Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03894g8.839ON74572634750.0
Kwal_27.102638.839ON74361327950.0
SAKL0D01496g8.839ON68859924700.0
Ecym_46108.839ON75162022540.0
ABL127W8.839ON72860022400.0
KLLA0D01595g8.839ON71960020640.0
TDEL0B005808.839ON71360420100.0
ZYRO0G14168g8.839ON76462119880.0
NCAS0C004208.839ON72561019380.0
KAFR0B039108.839ON72461519270.0
CAGL0M02959g8.839ON75860119070.0
Kpol_1068.98.839ON74560518800.0
TPHA0I002408.839ON73262018660.0
TBLA0D032608.839ON76863418630.0
YMR277W (FCP1)8.839ON73262418590.0
Skud_13.4498.839ON73463718460.0
Suva_13.4658.839ON73262318350.0
Smik_13.4908.839ON73262418320.0
KNAG0J002808.839ON74262317850.0
NDAI0K004208.839ON77855017560.0
NDAI0D018605.202ON5141201047e-04
NDAI0C032305.94ON1034120980.004
SAKL0G12870g5.202ON39960950.008
Skud_8.492.530ON447103940.012
NCAS0A068005.202ON47351910.027
Kpol_1010.615.94ON93276910.030
TPHA0E030705.202ON494147880.055
Smik_8.532.530ON446103880.060
YHR004C (NEM1)2.530ON446103870.077
YLR019W (PSR2)5.202ON39745860.097
Smik_12.825.202ON39245840.18
TPHA0H010705.94ON101558840.22
TBLA0A089504.90ON819249840.23
Skud_12.875.202ON39245820.29
Suva_8.582.530ON452103820.32
ZYRO0B10428g5.202ON48240810.37
KAFR0A018302.530ON44299800.47
KAFR0E021405.94ON95175810.48
NCAS0F009302.530ON42295800.53
YLL010C (PSR1)5.202ON42740780.83
Suva_10.655.202ON41540780.86
KNAG0C058502.530ON443103780.91
Skud_12.575.202ON41540780.91
Smik_12.535.202ON41440780.97
NDAI0H014202.530ON448139771.2
SAKL0H20592g4.156ON50887771.2
TPHA0E036401.52ON1137109781.2
TPHA0N006705.202ON45241771.4
Kpol_2002.1005.202ON47742761.4
NDAI0E039307.46ON1028175761.8
Suva_10.995.202ON38541752.0
Suva_8.4007.46ON985117752.3
Suva_16.2498.527ON480163742.5
Ecym_20665.94ON880115742.8
Ecym_72764.156ON59364743.2
YPL063W (TIM50)8.527ON476162733.4
KAFR0A065604.156ON55538733.7
Kpol_1054.601.534ON71983734.2
Smik_16.1728.527ON477100724.5
TPHA0G014508.716ON668110724.6
TBLA0C060905.202ON48451725.2
Kpol_1002.576.200ON57986716.0
YOL089C (HAL9)3.109ON103073716.5
SAKL0G15620g5.94ON879106717.0
KLLA0E15621g5.94ON89171708.3
ZYRO0C09834g2.68ON1045206718.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03894g
         (745 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...  1343   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...  1081   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   956   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   872   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   867   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   799   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   778   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   770   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   751   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   746   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   739   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   728   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   723   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   722   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   720   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   715   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   711   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   710   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   692   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   681   0.0  
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     45   7e-04
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    42   0.004
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    41   0.008
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...    41   0.012
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    40   0.027
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    40   0.030
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    39   0.055
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...    39   0.060
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...    38   0.077
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    38   0.097
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    37   0.18 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    37   0.22 
TBLA0A08950 Chr1 complement(2200024..2202483) [2460 bp, 819 aa] ...    37   0.23 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    36   0.29 
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...    36   0.32 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    36   0.37 
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...    35   0.47 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    36   0.48 
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...    35   0.53 
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    35   0.83 
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    35   0.86 
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...    35   0.91 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    35   0.91 
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    35   0.97 
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530     34   1.2  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    34   1.2  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    35   1.2  
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    34   1.4  
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    34   1.4  
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    34   1.8  
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    33   2.0  
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    33   2.3  
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    33   2.5  
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    33   2.8  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    33   3.2  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    33   3.4  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   3.7  
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    33   4.2  
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    32   4.5  
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               32   4.6  
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    32   5.2  
Kpol_1002.57 s1002 (157693..159432) [1740 bp, 579 aa] {ON} (1576...    32   6.0  
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    32   6.5  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    32   7.0  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    32   8.3  
ZYRO0C09834g Chr3 (747069..750206) [3138 bp, 1045 aa] {ON} simil...    32   8.3  

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/726 (91%), Positives = 661/726 (91%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60
           MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60

Query: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120
           DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD
Sbjct: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120

Query: 121 QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG 180
           QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG
Sbjct: 121 QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQE 240
           VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPIL           RKCQYYVKLRPGLQE
Sbjct: 181 VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVKLRPGLQE 240

Query: 241 FFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPM 300
           FFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPM
Sbjct: 241 FFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPM 300

Query: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKAE 360
           DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKAE
Sbjct: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKAE 360

Query: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEV 420
           EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEV
Sbjct: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEV 420

Query: 421 QQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQ 480
           QQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQ
Sbjct: 421 QQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQ 480

Query: 481 MKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKA 540
           MKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKA
Sbjct: 481 MKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKA 540

Query: 541 RLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSE 600
           RLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSE
Sbjct: 541 RLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSE 600

Query: 601 KALSESIQQEATQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRX 660
           KALSESIQQEATQ                                            YR 
Sbjct: 601 KALSESIQQEATQELNLLTGNDLWLDNDDDEMDEFLNDEDANDDNEDGGEDLDEQQEYRS 660

Query: 661 XXXXXXXXXTRDVHTTGLSSDSASEHNGGEPENAELDAQHQATKRSFEPAEAETPPKRRN 720
                    TRDVHTTGLSSDSASEHNGGEPENAELDAQHQATKRSFEPAEAETPPKRRN
Sbjct: 661 PSSDSSESSTRDVHTTGLSSDSASEHNGGEPENAELDAQHQATKRSFEPAEAETPPKRRN 720

Query: 721 LNARDP 726
           LNARDP
Sbjct: 721 LNARDP 726

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/613 (83%), Positives = 558/613 (91%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60
           MTTPIRLP NLPFP+TIAKL VS G+SV KGQRLFVYKYWELQD+ITAPNEEA KKKRRV
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAPNEEASKKKRRV 60

Query: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120
           DLIGTFDSP+EGTLVSL + +GDEFVND+N+IAE+ Q CSHEVTYG LCVVCGK V+EDD
Sbjct: 61  DLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGKAVDEDD 120

Query: 121 QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCG 180
            N+S +G+SN KLTVAHNNTNIKVSERQAA+IEKTAQK LRE KKLVLVVDLDQTVIHCG
Sbjct: 121 SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLDQTVIHCG 180

Query: 181 VDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQE 240
           VDPTI EWANDPSNPNYDALKNVKTFSLDEDPIL           R+CQYYVKLRPGLQE
Sbjct: 181 VDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVKLRPGLQE 240

Query: 241 FFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPM 300
           FFDK+APHFELHIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLTHKSLERLFPM
Sbjct: 241 FFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKSLERLFPM 300

Query: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKAE 360
           DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH+GRR+RKKAE
Sbjct: 301 DQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGRRHRKKAE 360

Query: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEV 420
           EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKI+EENQP+R +SKEDLTKKLEHNASLEV
Sbjct: 361 EEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEENQPDRSMSKEDLTKKLEHNASLEV 420

Query: 421 QQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQ 480
           QQQNRPLAELQKHMNNQKLL DDDDELPHLS ILLNVH+TYY++LA+    PDIK LMPQ
Sbjct: 421 QQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEVFPDIKLLMPQ 480

Query: 481 MKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKA 540
           MK++VF +CHFVFSGLIPLGTN+R ADIVLWT+MFGA TS D+DE TTHVITKTPGTFKA
Sbjct: 481 MKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHVITKTPGTFKA 540

Query: 541 RLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSE 600
           RLAK+YNP+IK++HPDWIFECLVKWVR +EKPYEL  EQ+VS +ELEEF++ L K++ +E
Sbjct: 541 RLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDELEEFQRNLKKRQMAE 600

