Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03872g8.840ON62162132770.0
Kwal_27.102588.840ON62062023610.0
SAKL0D01474g8.840ON62462620850.0
KLLA0D01573g8.840ON60762418890.0
ABL126W8.840ON62462218880.0
TPHA0I002508.840ON62962818770.0
YMR278W (PGM3)8.840ON62262318720.0
Ecym_46118.840ON63062518550.0
Suva_13.4668.840ON62262318420.0
NCAS0C004108.840ON62562918410.0
Smik_13.4918.840ON62263118090.0
KNAG0J002708.840ON62562718080.0
CAGL0M02981g8.840ON61762518070.0
Skud_13.4508.840ON62262318060.0
NDAI0K004108.840ON62663017950.0
TDEL0B005708.840ON63062317940.0
ZYRO0G14190g8.840ON61062117810.0
TBLA0B032508.840ON64363817780.0
KAFR0B039208.840ON62463217750.0
Kpol_1068.88.840ON63262416880.0
SAKL0E03630g2.445ON5714301216e-06
Kwal_26.76282.445ON5703921199e-06
Kpol_1033.542.445ON5704301162e-05
KLTH0D04796g2.445ON5704261153e-05
KAFR0D030102.445ON5694261127e-05
KNAG0E023902.445ON5693961101e-04
ZYRO0G02508g2.445ON5694261101e-04
TDEL0E00210singletonON5704391073e-04
Kpol_1018.1612.445ON5694551047e-04
NCAS0A043502.445ON5694271030.001
NCAS0F014702.445ON5693311000.002
KLLA0B12694g2.445ON568443990.002
TPHA0G029002.445ON569434970.004
TDEL0A022102.445ON572331970.004
Ecym_24752.445ON567445950.008
NDAI0H023502.445ON569319930.013
Smik_13.2912.445ON569329930.014
ABL029W2.445ON568492920.016
ACR015W6.11ON552105920.018
Skud_13.2632.445ON569329900.026
KAFR0L003406.11ON540131900.027
Suva_13.2822.445ON569322890.035
CAGL0B03597g6.11ON54041890.036
Kpol_1032.26.11ON53961890.038
KAFR0A028908.854ON528174880.055
NCAS0F002006.11ON54953880.056
TDEL0G046006.11ON52842870.066
TPHA0G024702.445ON569418850.10
TBLA0G009806.11ON55834850.12
KNAG0K017503.158ON414110840.12
NDAI0K028906.11ON56151850.13
CAGL0K07480g2.445ON567419840.16
Skud_5.316.11ON55750830.18
Suva_5.106.11ON55396830.19
Smik_5.296.11ON55550830.20
KLTH0C11506g6.11ON54460820.23
Kwal_56.223556.11ON54160820.23
Skud_11.1022.445ON570429820.26
YEL058W (PCM1)6.11ON557100820.27
ZYRO0F00506g6.11ON55023820.28
KNAG0A062802.445ON570424810.37
Suva_4.2173.158ON429131800.38
TPHA0M002106.11ON54561800.41
SAKL0E00902g6.11ON54441790.61
TBLA0B090102.445ON569422790.66
KLLA0D00858g6.11ON54118780.87
NDAI0A066803.158ON413120770.95
KNAG0E009406.11ON53856761.2
Smik_4.2033.158ON414126751.8
Smik_11.1122.445ON570133751.9
SAKL0C08756g3.158ON413108742.1
Suva_11.982.445ON570430742.3
Ecym_30146.11ON55141724.2
NCAS0A047902.535ON55550724.5
ZYRO0D16588g7.224ON47459699.0
Smik_8.1605.376ON1038138699.3
KLLA0E18481g2.535ON46455699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03872g
         (621 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...  1266   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   914   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   807   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   732   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   731   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   727   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   725   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   719   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   714   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   713   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   701   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   701   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   700   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   700   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   696   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   695   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   690   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   689   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   688   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   654   0.0  
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    51   6e-06
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    50   9e-06
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    49   2e-05
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    49   3e-05
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    48   7e-05
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    47   1e-04
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    47   1e-04
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    46   3e-04
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    45   7e-04
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    44   0.001
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    43   0.002
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    43   0.002
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               42   0.004
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    42   0.004
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    41   0.008
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.013
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    40   0.014
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    40   0.016
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    40   0.018
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    39   0.026
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    39   0.027
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    39   0.035
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    39   0.036
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.038
KAFR0A02890 Chr1 (600855..602441) [1587 bp, 528 aa] {ON} Anc_8.8...    39   0.055
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.056
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    38   0.066
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    37   0.10 
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    37   0.12 
KNAG0K01750 Chr11 (366717..367961) [1245 bp, 414 aa] {ON} Anc_3....    37   0.12 
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    37   0.13 
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    37   0.16 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.18 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.19 
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    37   0.20 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.23 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.23 
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    36   0.26 
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    36   0.27 
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    36   0.28 
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               36   0.37 
Suva_4.217 Chr4 complement(383019..384308) [1290 bp, 429 aa] {ON...    35   0.38 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    35   0.41 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    35   0.61 
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    35   0.66 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    35   0.87 
NDAI0A06680 Chr1 (1528516..1529757) [1242 bp, 413 aa] {ON} Anc_3...    34   0.95 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    34   1.2  
Smik_4.203 Chr4 complement(372811..374055) [1245 bp, 414 aa] {ON...    33   1.8  
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    33   1.9  
SAKL0C08756g Chr3 complement(802996..804237) [1242 bp, 413 aa] {...    33   2.1  
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    33   2.3  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    32   4.2  
NCAS0A04790 Chr1 complement(956993..958660) [1668 bp, 555 aa] {O...    32   4.5  
ZYRO0D16588g Chr4 (1375905..1377329) [1425 bp, 474 aa] {ON} simi...    31   9.0  
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    31   9.3  
KLLA0E18481g Chr5 complement(1642554..1643948) [1395 bp, 464 aa]...    31   9.6  

