L E+    +D P+ ++L+K+V  QL ++N  + IS FA + ++ LV   +  
Sbjct: 17  VQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLN--ICISNFALDEMVNLVAVQMDG 74

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRS-HNLXXXXXXXX 137
           M  +LH +  +QRR  +S+ DL L+   +NL  A L  +L+ S++++S H++        
Sbjct: 75  MFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHIKSKHSVEYEKLVKS 134

Query: 138 XXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTY 197
                                       Q  EI  L+PP+    K +P WLP FPPDHTY
Sbjct: 135 SSFTAVSHIEDDEEDEINNIEE------QQNEINVLLPPSNPLEKLIPSWLPNFPPDHTY 188

Query: 198 RFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-------LSHEESPS--EGADSDE 248
           +FT +FN PITD + +KR++ +E+  SE+AL++L+K        SH  SP   + +D+ E
Sbjct: 189 KFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHTPSPRLPDASDASE 248

Query: 249 IFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYE 308
             +        I+G     +  AI   S           N+E+YA+ R+E+AR +V ++E
Sbjct: 249 RLE--------IWGNTLHERKPAIIAKSF-------NEKNIEQYAKYRIELARERVSKFE 293

Query: 309 RHQLLLQKGAFIKAAHLLSPFAK-KRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRK 365
            +QL   K  F+K +  L  F    ++ K +++ +   L +S    + + P +++ +K
Sbjct: 294 VNQLKRTKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKK 351

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  151 bits (382), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 161/315 (51%), Gaps = 26/315 (8%)

Query: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78
           VQL++LP+L EI    +D P+ ++L K V  QL +++  + IS FA + L+ LV   +  
Sbjct: 17  VQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLD--ICISNFALDELVNLVAVQMDG 74

Query: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXX 138
           M  +LH +  +QRR   ++ DL L+   +NL  A L  +L+ S++++S++          
Sbjct: 75  MFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFIKSNHSVEYEKLVSS 134

Query: 139 XXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYR 198
                                      Q  EI  L+PP+    K +P WLP FPPDHTYR
Sbjct: 135 SSFSASSHNEEDEEDELNNIEE-----QQNEISVLLPPSNPLEKLMPSWLPNFPPDHTYR 189

Query: 199 FTSQFNRPITDERLMKRKLAEEADLSEKA-------LIHLSKLSHEESPSEGADSDEIFK 251
           FT +FN PITD + +KR++ +E+  SEKA       L+H+S  SH   P    D+D    
Sbjct: 190 FTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRLPDDAD---- 245

Query: 252 ESQQDTQLIFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQ 311
             +Q  ++     ++ K  AI+ + +          N+E+YA+ RVE+AR +V ++E +Q
Sbjct: 246 AGEQQLEIWGNALQEEKRTAISKSFN--------ENNIEQYAKYRVELARERVSKFEVNQ 297

Query: 312 LLLQKGAFIKAAHLL 326
           L   K  F++ +  L
Sbjct: 298 LKRTKNPFLRISETL 312

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  140 bits (353), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 122/438 (27%), Positives = 193/438 (44%), Gaps = 112/438 (25%)

Query: 29  EIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNMLVDLHKMVN 88
           EI    +D  + KLL+K++AIQLKA    V  S+ AF  L +LV+  L++++ +LH++  
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFK--VDFSKLAFNQLTLLVDDQLNSLITELHRLSL 77

Query: 89  IQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXXXXXXXXXXXX 148
           +QRR+ ++K DL L + G+N+  +DL  + E S+Y++   L                   
Sbjct: 78  LQRRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQ-EKLSGKEYRILRDLNEEVVKQR 136

Query: 149 XXXXXXXXXXXXXXFFIQDKEI--------LTLVPPTPKNTKYVPRWLPEFPPDHTYRFT 200
                            Q + I        + + P  P     +  WLP FPPDHTY+FT
Sbjct: 137 THIMESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFT 196