Query: 601 KALSESIQQEATQ 613
           KA  ES+QQE  +
Sbjct: 601 KAARESLQQETGE 613

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/599 (75%), Positives = 521/599 (86%), Gaps = 2/599 (0%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPK-KKRR 59
           MTT ++LP NLP+P+TIA+LC STGD +KKGQRLF YKYWE QD++T+PN+ + K KK+R
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSPNDTSTKPKKQR 60

Query: 60  VDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEED 119
           VDLIGTFDSPVEG LVS N+ LGDEFVN  +V+AE+ Q C+H+VTYGGLCV+CGK+VEE 
Sbjct: 61  VDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEY 120

Query: 120 DQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHC 179
             N S +  S +KLT++H NTNIK+SERQAA IE+TAQK LR+ KKLVLVVDLDQTVIHC
Sbjct: 121 SSN-SASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHC 179

Query: 180 GVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQ 239
           GVDPTI EW+ DP NPNY+ALK++K+F+L E+PIL           RKC YYVKLRPGL+
Sbjct: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLRPGLK 239

Query: 240 EFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFP 299
           EFF+KIAPHFELHIYTMATRAYALEIAKIIDP G+LFGDRILSRDENGS+THKSLERLFP
Sbjct: 240 EFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLFP 299

Query: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKA 359
           MDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVGVGDINSNFLPRQQNSMLHLGRR+RKKA
Sbjct: 300 MDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKKA 359

Query: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLE 419
           EEEELLTDI+DTEKKLQEKID+EVK+QEEK +K+ EE QPE   SKEDL KKLEH+ASLE
Sbjct: 360 EEEELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNSKEDLAKKLEHSASLE 419

Query: 420 VQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMP 479
           VQQQNRPLAELQKH++NQKLL DDDDELPHLS ILL VH  YY+ L++   PP+IK LMP
Sbjct: 420 VQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPPNIKNLMP 479

Query: 480 QMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFK 539
           Q+K +VF +C FVFSGLIPLGT+VR+ADI LWTSMFGA T+ D+DEATTH+ITKTPGTFK
Sbjct: 480 QLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIITKTPGTFK 539

Query: 540 ARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQ 598
           ARLAK +NP IKV+HPDWIFECLV W RV+EK YEL  EQ VS EEL++FKK+L+ +K+
Sbjct: 540 ARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELDDFKKKLENEKK 598

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/620 (66%), Positives = 507/620 (81%), Gaps = 12/620 (1%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAP---KKK 57
           M+TPIRLP NLP+P+T+A+L VS GD V++GQRLF YKYW+ + I+T+P +E+     K+
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAGGKSKR 60

Query: 58  RRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVE 117
           +R+DL+GTFDSPV G +VSLNI LGDEFVN    +AE+ Q C+H+VTYGGLCV CG+TVE
Sbjct: 61  QRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQTVE 120

Query: 118 EDDQNVSDNGISN-SKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTV 176
             D+  S + + N +KLT++H N NI++SE+QA T+EK+AQK LRE +KLVLVVDLDQTV
Sbjct: 121 --DEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDLDQTV 178

Query: 177 IHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRP 236
           IHCGVDPTI EW+ DP NPNY++LK+V++FSL E+P+L           RKC YYVKLRP
Sbjct: 179 IHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYYVKLRP 238

Query: 237 GLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLER 296
           GLQ+FF  IAPHFELHIYTMATR YALEIAKIIDP G LFGDRILSRDENGSLT KSLER
Sbjct: 239 GLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQKSLER 298

Query: 297 LFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNR 356
           LFPMDQSMVVIIDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLPRQQNSMLHLGRRNR
Sbjct: 299 LFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHLGRRNR 358

Query: 357 KK-AEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHN 415
           KK  ++EELLTDI+DTEKKL+ KI +EVK+QEE+  K++EE  P+   SKED+ KKLEHN
Sbjct: 359 KKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSEEKIPDHTTSKEDIAKKLEHN 418

Query: 416 ASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ----- 470
           ASLEVQQQNRPLAELQKH++N++LL DDDDELPHL++ILL VH  YYD+L +        
Sbjct: 419 ASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEKNKHGATEL 478

Query: 471 PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHV 530
            PDIK L+P +K  VFK C+FVFSGLIPL TN+ +ADIVLWT+ FGA T++++D  TTH+
Sbjct: 479 SPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTINIDYNTTHL 538

Query: 531 ITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590
           ITKTPGT KARLA ++N +IK++HPDWIFEC+V W RV+EKPYEL  E+ VS E LE FK
Sbjct: 539 ITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYELIVEEPVSKEYLENFK 598

Query: 591 KRLDKKKQSEKALSESIQQE 610
           K L++ ++S+ ++  +I  +
Sbjct: 599 KELEETEKSKNSVDANISSQ 618

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/600 (68%), Positives = 495/600 (82%), Gaps = 13/600 (2%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKR-- 58
           M+TPIRLP +LP+P+TIA+L VSTGD+V+KGQRL  YKYW+L D+ITAP EE   K R  
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGKARKQ 60

Query: 59  RVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEE 118
           RVDL+GTFDSPV GT+VSL++ +GDEFVN    + E+ Q C H+VTYGGLCV CG+ VE 
Sbjct: 61  RVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQAVE- 119

Query: 119 DDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIH 178
            D+  + +G+  +KLTV+H NT+I+VSERQAA++ ++AQ  LRE +KLVLVVDLDQTVIH
Sbjct: 120 -DEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTVIH 178

Query: 179 CGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGL 238
           CGVDPTI EW+ DP+NPNY+ALK+V++FSLDE+P+L           RKC YYVKLRPGL
Sbjct: 179 CGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRPGL 238

Query: 239 QEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLF 298
           +EFF KIAPHFELHIYTMATRAYALEIAKIIDP G+LFGDRILSRDENGSLT KSLERLF
Sbjct: 239 KEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLERLF 298

Query: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKK 358
           PMDQSMVV+IDDRGDVW+WCENLIKVVPY+FFVG+GDINSNFLP QQNSMLHLGRRNRKK
Sbjct: 299 PMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNRKK 358

Query: 359 A-EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNAS 417
             +EEELLTDI+DTEKKL+EKI++EVK+QE++ +++ +E  P+      D+ KKLEHNAS
Sbjct: 359 PKQEEELLTDILDTEKKLKEKINEEVKRQEDQMHRLTDEKLPD----TRDIAKKLEHNAS 414

Query: 418 LEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKL----AEQGQPPD 473
           LEVQQQNRPLAELQKHM N++LL DDDDELPHL NILL VH  YYD+L    + +   PD
Sbjct: 415 LEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGEDPIPD 474

Query: 474 IKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITK 533
           IK LMP++K  VF+ C FVFSGLIPL TN+ +ADIVLWT+MFGA+T+ ++D  TTH+IT+
Sbjct: 475 IKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTHLITR 534

Query: 534 TPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRL 593
           TPGT KARLAK++NP IK++HPDWIFECLV W RV E PYEL  E+ V  E LE FK+ L
Sbjct: 535 TPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYELIVEEPVGEEYLENFKRDL 594

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/600 (63%), Positives = 483/600 (80%), Gaps = 15/600 (2%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60
           + T +++ S+LP+P+T+A+L V  GD V+KGQRLF Y+YW+ QD++    E+   KK+RV
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVKYEEKT--KKQRV 60

Query: 61  DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDD 120
           D + TFDSPV GT+   +  + DEF +  + +  + Q C+H++TYGGLCV CG TV+E+D
Sbjct: 61  DRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGNTVDEED 120

Query: 121 QNVSDNGISNSK-LTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHC 179
                    NSK LT++H NTNIKVSE+QA T+E+++   LRE KKLVLVVDLDQTVIHC
Sbjct: 121 ---------NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHC 171

Query: 180 GVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQ 239
           GVDPTI EW  DP NPNY AL++VK+F+L+++PI+           RK  YYVKLRPGL+
Sbjct: 172 GVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLK 231

Query: 240 EFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFP 299
           EFF+ ++PHFE+HIYTMATR+YA EIAKIIDP GELFGDRILSRDENGSLT KSLERLFP
Sbjct: 232 EFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFP 291

Query: 300 MDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKKA 359
           MDQSMVV+IDDRGDVW+W ENLIKVVPY+FFVG+GDINSNFLPRQQNS+LHLGR +R+K 
Sbjct: 292 MDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLGRHHRRKQ 351

Query: 360 EEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPER--PISKEDLTKKLEHNAS 417
           EEE+L++DI+D EKKL+EKID+EVK+QEE  + I ++N  +   P +KED++KKLEH+AS
Sbjct: 352 EEEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSAS 411