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 1266 bits (3277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/621 (97%), Positives = 607/621 (97%)

Query: 1   MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60
           MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL
Sbjct: 1   MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60

Query: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120
           RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ
Sbjct: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120

Query: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180
           LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC
Sbjct: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180

Query: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV 240
           QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV
Sbjct: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV 240

Query: 241 ITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300
           ITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP
Sbjct: 241 ITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300

Query: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKW 360
           NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKW
Sbjct: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKW 360

Query: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420
           ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG
Sbjct: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420

Query: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480
           YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK
Sbjct: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480

Query: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLP 540
           EYNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLP
Sbjct: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLP 540

Query: 541 VDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXXXX 600
           VDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAV             
Sbjct: 541 VDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASALAKK 600

Query: 601 XWDVLRREWFKPEQTGLATNF 621
            WDVLRREWFKPEQTGLATNF
Sbjct: 601 AWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/620 (69%), Positives = 496/620 (80%)

Query: 2   MSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLR 61
           M     E+P DLK  VE+W ++DKNE+TR++I++LV +++W EL  RL+ RI+FGTAGLR
Sbjct: 1   MESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLR 60

Query: 62  SRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQL 121
           S+MEAGF+RMNTLTVLQASQGLAKYIA  FP+N +V VGHDHRFNS+DFAEVT VAFLQL
Sbjct: 61  SKMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQL 120

Query: 122 GFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQ 181
            FKVY LGF  D  +D  VHTPMVPF ID L AS G+MITASHNPKMDNGYKVYYSNGCQ
Sbjct: 121 RFKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQ 180

Query: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241
           IIPPHD+ I+QSIL NL PW+RAWDC AV AEA +    +D KK +VD YV  +   LV 
Sbjct: 181 IIPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVS 240

Query: 242 TNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301
           +++     PWFVYTPLHGVGFEIFE+I S    L +GRDY CV E K PDP FPTVSFPN
Sbjct: 241 SDIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPN 300

Query: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWE 361
           PEE GALD AI LA+K+ I+FVLGNDPDADRFS A KH G+WRQLTGNEIGFLFAQ+ WE
Sbjct: 301 PEEAGALDLAIALADKNGISFVLGNDPDADRFSAAVKHQGKWRQLTGNEIGFLFAQFVWE 360

Query: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421
            Y+ ES +FK  NPLA+INSTVSSQMIKK+A VE FHYEDTLTGFKWLGNRAR+LE++GY
Sbjct: 361 KYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGY 420

Query: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKE 481
           +VPFAYEEAIG+MFSD+VHDKDG+SAAVVFLQMLWSWK QAL+P DVLQ A+ KYGVFKE
Sbjct: 421 YVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALSPIDVLQSAFGKYGVFKE 480