Query: 201 SQFNRPITDERLMKRKLAEEADLSEKALIH-LSKLSHEE------------SPS---EG- 243
            QFN PITDE+L+K+KL EE   SEKAL++ L  +S+ +            SPS   EG 
Sbjct: 197 PQFNNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGP 256

Query: 244 -ADSDEIFKES-------QQDTQL----------------IFGPAKKT------------ 267
             D+DE  K++       Q+DT +                I+G   ++            
Sbjct: 257 ITDTDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPN 316

Query: 268 -------KIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFI 320
                  KI    G S        + ++V +Y+ +RVE+ R+KVE +E  +L L+K  F+
Sbjct: 317 IISIHDEKIVNFFGHSS-----SDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFL 371

Query: 321 KAAHL---------------------------------LSPFAKKRNCKQVEKEVRTLLH 347
           K + L                                 LSP  K+    Q+  E+ + L 
Sbjct: 372 KLSKLVCLEKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKR---AQINNEIISNLK 428

Query: 348 RSYIGLLKSAPLLREQRK 365
           RS+  +L + P L++ +K
Sbjct: 429 RSFYSILNNYPKLKKAKK 446

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  131 bits (329), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 207/515 (40%), Gaps = 96/515 (18%)

Query: 21  LRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNML 80
           L++LP+L + P       + +LL K++A+QLK +N N SIS  AF  L+ LV+  L++M+
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 81  VDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXXXX 140
             L ++   QRR  I+  DL L +  +NL  +DL + LE S +++S              
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYELLR 161

Query: 141 XXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTYRFT 200
                                     +     +VPP+    + +P WLP  PPDHTY+FT
Sbjct: 162 DYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDHTYKFT 221

Query: 201 SQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEE---------------------- 238
             +N PITDE +MK+ L  E  L+E ALI L + S                         
Sbjct: 222 PLYNEPITDETVMKKILVNEGKLAESALIKLLEASTTSEINSLPTPETDRENDLEQNINI 281

Query: 239 --------------SPSEGADSDEIFKE---SQQDTQLIFGPAKKTKIAAINGASDLL-- 279
                         S +E  +++E   +   +Q +T+ I+G A   ++  I    +L+  
Sbjct: 282 DTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSA--LQVRKIKKRFELMID 339

Query: 280 ----RTLPQQ-----NYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKAAHLL---S 327
                 L ++      +NVEEYAR +V+  R +V  YE  QL  QK  F K + ++   S
Sbjct: 340 PKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKMIVGPS 399

Query: 328 PFAKKRNC----------------------------------KQVEKEVRTLLHRSYIGL 353
            F    +                                   KQ+  +++ + +RS   L
Sbjct: 400 QFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQMFNRSLNNL 459

Query: 354 LKSAP-LLREQRKXXXXXXXXXXXXXXXXXXXXXXXXXKNSKDYDVLDLDNLNE--DPFF 410
           + S P L +E+                           +       LDL +L +  D  F
Sbjct: 460 INSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSSAGALDLHDLQKENDGLF 519

Query: 411 GGLGSSDTEDEKEPPQQEGTNKSGNTAPSATPEIS 445
             LGSSD +DE     Q   N S  T  + +P++S
Sbjct: 520 ADLGSSD-DDESSTRHQ---NTSDKTQETHSPKLS 550

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  114 bits (286), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 97/348 (27%), Positives = 169/348 (48%), Gaps = 48/348 (13%)

Query: 29  EIPRTALDDP-LRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSNMLVDLHKMV 87
           EI R    +P L  LL K+VA++LK VN +  +   AF+ LI L++  L++++  L ++ 
Sbjct: 15  EIRRQITGNPQLDNLLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLS 74

Query: 88  NIQRRHC-ISKKDLLLIIDGYNLTCADLMVELERSQYVRSHNLXXXXXXXXXXXXXXXXX 146
            +QRR+   +K D+LL++ G+NL+ ++L  ELE S +++                     
Sbjct: 75  LLQRRNSNATKSDILLLLKGFNLSESELNTELEISNHIKR----------------LYSE 118