Query: 418 LEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ-PPDIKT 476
           LEVQQQNRPLAELQKH++NQ LL DDDDELPHLS ILL VHK Y+++  E  + PPDIK 
Sbjct: 412 LEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKY 471

Query: 477 LMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPG 536
           L+PQMK +VF+ CHFVFSGLIPL T+VR+ADIVLWT MFGATTS D++  TTH+IT T  
Sbjct: 472 LLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSR 531

Query: 537 TFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKK 596
           TFKARLAK++NP+IK++HPDW+FECLV+W RV E PYEL  +  V  ++++EFK++LDKK
Sbjct: 532 TFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLIQDPVDEDKVKEFKEKLDKK 591

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/604 (62%), Positives = 465/604 (76%), Gaps = 12/604 (1%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAP--NEEAPKKKR 58
           MTTP+  P  LP+P+TI +L    G  V+KGQRLF +K+W + +I ++P  NE   +KK 
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGGHRKKT 60

Query: 59  RVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEE 118
             + I  F++P EG L+S N+ +GDE V     I E+++ C+H++ YGGLC +CGK V+E
Sbjct: 61  VRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGKEVDE 120

Query: 119 DDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIH 178
            +Q        N  L ++H + N+KVS ++A  IE   +  LRE KKLVLVVDLDQTVIH
Sbjct: 121 SEQ-------FNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIH 173

Query: 179 CGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGL 238
           CGVDPTI EW  D SNPNY+ALK+V++F+LDE+PIL           RKC YYVK+RPGL
Sbjct: 174 CGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGL 233

Query: 239 QEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLF 298
           +EFFDK+AP FE+HIYTMATRAYALEIAKIIDP G LFGDRILSRDENGS+T KSLERLF
Sbjct: 234 KEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLF 293

Query: 299 PMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRKK 358
           P DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQN+ML LGR  RKK
Sbjct: 294 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKK 353

Query: 359 AEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLTKKLEHNA 416
            +E +EL+TDIMDTEKKLQEKID+EVK+QEEK N ++    +   P SK+ L KKLE++A
Sbjct: 354 TQESDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEEVPAPESKDQLAKKLEYSA 413

Query: 417 SLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ-PPDIK 475
           SLEVQQQNRPLA LQKHM+NQ+LL DDDDEL +L  IL  VH  YY  L +  +   DIK
Sbjct: 414 SLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIK 473

Query: 476 TLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTP 535
           TL+P MKS+VF+ CHFVFSGLIPLGTN+ +ADIVLWT+MFGA +S ++D++TTHVIT+TP
Sbjct: 474 TLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTP 533

Query: 536 GTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDK 595
           GT+KAR+AK +N NIKV+HPDW+FECLV W  V+EKPYEL  EQ  + EEL ++K++L +
Sbjct: 534 GTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLAR 593

Query: 596 KKQS 599
           +  +
Sbjct: 594 RSSA 597

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/621 (59%), Positives = 474/621 (76%), Gaps = 18/621 (2%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEE-----APK 55
           M TP+  P +LP+P+TI +L    G +VKKGQRLF YK+W + +I ++P+E      A  
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 56  KKRRV-DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGK 114
            K+ V + I  F+SP EG LVS  +  GDE  +   VI E+ + C+H+V YGGLC +CGK
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 115 TVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQ 174
            V+E+DQ         + L ++H +TN+KVS ++A  +E   ++ LR+ KKLVLVVDLDQ
Sbjct: 121 EVDENDQ-------MEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQ 173

Query: 175 TVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKL 234
           TVIHCGVDPTI EW  DPSNPNY+ LK+V+ FSL+E+PI+           RKC Y+VK+
Sbjct: 174 TVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKV 233

Query: 235 RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSL 294
           RPGL+EFF ++AP +E+HIYTMATR YALEIAKIIDP G LFGDRILSRDENGSLT KSL
Sbjct: 234 RPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSL 293

Query: 295 ERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRR 354
           ERLFP DQSMV++IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLPRQQ+ +L LGRR
Sbjct: 294 ERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRR 353

Query: 355 NRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLTKKL 412
             KK +E +ELLTDIMDTEK+LQEKID+EVK+QEEK + ++   ++P +  SKE LTKKL
Sbjct: 354 THKKPQESDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGESKEQLTKKL 413

Query: 413 EHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQG--Q 470
           E++ASLEVQQQNRPLA LQKHM+NQ+LL DDDDEL +L + L  +H+ YY KL ++G   
Sbjct: 414 EYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYY-KLLDEGNEN 472

Query: 471 PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHV 530
             DI++L+P MK QVFK C+FVFSGLIPLGTN+R+ADIVLWT MFGA TS ++DE TTHV
Sbjct: 473 SADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHV 532

Query: 531 ITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590
           ITKTPGT+KAR+AK +N N+KV+HPDW+FECLV W  V+EKPYEL  +   + EE+++FK
Sbjct: 533 ITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQDFK 592

Query: 591 KRLDKKKQSEKALSESIQQEA 611
           ++++++   E+   E  + EA
Sbjct: 593 RKIEQRHLIEEQRREQFESEA 613

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/610 (59%), Positives = 466/610 (76%), Gaps = 18/610 (2%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEE-------A 53
           M+T I  P  LP+P+TI +L    GD V+KG RL  YK+W + D+ ++P++        A
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 54  PKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCG 113
            KK  R + I  F+SP +G L+S N+ +GDE  +   V+AE+ + C+H+V YGGLC +CG
Sbjct: 61  GKKSIR-ESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCG 119

Query: 114 KTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLD 173
           + V+EDD + S +G   + LT++H +TN+K+S R+A  I    +  LR+ KKLVLVVDLD
Sbjct: 120 EEVDEDDNDASGSG---ANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLD 176

Query: 174 QTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVK 233
           QTVIHCGVDPTI EW NDP NPN++ LK+VK FSL+E+PIL           RKC YYVK
Sbjct: 177 QTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVK 236

Query: 234 LRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKS 293
           +RPGL+EF +KIAP FE+HIYTMATRAYA EIAKIIDP G+LFGDRILSRDENGS+T KS
Sbjct: 237 VRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKS 296

Query: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGR 353
           LERLFP DQSMV++IDDRGDVW+W  NLIKVVPYNFFVGVGDINSNFLP+QQ +ML LGR
Sbjct: 297 LERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGR 356

Query: 354 RNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPIS----KEDL 408
           R+R+K+++ E+LL DIMD+EKKL+EKIDQEVK+QEE+ +  +   + E P S    KE++
Sbjct: 357 RSREKSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTE-EPPTSAGENKEEI 415

Query: 409 TKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQ 468
           +KK+E++ASLEVQQQNRPLA LQKH ++Q+LL DDDDEL HL + L+ +H  YY+ L + 
Sbjct: 416 SKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKD 475

Query: 469 GQ-PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEAT 527
           G+   DIK +MP MK  V   C FVFSGLIPLGT++++ADIV+WT+ FGA ++ D+DE T
Sbjct: 476 GELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKT 535

Query: 528 THVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELE 587
           THVITKTPGT+KARLAK++NP IK++HPDW+FECL  W  V+EKPYEL  EQ VS  ELE
Sbjct: 536 THVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELE 595

Query: 588 EFKKRLDKKK 597
           EFKK+L K++
Sbjct: 596 EFKKKLAKRQ 605

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/615 (58%), Positives = 467/615 (75%), Gaps = 19/615 (3%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPK----- 55
           MTTP+  P  LP+P+TI +L    G  ++KG RLF YK+W + +I ++P++  P      
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 56  ----KKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVV 111
               KK+  + I  FD+P EGTL+S NI +GDE  + + VI E+ + C+H++ YGGLC  
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 112 CGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVD 171
           CGK V+E +Q  S  G   S  TV+H +TN+K+S ++A  I +  +K LR  KKLVLVVD
Sbjct: 121 CGKEVDESEQ--SQFG---SNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175

Query: 172 LDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYY 231
           LDQTVIHCGVDPTI EW +DP+NPNYD LK+V+ F+L+E+P+L           RKC YY
Sbjct: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYY 235

Query: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291
           VK+RPGL+EFF K+AP FE+HIYTMATRAYALEI KIIDP GELFG+RILSRDENGSLT 
Sbjct: 236 VKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTS 295

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351
           KSLERLFP DQSMV+IIDDRGDVW+W  NLIKVVPY+FFVGVGDINSNFLP+QQ +ML L
Sbjct: 296 KSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQL 355

Query: 352 GRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEENQPERPISKEDLT 409
           GRR+R+KA+E +ELLTDIMDTEKKLQEKID+EVK+QE+  + ++    +     +KE+ T
Sbjct: 356 GRRSREKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNETKEEWT 415