Query: 482 YNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPV 541
           YNGYY VPDLSLTD++FS IRS +   P HIG +F V S+TDLT G+QS+T D+ PRLPV
Sbjct: 481 YNGYYTVPDLSLTDRIFSDIRSSYDSYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLPV 540

Query: 542 DPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXXXXX 601
           DPSSQMI ATL P++S G     E VRFTARGSGTEPKLKVYIEA               
Sbjct: 541 DPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLARTT 600

Query: 602 WDVLRREWFKPEQTGLATNF 621
           W+VLR EWFKP++TGL+T F
Sbjct: 601 WNVLRDEWFKPKETGLSTKF 620

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/626 (64%), Positives = 464/626 (74%), Gaps = 8/626 (1%)

Query: 2   MSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLR 61
           MS +   VP+DLK  V  WL YDKN +TR +++ LVE K W EL  RL+ RI+FGTAGLR
Sbjct: 1   MSDSYTTVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLR 60

Query: 62  SRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQL 121
           SRMEAGF+RMNTLTVLQASQGLA YI S FP+NLSV+VGHDHR++S +FA VT+ AFLQL
Sbjct: 61  SRMEAGFSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQL 120

Query: 122 GFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQ 181
           GFKVY L  +   S +  VHTPMVPF I+ L AS GIMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 121 GFKVYYLNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQ 180

Query: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241
           IIPPHD+ IS++I  NL PW++AWDC  V   A++S  L D K+ +  +Y+ TV   LV 
Sbjct: 181 IIPPHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVR 240

Query: 242 TNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301
             +     PWFVYTP+HGVGFEIFE+I   A  L +G+ Y+CV EQ+ PDP FPTVSFPN
Sbjct: 241 VPMLDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPN 300

Query: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWE 361
           PEEKGALD +I LAE+ DI  V+ NDPDADRFSVA K+  +W QLTGNEIGFLFA Y+W+
Sbjct: 301 PEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDRWSQLTGNEIGFLFAYYQWQ 360

Query: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421
            Y+   + FK  +PLAMINSTVSSQMIK +AE E FHYEDTLTGFKWLGNRA ELE  GY
Sbjct: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420

Query: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQ-ALTPFDVLQRAYQKYGVFK 480
           +VPFAYEEAIGYMF +V HDKDGISAAVVFLQM   W ++  +TP  VL   + KYGVFK
Sbjct: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480

Query: 481 EYNGYYIVPDLSLTDKVFSGIRSGFS----LQPTHIGQEFRVESYTDLTTGYQSNTPDSE 536
           EYNGYYIVP LSLT +VF  IR  ++      P  IG EF V S+ DLTTGYQS+T D+ 
Sbjct: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540

Query: 537 PRLPVDPSSQMITATLTPTSSTGRQGFS-ESVRFTARGSGTEPKLKVYIEAVXXXXXXXX 595
           P LPVD SSQMITATL P  S G++  S E VRFT RGSGTEPKLKVYIEA         
Sbjct: 541 PNLPVDASSQMITATLRP--SNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQ 598

Query: 596 XXXXXXWDVLRREWFKPEQTGLATNF 621
                 W VLRREWF+PE+TGL T F
Sbjct: 599 HLARETWQVLRREWFRPERTGLETKF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/624 (59%), Positives = 437/624 (70%), Gaps = 38/624 (6%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           +P DL+  V  WLKYDK E+TR++I++L      TEL  RL+  I FGTAGLR RMEAGF
Sbjct: 10  LPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRMEAGF 69

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           NRMN LTV QASQGLAKYI   FP+NL+VVVGHDHR NS+ F +VT+  FLQLGFKV+ L
Sbjct: 70  NRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFKVFHL 129

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
               + S   +VHTP+VPF ++   AS GIMITASHNPKMDNGYKVYY+NGCQIIPPHD+
Sbjct: 130 NHENEKS---LVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDK 186

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVNH-T 247
            I++SI+ NLEP+            + Q+  +ID K+ +  +Y+D +  +L+   VN  T
Sbjct: 187 LIAESIIHNLEPFS-----------SPQTGTIIDCKEKMTKKYIDAIGSTLIDGAVNKKT 235

Query: 248 KAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGA 307
             PWFVYTP+HGVGFEIFE I      L +G+DYL VEEQKYPD +FPTVSFPNPEEKGA
Sbjct: 236 NEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEEKGA 295