Query: 147 XXXXXXXXXXXXXXXXFFIQDKEI--LTLVPPTPKNTKYVPRWLPEFPPDHTYRFTSQFN 204
                            F+   E     L+ PT      +P W P  PPDHTY+FT ++N
Sbjct: 119 DEKKLSEDSIHYNQHTDFVGPVETSSFQLLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYN 178

Query: 205 RPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPSEGAD--SDEIFKESQQDTQLIFG 262
             I D +++K+K  +E+   + AL +L  ++  ES  E  D   DE    ++ ++Q +FG
Sbjct: 179 NFINDPKIIKQKRFDESKTVKTALFNL--INKIESNEERNDLHYDETL--AKLESQALFG 234

Query: 263 PAKKTKIAAINGASDLLRTL-----PQQNYNVEEYARNRVEIARRKVEEYERHQLLLQKG 317
             ++     +N    + ++L     P   +++EEY+  RV IAR KV ++E   L L+  
Sbjct: 235 TVEE----KMNTNKKVYKSLNSIIVPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYN 290

Query: 318 AFIKAAHLLSPFAKKRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRK 365
            FI             N    + +V++ L+RS+  ++ S P L  ++K
Sbjct: 291 PFI-------------NLINDQTDVKSYLNRSFQLMINSIPELTLEKK 325

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/354 (21%), Positives = 150/354 (42%), Gaps = 40/354 (11%)

Query: 16  LKGVQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFA------FENLI 69
           +KG  +  +    E+P    D  + ++L  +VA Q+ A  +              F+ L+
Sbjct: 12  VKGALVGDVSAPVELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMAGQAFQLLL 71

Query: 70  ILVEQMLSNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADL--------MVELERS 121
            LVE+ LS M+ +LH++  +QRR   +  D+ L++ G+ LT  D+         +   R 
Sbjct: 72  QLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLSKKIGYNRM 131

Query: 122 QYVRSHNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFIQDKEILTLVPPTPKNT 181
           Q  R   +                                   I +K             
Sbjct: 132 QVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQELPIAEK------------- 178

Query: 182 KYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSKLSHEESPS 241
             +P WLP+ PP+HTY+FT+++N+ + DE+++K K+ +E+   E +L +L +    ++ +
Sbjct: 179 --IPAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADT 236

Query: 242 EGADSD-----EIFKESQQDTQLIFGPAKKTKIAAINGASDLLRTLP---QQNYNVEEYA 293
           +  +       E  K    +   ++GP +  +IA  +      R  P   +++++V+ Y+
Sbjct: 237 KVDERARETPPEELKRIDDEIVALYGPLE--EIAERHEGPRTKRRTPLYLKKSFDVQAYS 294

Query: 294 RNRVEIARRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRTLLH 347
             RV++AR  V+ +E       +  F+  +H   P   K+    +E  +  L+ 
Sbjct: 295 LGRVKLARNAVQRFEWETKYRPRNPFL-CSHRAVPENSKKVYSMLENSLNELVQ 347

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 18  GVQLRHLPNLEEIPRT-ALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQML 76
           GVQ     +++EI  +  +D  + +LL++AV +QL+ ++ +V++++ A + L++  E  L
Sbjct: 12  GVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAMDQLVLFAEDQL 71

Query: 77  SNMLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRSH 127
           + ++  LH++  +QRR  I+  DL + + GYNL  +DL +  E S+++R +
Sbjct: 72  NALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIREN 122

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (69%)

Query: 179 KNTKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLAEEADLSEKALIHL 231
           +N +Y P WLP+FPPDHTY++T  +   +  E  +++KL EE  LSEKAL+ L
Sbjct: 192 RNLRYKPGWLPDFPPDHTYKYTPSYVNVVKPETEIRQKLVEEGRLSEKALVKL 244

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 285 QNYNVEEYARNRVEIARRKVEEYERHQLLLQKGAFIKAAHLLSPFAKKRNCKQVEKEVRT 344
           ++++VE YAR R+EIARRKV ++E  QL L+    ++ A +    A++ +    E E + 
Sbjct: 396 KDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDF---ETEYQK 452