Query: 410 KKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQG 469
           KKLEH+AS+EVQQQNRPLA LQ+H++NQ+LL DDDDEL  L + L  VH  YY  L  + 
Sbjct: 416 KKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKS 475

Query: 470 ---QPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEA 526
                 DIK +MP++K  VF+ CHFVFSGLIPL T++R+ADIV+WTSMFGA +S +++E 
Sbjct: 476 LDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEV 535

Query: 527 TTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEEL 586
           TTHVITKTPGTFKARLAK++N +IK++HPDW+FECL++W  V+EKPY L  E+ +S  EL
Sbjct: 536 TTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDREL 595

Query: 587 EEFKKRLDKKKQSEK 601
           ++F++ L+ +K +E+
Sbjct: 596 KKFREDLNNRKLTER 610

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/601 (60%), Positives = 453/601 (75%), Gaps = 24/601 (3%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE-----EAP- 54
           M+TP+  P  LP+P+T+ +L V  G  V+KGQRLF YK+W + +I  +P++     E P 
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 55  --KKKRRV-DLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVV 111
             K KR+V + I  +++P EG L+S N+   DE       + E+ + C+H++ YGGLC +
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 112 CGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVD 171
           CGK V+E DQ        ++ LT++H +TN++VS ++A  ++K     L+  KKLVLVVD
Sbjct: 121 CGKEVDEYDQ-------VDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173

Query: 172 LDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYY 231
           LDQTVIHCGVDPTI EW  DPSNPNY+ LK+VK FSL+E+PIL           R C YY
Sbjct: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYY 233

Query: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291
           VK+RPGL+EFF+KIAP +E+HIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLT 
Sbjct: 234 VKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQ 293

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351
           KSL RLFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML L
Sbjct: 294 KSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQL 353

Query: 352 GRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KINEENQPERPISKED 407
           GRR R+K +E EELLTDIMDTEKKLQEKID+EVK+QEEK N      EE+  +   SKE 
Sbjct: 354 GRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATAEESTDQE--SKEK 411

Query: 408 LTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKL-- 465
           + KKLE +ASLEVQQQNRPLA+LQKH+++Q+LL DDDDEL +L + L  +HK +Y  L  
Sbjct: 412 IAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLED 471

Query: 466 AEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDE 525
           A      DI  L+P++K +VFK CHFVFSGLIPLGT++++ADIV+WTS+FGA ++ D+DE
Sbjct: 472 ASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDE 531

Query: 526 ATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEE 585
            TTHV+TKTPGT+KARLAK +NP+IKV+HPDWIFECL  W R++EKPY L  EQ VS +E
Sbjct: 532 HTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYLLIVEQPVSEDE 591

Query: 586 L 586
           L
Sbjct: 592 L 592

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/605 (59%), Positives = 456/605 (75%), Gaps = 23/605 (3%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAP-------NEEA 53
           M+TP+  P  LP+P+TI+KL  S G  V+KGQRLF YK+W + +I  +P       N+E 
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 54  PKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCG 113
            KK  R + I  FDSP EG LVS N+ +GDE V     I E+ + C+H++ Y G+C +CG
Sbjct: 61  SKKSIR-ESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCG 119

Query: 114 KTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLD 173
           K V+E DQ VS N      LT++H +TN+KVS R+A  I +  +K L   KKL+LVVDLD
Sbjct: 120 KEVDESDQ-VSAN------LTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLD 172

Query: 174 QTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVK 233
           QTVIHCGVDPTI EW NDP+NPN++ L++VK+F L+E+PIL            KC YYVK
Sbjct: 173 QTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVK 232

Query: 234 LRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKS 293
           +RPGL+EFF++++  +E+HIYTMATR+YA EIAKIIDP G LF DRILSR+ENGSLTHKS
Sbjct: 233 IRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKS 292

Query: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGR 353
           LERLFP DQSMVV+IDDRGDVW+WC NLIKV PYNFFVG+GDINSNFLPRQQ +ML LGR
Sbjct: 293 LERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGR 352

Query: 354 RNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN----KINEENQPERPISKEDL 408
           RN KK E+ +ELLTDIMDTEKKLQEKID+EVK+QEE  +     + EE   +  + KED+
Sbjct: 353 RNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQ--VRKEDI 410

Query: 409 TKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQ 468
           TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LLTDDDDEL +L +IL NV + YY++L + 
Sbjct: 411 TKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KT 469

Query: 469 GQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATT 528
            +   I+TLMP++K +V + C+FVFSGLIPLGTN+++ADIVLWT+MFGA +S D+ E TT
Sbjct: 470 DKEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTT 529

Query: 529 HVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEE 588
           HVITKTP T+KA++AK +  +IKV+HPDW+FECL+ W  + E PYE       + +EL E
Sbjct: 530 HVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNE 589

Query: 589 FKKRL 593
           FK+ L
Sbjct: 590 FKEAL 594

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/620 (58%), Positives = 453/620 (73%), Gaps = 30/620 (4%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE--------- 51
           M TP++ P  +P+P+TI+KL    G  + KG RLF YK+W L +I  +P+E         
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 52  -EAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCV 110
            E  KK  R + I  FD+P EGT++  N+ +GDE V    ++ EV + C H++ Y G+C 
Sbjct: 61  GEQSKKTIR-ESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICT 119

Query: 111 VCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVV 170
           +CGK V+E DQ VS N      LT++H +TN+KVS ++A  I +T +  L   KKL+LVV
Sbjct: 120 MCGKEVDERDQ-VSAN------LTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVV 172

Query: 171 DLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQY 230
           DLDQTVIHCGVDPTI EW NDPSNPNY+ L+NVK+F L+E+ IL            KC Y
Sbjct: 173 DLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSY 232

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLT 290
           YVK+RPGL+EFF+K+AP +E+HIYTMATRAYA EIAKIIDP G LFG+RILSRDENGSLT
Sbjct: 233 YVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLT 292

Query: 291 HKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLH 350
           HKSLERLFP DQSMVVIIDDRGDVW+W  NLIKV PYNFFVG+GDINSNFLPRQQ +ML 
Sbjct: 293 HKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQ 352

Query: 351 LGRRNRKK---AEEEELLTDIMDTEKKLQEKIDQEVKKQE----EKFNKINEENQPERPI 403
           +GRRN       E EELLTDI+DTEKKLQEKID+EVK+QE     K   + EE   +  +
Sbjct: 353 MGRRNHNAEKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQ--V 410

Query: 404 SKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYD 463
              D+TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L  IL  V   +Y 
Sbjct: 411 RNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYK 470

Query: 464 KL-AEQGQPPD--IKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTS 520
            L  + G   D  I+ LMP++K  VFK C+FVFSGLIPLGT++++ADIVLWT MFGA+++
Sbjct: 471 ALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASST 530

Query: 521 VDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQD 580
            ++ E TTHVITKTPGT KAR+AK++NP+IKV+HPDW+FECL  W  V+EK +EL  +Q 
Sbjct: 531 SNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQV 590

Query: 581 VSPEELEEFKKRLDKKKQSE 600
            S  ELEEFKK L+K+ +++
Sbjct: 591 ASERELEEFKKNLEKRNKNK 610

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/634 (55%), Positives = 451/634 (71%), Gaps = 61/634 (9%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNEEAPKKKRRV 60
           M+TP+  P++LPFP+TI +L    G  V+KGQRLF YK+W + +I  +P+   P  +   
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 61  DLIGT------------------------FDSPVEGTLVSLNIGLGDEFVNDANVIAEVN 96
           DL G                         F+SP EG L+  N+  GDE +++  ++ ++ 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 97  QLCSHEVTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTA 156
           + C+H++ Y G+C  CGK V++ D       I ++ L+++H +TN+K+S ++A  I++++
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSD-------IMDASLSISHTDTNLKISRKEARDIDQSS 173

Query: 157 QKHLREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXX 216
              L++ KKL+LVVDLDQTVIHCGVDPTI EW NDP NPNY+ LK+V++FSLDE+PIL  
Sbjct: 174 MSRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPP 233

Query: 217 XXXXXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELF 276
                    RKC YYVK+RPGL+EFF KIAP +E+HIYTMATRAYALEIAKIIDP G LF
Sbjct: 234 SYMGPRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLF 293

Query: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336
           G RILSRDENGSLT KSLERLFP DQSMV+IIDDRGDVW+WC NLIKV+PYNFFVG+GDI
Sbjct: 294 GSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDI 353