Query: 308 LDKAIELAEKHD-ITFVLGNDPDADRFSVAAKHNGQ-----WRQLTGNEIGFLFAQYKWE 361
           LD A+E   K+D +  ++ NDPDADRFSVA + N Q     WRQLTGNEIGFLFA Y+WE
Sbjct: 296 LDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYYEWE 355

Query: 362 TYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGY 421
            Y+          PLAM+NSTVSSQMIK+MAE+EGFHYEDTLTGFKWLGNRA ELE  GY
Sbjct: 356 RYKHSPID----EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQEGY 411

Query: 422 FVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKE 481
           + PFAYEEAIGYMFS VVHDKDGISAA+VFLQ    W+A   T  D+L  A  KYG FKE
Sbjct: 412 YTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTVLDILATASLKYGHFKE 471

Query: 482 YNGYYIVPDLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPV 541
           +NGYYIVPDL++T +VF  IRS  S  P  +G  F +  + DLT GYQS+TPD  P L  
Sbjct: 472 FNGYYIVPDLAITKQVFDAIRSIESPYPKKLGSSFEIIKFRDLTNGYQSDTPDHIPELAS 531

Query: 542 DPSSQMITATL----TPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXX 597
           DPSSQMIT  +     PTS          VRFT RGSGTEPKLKVYIEA           
Sbjct: 532 DPSSQMITCEMLLVEQPTS---------RVRFTIRGSGTEPKLKVYIEARTNTEPNSIAL 582

Query: 598 XXXXWDVLRREWFKPEQTGLATNF 621
               WDVLR+EWFKPE TGL T F
Sbjct: 583 AKFTWDVLRQEWFKPELTGLLTPF 606

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/622 (58%), Positives = 452/622 (72%), Gaps = 14/622 (2%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           VP  LK  +  WL +DKN +T+ +I +LV +  W ELR RL  RITFGTAGLR+RMEAGF
Sbjct: 8   VPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGF 67

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMNTLTV+QASQGLA+YI S FPD+L VV+GHDHRF+S++FAE TI AFLQL + +Y L
Sbjct: 68  SRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYL 127

Query: 129 GFTEDAS-QDVVVHTPMVPFGIDHLRA---SGGIMITASHNPKMDNGYKVYYSNGCQIIP 184
            +    S +DV VHTPMVPF I+++     S G+MITASHNPKMDNGYKVYY+NGCQIIP
Sbjct: 128 NYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIP 187

Query: 185 PHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI-TN 243
           PHD+ I + I ANLEPW RAWD  A+  EA++S  L D +K ++ +Y D+++  LV  +N
Sbjct: 188 PHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQSN 247

Query: 244 VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPE 303
           +     PWFVYTP+HGVG+E F++ ++S   + + +DY+ V EQKYPDP FPTVSFPNPE
Sbjct: 248 LKFAGGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNPE 307

Query: 304 EKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETY 363
           E+GALD A+++A+ + IT VL NDPDADRFSVA K++G+W QLTGN+IG LFAQ + ++Y
Sbjct: 308 ERGALDMAMKVADANGITVVLANDPDADRFSVAVKYHGEWNQLTGNQIGILFAQAEMQSY 367

Query: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423
             E    +    LAM+ S VSSQ+++KMAE EGF   +TLTGFKWLGNRARELE  GY+V
Sbjct: 368 FKEPKLDR--KQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEGYYV 425

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKEYN 483
           PFAYEEAIGYMFS VVHDKDGI+AA VFLQM + WK  A +  +VLQ  Y+KYG F +YN
Sbjct: 426 PFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQEVLQECYEKYGYFVDYN 485

Query: 484 GYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRL 539
           GYYI    ++T +VF   R+ ++      P+HIG EF VE   DLT GYQS+T  + P L
Sbjct: 486 GYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATNIPDL 545

Query: 540 PVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXXX 599
           PVD +SQMIT  L P      +   ESVRFTARGSGTEPKLKVYIE+             
Sbjct: 546 PVDHNSQMITCVLKPVK---METDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLSH 602

Query: 600 XXWDVLRREWFKPEQTGLATNF 621
             WDVL+REWF+P +TGL TNF
Sbjct: 603 LAWDVLKREWFRPTETGLQTNF 624

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/628 (57%), Positives = 452/628 (71%), Gaps = 24/628 (3%)

Query: 7   AEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEA 66
           + +PEDLK  +  W +YD N++T D++ +L  +KS  EL  R + RI FGTAGLRSRMEA
Sbjct: 13  SSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTAGLRSRMEA 72