Query: 345 LLHRSYIGLLKSAPLLREQRK 365
            + R+     ++ P+++E+RK
Sbjct: 453 CIKRTMDRFKRNIPIIKEKRK 473

>SAKL0B05566g Chr2 complement(482433..483950) [1518 bp, 505 aa] {ON}
           similar to uniprot|Q02555 Saccharomyces cerevisiae
           YMR239C RNT1 RNAase III cleaves a stem-loop structure at
           the 3' end of U2 snRNA to ensure formation of the
           correct U2 3' end
          Length = 505

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 30/147 (20%)

Query: 170 ILTLVPPTPK-NTKYVPRWLPEFPPDHTYRFTSQFNRPITDERLMKRKLA----EEADLS 224
           I  L+   PK N + V +WL            S+   P+ +E +MK+++A    +E D++
Sbjct: 314 IGGLIEDDPKSNLRRVRKWL------------SKLADPVIEE-VMKKEIALAPTDEVDVN 360

Query: 225 EK----ALIHLSKLSHEESPSEGADSDE---IFKESQQD-TQLIFGPAKKTKIAAINGAS 276
            K    +LI  + L+    P +   SD+   I +   +D T L  G  K  KIA +  A 
Sbjct: 361 AKKTLYSLIGYAALNLHYKPVKKPTSDDPNAIVECRVKDGTVLGVGKGKNIKIAGMRAAQ 420

Query: 277 DLLRTLPQQNYNVEEYARNRVEIARRK 303
           D+LR        VE+YA  R  I R K
Sbjct: 421 DVLRNKSL----VEKYANMRAAIPRTK 443

>ADL090W Chr4 (523284..527099) [3816 bp, 1271 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL030C (SSM4)
          Length = 1271

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 17/180 (9%)

Query: 393 SKDYDVL-DLDNLNEDP-FFGGLGSSDTEDEKEPPQQEGTNKSGNTAPSATPEISDRANT 450
           +K + VL DL   N+ P F   +G +D E+ + P      N+    A     E++DR N 
Sbjct: 238 TKKFAVLADLAIRNDIPEFLQNIGGTDNENWELPLN---LNRRYLQALLYGEELADRRNI 294

Query: 451 -MSADIPGRSVLDEAESQDLTREADMEFDSEKNKDDTSNEYSFQTAGNPRLSPGGPSSAL 509
            +  D  G       E  D   EA    + +    D   EY+ +T  +P       ++AL
Sbjct: 295 HVGQDDNGEHGASHDELDDEENEASFNLNQDDTVIDMQTEYAIETPLDPSEHNIERNAAL 354

Query: 510 HDFTSTPPALPSSDNREIHE-GTPSTSAPQV--PDN----GEQQRQKAPEASVNVNDASA 562
           HDF      L  + + +IH+        PQ   P+N    G+Q   +  +  + +N  SA
Sbjct: 355 HDFVE----LLDAHDVDIHDRNQEMVQMPQFNQPENDWNAGDQDEVRGFQLDIKINLFSA 410

>NCAS0H02490 Chr8 (492388..495087) [2700 bp, 899 aa] {ON} Anc_5.509
           YDR409W
          Length = 899

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%)

Query: 406 EDPFFGGLGSSDTEDEKEPPQQEGTNKSGNTAPSATPE 443
           E+P    L SSD E E EPP Q       NT P++TP+
Sbjct: 464 EEPIVISLDSSDEEPEDEPPTQPPQISDKNTMPTSTPQ 501

>Skud_4.58 Chr4 complement(98588..100651) [2064 bp, 687 aa] {ON}
           YDL199C (REAL)
          Length = 687

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 24  LPNLEEIPRTALDDPLRKLLEKAVAIQLKA 53
           LP  E  PR ++DDP R+LL++A   QL++
Sbjct: 80  LPLSEHTPRMSMDDPYRQLLQQAEISQLRS 109

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,625,900
Number of extensions: 2495994
Number of successful extensions: 10715
Number of sequences better than 10.0: 241
Number of HSP's gapped: 11154
Number of HSP's successfully gapped: 340
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)