Query: 337 NSNFLPRQQNSMLHLGRRNRKKA-----------------------EEEELLTDIMDTEK 373
           NSNFLPRQQ++ML LG R+ KK                        + EELLTDIMDTEK
Sbjct: 354 NSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEK 413

Query: 374 KLQEKIDQEVKKQEEKFNKINEENQPERPISKE----DLTKKLEHNASLEVQQQNRPLAE 429
           KLQ+KID+EV++QE+K   I +E    + IS E    +L+KK+E +ASLEVQQQNRPLA 
Sbjct: 414 KLQKKIDEEVRRQEKKL--IKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLAT 471

Query: 430 LQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAE-QGQPPDIKTLMPQMKSQVFKR 488
           LQ+H  NQ+LL DDDDEL +L +IL  VH T+Y++L E + +   I+TLMP++K  VF  
Sbjct: 472 LQRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSG 531

Query: 489 CHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNP 548
            +FVFSGLIPLGT++R+ADIVLWT+MFGA ++ D+DE TTHVITKT GT+KARLAK +NP
Sbjct: 532 YNFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNP 591

Query: 549 NIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVS 582
            IKV+HPDWIFECLV W R+ EKPYEL  EQ  S
Sbjct: 592 EIKVVHPDWIFECLVSWKRMPEKPYELIIEQPAS 625

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/624 (56%), Positives = 453/624 (72%), Gaps = 34/624 (5%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIIT------------- 47
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 48  ----APNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEV 103
                 N  +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 104 TYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREH 163
            YGGLC  CGK V  D             L V   + ++++SE +A    K  ++HLR  
Sbjct: 121 VYGGLCTQCGKEVSAD-------AFDGVPLDVV-GDVDLQISETEAIRTGKALKEHLRRD 172

Query: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXX 223
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +L         
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232

Query: 224 XX------RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFG 277
                   RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP GELFG
Sbjct: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292

Query: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 338 SNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINE 395
           SNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++  
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455
             +P    SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 456 NVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSM 514
           N+HKTYYD L++Q +P P++  ++P +K +VF+ C+FVFSGLIPLGT+++++DIV+WTS 
Sbjct: 473 NIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 515 FGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYE 574
           FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK++HPDWIFECLV W +V+EKPY 
Sbjct: 533 FGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 575 LTTEQDVSPEELEEFKKRLDKKKQ 598
           L  +  +S EEL+ F+ +L K+++
Sbjct: 593 LIVDSPISDEELQNFQTQLQKRQE 616

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/637 (55%), Positives = 458/637 (71%), Gaps = 38/637 (5%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWEL----QDIITAPNEE---- 52
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L     D     + E    
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 53  ----------APKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHE 102
                     +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H+
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 103 VTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLRE 162
           + YGGLC  CGK V  D             L V   + ++++SE +A    +  ++HLR 
Sbjct: 121 IVYGGLCTQCGKEVSAD-------AFDGVPLDVV-GDMDLQISETEAIRSGEALKEHLRR 172

Query: 163 HKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXX 222
            KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +L        
Sbjct: 173 DKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNED 232

Query: 223 XXX------RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELF 276
                    RKC YYVK+RPGL+EFFDK+AP FE+HIYTMATRAYA++IAKI+DP GELF
Sbjct: 233 GSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELF 292

Query: 277 GDRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDI 336
           GDRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDI
Sbjct: 293 GDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDI 352

Query: 337 NSNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KIN 394
           NSNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++ 
Sbjct: 353 NSNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLA 412

Query: 395 EENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNIL 454
              +P    SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL DDDDEL +L   L
Sbjct: 413 TAEEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 472

Query: 455 LNVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTS 513
            N+H TYY  +++  +P P++  ++P +K +VF+ CHFVFSGLIPLGT+++++DIV+WTS
Sbjct: 473 SNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTS 532

Query: 514 MFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPY 573
            FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK+IHPDWIFECLV W +V+EKPY
Sbjct: 533 TFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPY 592

Query: 574 ELTTEQDVSPEELEEFKKRLDKKKQSEKALSESIQQE 610
            L  +  +S EEL+ F+K+L K+++    L E+ QQ+
Sbjct: 593 TLIVDSPISDEELQNFQKQLQKRQE---YLEENQQQQ 626

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/623 (55%), Positives = 454/623 (72%), Gaps = 33/623 (5%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQD---------------- 44
           MTT IR P  LP+P+ I KL  S G  +++G RL VYK+W L +                
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 45  IITAPNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVT 104
                   +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++ 
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 105 YGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHK 164
           YGGLC  CGK        VS +      L V   + ++++SE +A    +  ++HLR  K
Sbjct: 121 YGGLCTQCGK-------EVSADAFDGVPLDVV-GDMDLQISETEAIRTGRALKEHLRRDK 172

Query: 165 KLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXX 224
           KL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +L          
Sbjct: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232

Query: 225 X------RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGD 278
                  RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP GELFGD
Sbjct: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292

Query: 279 RILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINS 338
           RILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDINS
Sbjct: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352

Query: 339 NFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINEE 396
           NFLP+Q   ML LGR+ R+K++E +EL+TDIMD EKKLQEKID EVK+QEE+ N ++   
Sbjct: 353 NFLPKQSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLATA 412

Query: 397 NQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLN 456
            +P    SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL DDDDEL +L + LLN
Sbjct: 413 EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLN 472

Query: 457 VHKTYYDKLAEQGQ-PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMF 515
           +HKTYY  L++ G+  P++  ++P +K +VF+ C+FVFSGLIPLGT+++++DIV+WTS F
Sbjct: 473 IHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTF 532

Query: 516 GATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYEL 575
           GAT++ D++  TTH+ITK PGT+KARLAK +NP IKV+HPDWIFECLV W +V+EKPY L
Sbjct: 533 GATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTL 592

Query: 576 TTEQDVSPEELEEFKKRLDKKKQ 598
             +  +S +EL+ F+K+L KK++
Sbjct: 593 IVDSPISDDELQSFQKQLQKKQE 615

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/624 (55%), Positives = 450/624 (72%), Gaps = 34/624 (5%)

Query: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIIT------------- 47
           MTT IR P  LP+P+ I KL  S G  + +G RL VYK+W L +  +             
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASP 60

Query: 48  ----APNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEV 103
                 N  +P  K+  + I  F+SP EG L+S N+ +GDE      VI E+ + C+H++
Sbjct: 61  GGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 104 TYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREH 163
            YGGLC  CGK V  D             L V   + ++++SE +A    K  ++HLR  
Sbjct: 121 VYGGLCTQCGKEVSAD-------AFDGVPLDVV-GDMDLQISETEAIRTGKALKEHLRRD 172

Query: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXX 223
           KKL+LVVDLDQT+IHCGVDPTI EW NDP+NPN++ L++VK+F+LDE+ +L         
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232

Query: 224 XX------RKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFG 277
                   RKC YYVK+RPGL+EFF K+AP FE+HIYTMATRAYAL+IAKI+DP G+LFG
Sbjct: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292

Query: 278 DRILSRDENGSLTHKSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDIN 337
           DRILSRDENGSLT KSL +LFP DQSMVV+IDDRGDVW+WC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 338 SNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN-KINE 395
           SNFLP+Q   ML LGR+ R+K++E +ELLTDIMD EKKLQEKID+EVK+QEEK N ++  
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455
             +P    SKE+LTKKLE++ASLEVQQQNRPLA+LQKH+++QKLL DDDDEL +L   L 
Sbjct: 413 AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLS 472

Query: 456 NVHKTYYDKLAEQGQP-PDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSM 514
           N+H TYY  L+++ +P P++  ++P +K +VF+ C FVFSGLIPLGT+++++DIV+WTS 
Sbjct: 473 NIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTST 532

Query: 515 FGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYE 574
           FGAT++ D+D  TTH+ITK P T+KARLAK +NP IK++HPDWIFECLV W +V+EKPY 
Sbjct: 533 FGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPYT 592

Query: 575 LTTEQDVSPEELEEFKKRLDKKKQ 598
           L  +  +S EEL+ F+ +L K+++
Sbjct: 593 LIVDSPISDEELQNFQSQLQKRQE 616

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/623 (56%), Positives = 454/623 (72%), Gaps = 29/623 (4%)