Query: 67  GFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVY 126
           GFNRMN LTVLQ++QGLA YI S FP NL+ VVGHDHR++SK+FA++T   FL  GFKVY
Sbjct: 73  GFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVFLNAGFKVY 132

Query: 127 DLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPH 186
            L        D  VHTPMVPFGI+   AS G+MITASHNP+MDNGYKVYY+NGCQIIPPH
Sbjct: 133 YLN-----PNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPH 187

Query: 187 DQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVN- 245
           D+ I++ I  NLEP    W+  AV ++A+++  LI +K+ ++ QY+  + + ++  N++ 
Sbjct: 188 DKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKNISL 247

Query: 246 ----HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPN 301
                 K PWFVYTP+HGVG++IF +I S+   L +  DY+CV+EQ  PDP+FPTVSFPN
Sbjct: 248 GTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVSFPN 307

Query: 302 PEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKH--NGQWRQLTGNEIGFLFAQYK 359
           PEEKGALD  I+ A+KH+I  V+ NDPDADRFSVA ++    +++QLTGNEIGFLFA + 
Sbjct: 308 PEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFAYFL 367

Query: 360 WETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENA 419
           WE Y +    FK   PLAMINSTVSSQMIKKMAEVEGF+YEDTLTGFKW+GN+ARELE  
Sbjct: 368 WEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKARELEKE 427

Query: 420 GYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW---KAQALTPFDVLQRAYQKY 476
           GY+VPF +EEAIGYMF  +  DKDGI+A VVFLQ  + W     Q+L  FD+++  ++KY
Sbjct: 428 GYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSL--FDIIETGFKKY 485

Query: 477 GVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQP---THIGQEFRVESYTDLTTGYQSNTP 533
           GVFKEYNGYYIV DLSLT  +F  IR   + +    +HIG EF+V ++ DLT GYQS+T 
Sbjct: 486 GVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDTI 545

Query: 534 DSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXX 593
            + P LPVDPSSQMIT T+ PTS       + SVRFT RGSGTEPKLKVYIEA       
Sbjct: 546 GNVPTLPVDPSSQMITMTIIPTSLPE----NGSVRFTIRGSGTEPKLKVYIEANAKTEAE 601

Query: 594 XXXXXXXXWDVLRREWFKPEQTGLATNF 621
                   WDVL+REWF  E+TGL TNF
Sbjct: 602 ANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/623 (56%), Positives = 445/623 (71%), Gaps = 19/623 (3%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           VP DLK  +  W K D+N +T +++  L +   W EL  R + RI FGTAGLRS+M+AGF
Sbjct: 9   VPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQMQAGF 68

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMNTL V+QASQGLA Y+   FPDNL  VVGHDHRF+SK+FA  T  AFL  GFKV+ L
Sbjct: 69  SRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFKVHYL 128

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
               +      VHTP+VPF +D L+AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 NPDHE-----FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN---VN 245
            IS SI ANLEPW   WD   V  +A++   L+ +++ ++  Y++ V ++LV  N   + 
Sbjct: 184 AISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLE 243

Query: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305
               PWFVYTP+HGVGF+IF  I+     L +G+DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 244 VKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363
           GALD  I LAEKHDI  ++ NDPDADRFSVA K   +G+WRQLTGNEIGFLFA Y+++ Y
Sbjct: 304 GALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKY 363

Query: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423
           +    +F+  +PLAM+NSTVSSQMIKKMAE+EGFHYEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 KSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYV 423

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKA-QALTPFDVLQRAYQKYGVFKEY 482
           PF +EEAIGYMF  + HDKDGISA++VFLQ    WK    L P +VL+  ++KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEY 483

Query: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538
           NGYY+VP+ ++T  +F  IR+ ++ +    P+ IG+E  V  Y DLTTGYQS+T + +P 
Sbjct: 484 NGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPT 543

Query: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXX 598
           LPVDP+SQMIT +  P++ +     +E +RFT RGSGTEPKLKVYIEA            
Sbjct: 544 LPVDPTSQMITVSARPSNGSE----NEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLA 599

Query: 599 XXXWDVLRREWFKPEQTGLATNF 621
              W+VLRREWF+P++  + T F
Sbjct: 600 KLTWNVLRREWFRPDEMNIVTKF 622

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/625 (57%), Positives = 437/625 (69%), Gaps = 13/625 (2%)