Query: 3   TPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYW---ELQDIITAPNEEA-----P 54
           TP+   + LP+PVT+ +L    GD V +G RLF YK+W   EL  +  A   ++      
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 55  KKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGK 114
            KK   + +  F+SP EGT+VS ++  GDE       +  + + C+H+V Y GLC +CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 115 TVEEDD--QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDL 172
            V+E +     + +G     LTV+H +TN+++S  +A  ++   Q+ LR  +KLVLVVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 173 DQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXX-RKCQYY 231
           DQTV+HCGVDPTI EW  DP NPNY+AL++V++F+L+E+PIL            RKC YY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291
           VK+RPGL++FF ++AP FE+HIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLTH
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351
           KSLERLFP DQSMV +IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 352 GRRNR------------KKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKIN----E 395
           GRR++               +++ LLTDIM+TEK+LQEKIDQEVK+QE K NK N    E
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455
           +  P +  SKE+ TKKLE +AS+EVQQ+NRPLA LQKH++NQKLL D+DDEL +L + L 
Sbjct: 427 QQTPGQ--SKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLA 484

Query: 456 NVHKTYYDKLAEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMF 515
           ++HK YY  L E  Q  +I+++M Q+K++VF+ CHFVFSGLIPL TNV+ ADIV+WT+ F
Sbjct: 485 DLHKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKF 544

Query: 516 GATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYEL 575
           GATT+ D+DE TTH+ITKTPGT KARLAK +NP+IK++HPDWIFECL+KW RV+ KPY L
Sbjct: 545 GATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLL 604

Query: 576 TTEQDVSPEELEEFKKRLDKKKQ 598
             E  VS  ++ EFK++L ++K+
Sbjct: 605 IVEDPVSEAQVREFKEKLTRQKE 627

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/550 (59%), Positives = 421/550 (76%), Gaps = 18/550 (3%)

Query: 63  IGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGKTVEEDDQN 122
           I  FD P +G L S  +  GD+ V     + E+ + C+H+V YGGLC +CGK V+E+D  
Sbjct: 113 IEFFDCPYDGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDEND-- 170

Query: 123 VSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLDQTVIHCGVD 182
           + D  +S   LT++H +TN+K+S R+A  I ++ +K LR+ KKL+LVVDLDQTVIHCGVD
Sbjct: 171 IDD--LSGPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVD 228

Query: 183 PTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQEFF 242
           PTI EW  DP+NPN++ LK+VK F+L+E+PIL           RKC YYVK+RPGL++FF
Sbjct: 229 PTIGEWKRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFF 288

Query: 243 DKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKSLERLFPMDQ 302
            K+AP FE+HIYTMATRAYA EIAKIIDP G+LFG+RILSRDENGSLT KSLERLFP DQ
Sbjct: 289 QKVAPLFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQ 348

Query: 303 SMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGRRNRK----- 357
           SMV+IIDDRGDVW+W  NLIKV+PYNFFVGVGDINSNFLP+QQ +ML LGRR+ +     
Sbjct: 349 SMVIIIDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKV 408

Query: 358 -KAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN---KINEENQPERPISKEDLTKKLE 413
              E ++LLTDIMDTEK LQ KI++EVK+QEEK N      EE       +KE+++KK+E
Sbjct: 409 STKENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIE 468

Query: 414 HNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQ--- 470
           ++ASLEVQQ+NRPLA LQKH ++Q+LL DDD+EL HL + L  +H  YY+ L +  +   
Sbjct: 469 YSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKD 528

Query: 471 --PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATT 528
              PDIK +MPQMK  V + CHFVFSGLIPLGTN++++DIV+WT+MFGA ++ D+DE TT
Sbjct: 529 SIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTT 588

Query: 529 HVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEE 588
           HVITKTPGT+KARLAK+Y+P+IK++HPDW+FECL++W  V EKPYEL  EQ VS +EL +
Sbjct: 589 HVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELAD 648

Query: 589 FKKRLDKKKQ 598
           F ++L+++ Q
Sbjct: 649 FNRKLERRIQ 658

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 1  MTTP--IRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAPNE 51
          M TP  IR P  LP+P+TI +L    G  + K  RL  YK+W + +I T+P+E
Sbjct: 1  MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDE 53

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 29/120 (24%)

Query: 162 EHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXX 221
           +HKK  LV+DLD+T++H       +   N P N + D + NV                  
Sbjct: 341 KHKK-CLVLDLDETLVHSSFKYLPNADFNLPVNID-DQIHNV------------------ 380

Query: 222 XXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRIL 281
                    YV  RPG+ EF +K+   FE+ I+T +   Y   +   +DPKG+    R+ 
Sbjct: 381 ---------YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 54/120 (45%), Gaps = 13/120 (10%)

Query: 471 PPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHV 530
           PP+   L    K ++FK    + +     G   +++ I   T M G  ++ ++ +  TH+
Sbjct: 342 PPNTNLLFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHL 399

Query: 531 ITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590
           +++ P   K   AK +    +VI+  W+           E+ Y+   +QD +  E ++FK
Sbjct: 400 VSRMPVGKKFFQAKKWKDRCQVINHLWL-----------ERTYKTGIKQDPNSSEFQDFK 448

 Score = 35.0 bits (79), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 49/100 (49%), Gaps = 7/100 (7%)

Query: 490 HFVFSGLIPLGT-NVRQADIVLWTSM---FGATTSVDVDEATTHVITKT---PGTFKARL 542
           HF  +  I + T +++ ++ + ++ +    G T +  ++  TTH+I      P     + 
Sbjct: 131 HFFRNFQICISTYSMKFSEYIFYSELINSLGGTITHVINNKTTHLIAIAIDDPAIIAIKE 190

Query: 543 AKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVS 582
               N  IK ++P W+ +C  +   ++E P+ +T +Q+ S
Sbjct: 191 KGQNNTIIKSVYPTWLVQCFKERKYIDESPHLITEDQNNS 230

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKG----ELFGDRILSRDEN 286
           YV  RPG+ EF +++   +E+ ++T +   Y   +  I+DP+G     LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 45/103 (43%), Gaps = 22/103 (21%)

Query: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXX 219
           L   KK  LV+DLD+T+IH     T H      SN +   L  VK F +   P L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGISGIPTL----- 293

Query: 220 XXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K++  ++L I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDFFLTKVSRWYDLIIFTASMKEYA 326

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRIL 281
           YV  RPG++EF  ++   FE+ ++T +   Y   +  I+DP  +L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 39.7 bits (91), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 4/76 (5%)

Query: 515 FGATTSVDVDEATTHVITKTPG--TFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKP 572
            G + S  +   TTH+I+  P      A +A   +  IK ++P W+ +C ++   V+EK 
Sbjct: 150 LGGSVSDMISNKTTHLISSDPTDPALIAIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKN 209

Query: 573 YELTTEQDVSPEELEE 588
           + L  +  +SPE+ EE
Sbjct: 210 FIL--DSSLSPEDAEE 223

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 58/147 (39%), Gaps = 35/147 (23%)

Query: 142 IKVSERQAATIEKTAQKHL-------REHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSN 194
           I +S+ QA  +  T  + L       R  +K  L++DLD+T++H                
Sbjct: 293 IDLSKLQANQVSATGYETLLAPKEIKRFGRKKCLILDLDETLVHSSFKYV---------- 342

Query: 195 PNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIY 254
              D+   V   ++D                +    YV  RPG+ EF  +++  +E+ ++
Sbjct: 343 ---DSADFVIPVTIDN---------------QTHHVYVIKRPGVDEFLKRVSELYEVVVF 384

Query: 255 TMATRAYALEIAKIIDPKGELFGDRIL 281
           T +   Y   +  I+DP   +   R+ 
Sbjct: 385 TASVSRYGDPLLNILDPANTIIHHRLF 411

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXX 219
           L   KK  LV+DLD+T+IH     T H      SN +   L  VK F +     L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGISGIRTL----- 293

Query: 220 XXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K++  +EL I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDLFLTKVSKWYELIIFTASMKEYA 326

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXX 219
           L   KK  LV+DLD+T+IH     T H      SN +   L  VK F L     L     
Sbjct: 246 LNTQKKKKLVIDLDETLIHSASRSTTH------SNSSQGHLVEVK-FGLSGIRTL----- 293

Query: 220 XXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K++  ++L I+T + + YA
Sbjct: 294 ----------YFIHKRPYCDLFLTKVSKWYDLIIFTASMKEYA 326

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGEL 275
           YV  RPG+ EF ++++  +E+ ++T +   YA  +   +DP G +
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGEL 275
           YV  RPG+ EF  ++   +E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 515 FGATTSVDVDEATTHVITKTPG--TFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNE 570
            G TT   +   TTH+IT  P      A +A     NI  ++P W+ +C      VNE
Sbjct: 147 LGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTWLCQCFKSMTLVNE 204

>TBLA0A08950 Chr1 complement(2200024..2202483) [2460 bp, 819 aa]
           {ON} Anc_4.90 YGL027C
          Length = 819

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 101/249 (40%), Gaps = 32/249 (12%)

Query: 238 LQEFFDKIAPHFELHIYTMATRAYALE-IAKIIDPKGELFGDRILSR-----DEN---GS 288
           L E   +   HF+L       R +AL+ ++ ++   G   G +I+ R     DE     +
Sbjct: 323 LNEIQARFNRHFDLKGQDEEHRVFALQTLSNLLGGIGYFHGTQIVDRVTEFNDETFEPTT 382

Query: 289 LTHKSLERLFPMDQSM-VVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNS 347
            +H   E    +  S+       RG  W     L++++ Y+F +    I S F   + +S
Sbjct: 383 FSHAKEESPLSLFTSVPSRGFFPRGFYWDEGFQLLQIMEYDFDLAFEIITSWFDLIEDDS 442

Query: 348 M-----LHLGRRNRKKAEEEELL---------TDIMDTEKKLQEKIDQEVKKQEEKFNKI 393
                 + LG   R +  EE  +         T +M   + L   ID +       FN+ 
Sbjct: 443 GWVAREVILGAEARSRVPEEFTVQSPNVANPPTLLMTFSEMLSRAIDYQ---NSVNFNQD 499

Query: 394 NEENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHM----NNQKLLTDDDDELPH 449
            E N  +    +ED T +LE N+ L V+   R   +L KH      +QK LT+D  E+  
Sbjct: 500 KESNDNQEKTLRED-TNQLEQNSKLLVKYAKRIYPKLLKHYEWFTTSQKGLTEDYVEVFE 558

Query: 450 LSNILLNVH 458
              IL  VH
Sbjct: 559 EEGILSKVH 567

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGEL 275
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP G +
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXX 219
           L   KK  LV+DLD+T+IH     T H      SN +   L  VK F +     L     
Sbjct: 251 LNTQKKKKLVIDLDETLIHSASRGTTH------SNSSQGHLVEVK-FGISGISTL----- 298

Query: 220 XXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                     Y++  RP    F  K +  ++L I+T + + YA
Sbjct: 299 ----------YFIHKRPYCDLFLTKASKWYDLIIFTASMKEYA 331

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG+ EF  K+   FE+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 22/99 (22%)

Query: 164 KKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXX 223
           +K  LVVDLD+T+IH     T H       N +   L  VK FS++    L         
Sbjct: 242 RKKTLVVDLDETLIHSVSRGTTH------VNSSQGHLVEVK-FSINGISTL--------- 285

Query: 224 XXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                 YYV  RP    F  K++  + + I+T + + YA
Sbjct: 286 ------YYVHKRPFCDLFLSKVSKWYNIVIFTASMKEYA 318

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 506 ADIVLWTSM---FGATTSVDVDEATTHVITKTP--GTFKARLAKTYNPNIKVIHPDWIFE 560
           ++ +L+T +    G T   +++  TTH+IT  P    F+  L +    +IK I+P W+  
Sbjct: 140 SEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEI-LKRNGTTSIKYIYPTWLIH 198

Query: 561 CLVKWVRVNEKPYEL 575
           C+ +   ++E  +E+
Sbjct: 199 CVKESQLIDESEHEI 213

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 22/95 (23%)

Query: 168 LVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRK 227
           LV+DLD+T+IH     T H      SN +   +  VK FS+     L             
Sbjct: 228 LVLDLDETLIHSMSRGTTH------SNSSQGHIVEVK-FSVSGVSTL------------- 267

Query: 228 CQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
             YYV  RP    F  K++  ++L I+T + + YA
Sbjct: 268 --YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA 300

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF +++   FE+ ++T +   Y   +  I+D
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 334

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF +++   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 44/103 (42%), Gaps = 22/103 (21%)

Query: 160 LREHKKLVLVVDLDQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXX 219
           L   KK  LV+DLD+T+IH     T H       N +   +  VK FS+     L     
Sbjct: 244 LNREKKKTLVMDLDETLIHSVSRGTTH------PNSSQGHIVEVK-FSISGVSTL----- 291

Query: 220 XXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYA 262
                     YYV  RP    F  K++  +++ I+T + + YA
Sbjct: 292 ----------YYVFKRPYCDLFLTKVSKWYDIVIFTASMKEYA 324

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF +++   FE+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           YV  RPG++EF +++   FE+ ++T +   Y   +  I+D
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 321

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 61/139 (43%), Gaps = 26/139 (18%)

Query: 127 GISNSKLTVAHNNTNIKVSERQAATI--EKTAQKHLRE-HKKLVLVVDLDQTVIHCGVDP 183
            +S S  T+  NNT+   S+R    +  +K   K + +  ++  LV+DLD+T+IH     
Sbjct: 212 SLSRSMKTMVSNNTSFS-SKRMGKFLFPKKLIPKSITQTERRKKLVLDLDETLIHSISRG 270

Query: 184 TIHEWANDPSNPNYDALKNVKTFSLDEDPILXXXXXXXXXXXRKCQYYVKLRPGLQEFFD 243
           T H      +N +   +  VK FS     +L               YYV  RP    F  
Sbjct: 271 TTH------TNVSQGHIVEVK-FSSSGVSML---------------YYVHKRPYCDFFLS 308

Query: 244 KIAPHFELHIYTMATRAYA 262
           K+   ++L I+T + + YA
Sbjct: 309 KVCKWYDLIIFTASMKEYA 327

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 6/87 (6%)

Query: 527 TTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEEL 586
           TTH I     +    L K  N NI V+ P+W+  C ++   V  + + L    D  P  L
Sbjct: 211 TTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRACELERRIVGVRGFYL----DADPTNL 266

Query: 587 EE--FKKRLDKKKQSEKALSESIQQEA 611
           E   F K + +  Q E  ++E   Q+A
Sbjct: 267 ESYRFSKGVTEVPQQEGGVTEEELQQA 293

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 7/109 (6%)

Query: 362 EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKEDLTKKLEHNASLEVQ 421
           E+ L  +   E++LQ  ID+E +  +++FN +N+E Q E PI+   +++ +++  + E  
Sbjct: 633 EKELARMNKEEEQLQNDIDEEARLLKDEFNFVNDETQ-ENPINSRSVSEPVKNGGTDEKG 691

Query: 422 QQN-----RPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKL 465
           Q+N     RP++ L   +   K L D D+      N+ +N  KT  + +
Sbjct: 692 QRNFSLQTRPISRLDPGLMFSK-LGDVDNNSSVDENLTMNNQKTILETI 739

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDP 271
           YV  RPG+ EF   +   +E+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 229 QYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIID 270
           Q YV  RPG+ EF  ++   FE+ ++T +   Y   +  I+D
Sbjct: 343 QVYVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILD 384

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 70/175 (40%), Gaps = 27/175 (15%)

Query: 433 HMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQGQPPDIKTLMPQMKSQVFKRCHFV 492
           + +++KL  D  DE  HL N   N++    D + E G PP           Q+FK C   
Sbjct: 141 YFHDKKLRQDQQDE--HLRNQYRNLYLNGTDHINE-GLPP-----------QIFKDCIIY 186

Query: 493 FSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKV 552
            +G    G       IVL    F     +   +  TH+I       K    + Y    KV
Sbjct: 187 INGYTIPGRLQLHESIVLHGGKF--IHHLSAKKKITHIIASNLTLKKKLEFEKY----KV 240

Query: 553 IHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKRLDKKKQSEKALSESI 607
           + PDWI + +     +  + + L T        L+E +KRLD     ++ ++ S+
Sbjct: 241 VKPDWIVKSIESKKLLPWQDFALLT-------HLDEQQKRLDFLPTEKQTIASSL 288

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDP 271
           YV  RPG+ EF  +++  +E+ ++T +   YA  +   +DP
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDP 293

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 8/117 (6%)

Query: 475 KTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATTHVI-TK 533
           K L+      +FK C    +G    G       IVL    F     +   +  TH++ + 
Sbjct: 156 KGLISSQNGNLFKNCVIYINGYTKPGRLQLHEMIVLHGGKF--LHHLSAKKRVTHIVASN 213

Query: 534 TPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFK 590
            P   +   A     N KV++PDWI +C+ +   +  + Y LT + D   ++L+  K
Sbjct: 214 LPLKKRIEFA-----NYKVVNPDWITDCIKERRLLPWQNYSLTAKLDEQQKKLDNCK 265

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 19/163 (11%)

Query: 235 RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDP-----KGELFGDRILSRDENGSL 289
           RPG   F   ++ +FE+ +++     Y+ +IA+ +DP        LF +  + +D    +
Sbjct: 223 RPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 279

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYNFFVGVGDINSNFLPRQQNSM 348
             K L +L   D S V+IID   + +    EN I + P+N   G  D   + L R    +
Sbjct: 280 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEAD---DKLVRLIPFL 332

Query: 349 LHLGRRNRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFN 391
            +L  +  K       + D    +K L  + D  VKK ++KF+
Sbjct: 333 EYLATQQTKDVRP---ILDSFQDKKNLATEFDHRVKKLKDKFH 372

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 11/115 (9%)

Query: 482 KSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATT---HVITKTPGTF 538
           K+   K C+   S           A+  L+TSM        +D  +T   H+IT  P   
Sbjct: 115 KTHFMKDCYVYVSS-----QQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 539 KARLAKTYNP-NIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEELEEFKKR 592
              + K +N   +  +   W+ EC V+   V+E  Y + +E  +S EE+    ++
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAYLVGSE--MSNEEVTALAEK 222

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 527 TTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYELTTEQDVSPEEL 586
           TTH +     +    LA+  N NI V+ P+WI  C ++   V  + + L    DV    L
Sbjct: 211 TTHFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYL----DVDSSTL 266

Query: 587 EEFK 590
           E ++
Sbjct: 267 ESYR 270

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 19/162 (11%)

Query: 235 RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDP-----KGELFGDRILSRDENGSL 289
           RPG   F   ++ ++E+ +++     Y+ +IA+ +DP        LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYNFFVGVGDINSNFLPRQQNSM 348
             K L +L   D S V+IID   + +    EN I + P+N   G  D   + L R    +
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN---GEAD---DKLVRLIPFL 327

Query: 349 LHLGRRNRKKAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKF 390
            +L  +  K       + +  + +K L E+ D  VKK ++KF
Sbjct: 328 EYLATQQTKDVRP---ILNSFEDKKNLAEEFDHRVKKLKDKF 366

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 527 TTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVK 564
           TTH I        A L +  N NI ++ P+WI  C V+
Sbjct: 212 TTHFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVE 249

>Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON}
           (148854..151013) [2160 nt, 720 aa]
          Length = 719

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 110 VVCGKTVEED---DQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKL 166
           V C   + ED     +V DNG    K   A N+T IK+ + +  ++ KT   H       
Sbjct: 181 VQCFTGIHEDVIRKVSVLDNG---RKFVTASNDTTIKICDLETGSVLKTLSGH-ESFVYS 236

Query: 167 VLVVDLDQTVIHCGVDPTIHEWA 189
           V++    + +I CG D ++  W+
Sbjct: 237 VIISPKSKELISCGEDRSVRIWS 259

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 235 RPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDP-----KGELFGDRILSRDENGSL 289
           RPG   F   ++ +FE+ +++     Y+ +IA+ +DP        LF +  + +D    +
Sbjct: 218 RPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 290 THKSLERLFPMDQSMVVIIDDRGDVWSWC-ENLIKVVPYN 328
             K L +L   D S V+IID   + +    EN I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTEPNSYKLQPENAIPMDPWN 313

>TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 22/110 (20%)

Query: 313 DVWS----WCENLIKVVP-----------YNFFVGVGDINSNFLPRQQNSMLHLGRRNRK 357
           DVWS    +C  ++K  P           + +F    D+  +++   +++ L +  R +K
Sbjct: 423 DVWSIGIIFCCLMLKRFPWKAPRQDTDENFKYFCMEDDMEHDYVASAKHNELVIRERIKK 482

Query: 358 KAEEEELLTDIMDTEKKLQEKIDQEVKKQEEKFNKINEENQPERPISKED 407
           K E+EE+L       KK +EK D   + + E++ K + E  PE  +  ED
Sbjct: 483 KHEKEEIL-------KKQKEKSDAIREGRLEEYLKEHAEEVPEADVKTED 525

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 231 YVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRIL 281
           YV  RPG+  F  ++   +E+ I+T +   YA  +  ++D    L   R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>Kpol_1002.57 s1002 (157693..159432) [1740 bp, 579 aa] {ON}
           (157693..159432) [1740 nt, 580 aa]
          Length = 579

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 38/86 (44%), Gaps = 6/86 (6%)

Query: 37  YKYWELQDIITAPNEEAPKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIA--- 93
           YK   L    TAP  E P   + +++    +S ++ ++  +N+  G   VND N +    
Sbjct: 166 YKKKFLDVYSTAPTPERPLDSKLLEVFRNIESQLDRSIFDINLVSG---VNDKNKLTSDD 222

Query: 94  EVNQLCSHEVTYGGLCVVCGKTVEED 119
           E+N  C H+  +      C   + ++
Sbjct: 223 EINYFCCHQTLFRNFLENCNPAITDN 248

>YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}
           HAL9Putative transcription factor containing a zinc
           finger; overexpression increases salt tolerance through
           increased expression of the ENA1 (Na+/Li+ extrusion
           pump) gene while gene disruption decreases both salt
           tolerance and ENA1 expression
          Length = 1030

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 332 GVGDINSNFLPRQQNSMLHLGRRNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKF 390
           G   + SN + +  N   +L ++   K E+ +  ++ I+D+  +L+  +D+ VKKQE K+
Sbjct: 219 GNSPLESNIIDKVSNIQNNLNKKMNSKIEKLDRKMSYIIDSVARLEWLLDKAVKKQEGKY 278

Query: 391 NKINEENQPERPI 403
            + N   +P R I
Sbjct: 279 KEKNNLPKPARKI 291

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/106 (20%), Positives = 48/106 (45%), Gaps = 2/106 (1%)

Query: 456 NVHKTYYDKLAEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMF 515
           NV   ++    ++   P  K L+  ++ ++F +   + S    LG   ++  I       
Sbjct: 311 NVAWIFFMWSMQEFISPSSKLLLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEAL 368

Query: 516 GATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFEC 561
           G  ++ ++ +  THV++  P   K + A  ++   KV++  W+ EC
Sbjct: 369 GGASTTELSKKNTHVLSCMPYGQKYQAAVRWSDTCKVVNHLWLEEC 414

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 512 TSMFGATTSVDVDEATTHVIT--KTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVN 569
            S+FG T    +    TH+IT  K     KA + K +   +  + P+W+ +CL     + 
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKA-MQKFHKYTVIYLMPNWLVDCLCGLEYIK 204

Query: 570 EKPYELTTEQD 580
           E  Y +   +D
Sbjct: 205 EDEYLINVNED 215

>ZYRO0C09834g Chr3 (747069..750206) [3138 bp, 1045 aa] {ON} similar
           to uniprot|P33327 Saccharomyces cerevisiae YDL215C GDH2
           NAD( )-dependent glutamate dehydrogenase degrades
           glutamate to ammonia and alpha-ketoglutarate expression
           sensitive to nitrogen catabolite repression and
           intracellular ammonia levels
          Length = 1045

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 74/206 (35%), Gaps = 35/206 (16%)

Query: 102 EVTYGGLCVVCGKTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLR 161
           +V  GG+ +VC KT     Q+V D    NSK  V  N       +R+   I +   K + 
Sbjct: 530 DVARGGIRIVCSKT-----QDVYD---MNSKTVVDENYQLASTQQRKNKDIPEGGSKGV- 580

Query: 162 EHKKLVLVVDL---DQTVIHCG--VDPTIHEWANDPSNPNYDALKN---VKTFSLDEDPI 213
               ++L   L   DQT I     VD  I     DP    Y  L N   +  F  DE   
Sbjct: 581 ----ILLNPGLTAPDQTFIAFTQYVDSIIDILIKDPLKEKYVDLLNQEEILFFGPDEGTA 636

Query: 214 LXXXXXXXXXXXRKCQYYVKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKII---- 269
                       R C ++     G       I PH E  + ++  RAY  E+ K +    
Sbjct: 637 GFVDWATKHARARGCPWWKSFLTGKSPQLGGI-PHDEYGMTSLGVRAYVNELYKTLHLED 695

Query: 270 ---------DPKGELFGDRILSRDEN 286
                     P G+L  + IL   +N
Sbjct: 696 AVIHKFQTGGPDGDLGSNEILLSTKN 721

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,599,849
Number of extensions: 3555366
Number of successful extensions: 22133
Number of sequences better than 10.0: 582
Number of HSP's gapped: 22095
Number of HSP's successfully gapped: 898
Length of query: 745
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 628
Effective length of database: 40,065,477
Effective search space: 25161119556
Effective search space used: 25161119556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)