Query: 6   NAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRME 65
           N  +P+DL+  ++ W KYDKN QT  +I  LV+ ++W ELR RL  RI+FGTAGLR+RME
Sbjct: 10  NELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARME 69

Query: 66  AGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKV 125
           AGF RMNTLTV+QASQGLA YI S FP+NL VVVGHDHR+NSK FAEV I AFLQLGF+V
Sbjct: 70  AGFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEV 129

Query: 126 YDLGFTEDASQDV--VVHTPMVPFGIDHLR--ASGGIMITASHNPKMDNGYKVYYSNGCQ 181
           Y L +   +++DV   VHTPMVPF + ++   AS GIMITASHNPKMDNGYKVYYSNGCQ
Sbjct: 130 YYLNYVP-SNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188

Query: 182 IIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVI 241
           I PPHD++I+  I ANL PWD+AWD   +  +A  +  L D K+ L+  YV  ++ SLV 
Sbjct: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248

Query: 242 TN-VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300
           TN +      WFVYTP+HGVG+EIF  I+++   L +   YL V  QK+PDP F TVSFP
Sbjct: 249 TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFP 308

Query: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKW 360
           NPEE+GAL+ AIELA +     VL NDPDADRFS A K   +W+QLTGN++G+LFA  + 
Sbjct: 309 NPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNKWKQLTGNQLGYLFAVGQL 368

Query: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420
           E +   S++ +   PLAM+ STVSSQMI KMA+VEGF + +TLTGFKWL NRA +LEN G
Sbjct: 369 EKF---SNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDG 425

Query: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480
           ++VPFAYEEAIGYMFS V HDKDG+SAA  FLQM   WK +  TP DVL   Y+KYG F 
Sbjct: 426 FYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKTPLDVLNAGYEKYGNFV 485

Query: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSE 536
           EYNGYY V DLS+   VF  IR+  +      P+ IG EF V S+ DLT GYQS+T +  
Sbjct: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545

Query: 537 PRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXX 596
           P LPV P S MIT  L P      Q  S+ VRFT RGSGTEPKLKVYIE+          
Sbjct: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605

Query: 597 XXXXXWDVLRREWFKPEQTGLATNF 621
                WDVL+REWF+PE TGL T F
Sbjct: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/623 (56%), Positives = 439/623 (70%), Gaps = 19/623 (3%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           VP DLK  +  W   D+N +T +++  L ++  W EL  R + RI FGTAGLRS M+AGF
Sbjct: 9   VPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSEMQAGF 68

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMNTL ++QA+QGLA YI   FPDNL VVVGHDHRF+SK+FA  T  AFL  GFKV+ L
Sbjct: 69  SRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGFKVHYL 128

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
               +      VHTP+VPF +D L+AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 129 NPDHE-----FVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN---VN 245
            IS SI  NLEPW   W  + V  +A++   L+ +++ +++ Y   V ++LV TN   + 
Sbjct: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243

Query: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305
               PWFVYTP+HGVGF IF  I+     L +G DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363
           GALD  + LAE+HDI  ++ NDPDADRFS+A K   + +WRQLTGNEIGFLFA ++++ Y
Sbjct: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363

Query: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423
           + + ++F+ ++PLAM++STVSSQMIKKMAEVEGF YEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQA-LTPFDVLQRAYQKYGVFKEY 482
           PF +EEAIGYMF  + HDKDGISAAVV LQ    WK  + L P D+L+  +QKYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483

Query: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538
           NGYY+VP   +T ++F  IR+ ++      P  IG+E  V  Y DLTTGYQS+TPD +P 
Sbjct: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543

Query: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXX 598
           LPVDP+SQMIT +  P+   G    +E +RFT RGSGTEPKLKVYIEA            
Sbjct: 544 LPVDPTSQMITLSGKPSDGNG----NEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLA 599

Query: 599 XXXWDVLRREWFKPEQTGLATNF 621
              WDVLRR WF+PE   + T+F
Sbjct: 600 KLTWDVLRRGWFRPEIMNITTDF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/629 (55%), Positives = 447/629 (71%), Gaps = 20/629 (3%)

Query: 3   SLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRS 62
           SL+N   PE+L+  +  WL+ D+NE+TR ++++L E+K+W EL  R + RI FGTAGLRS
Sbjct: 7   SLSNC--PENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRS 64

Query: 63  RMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLG 122
           RMEAGF+RMN+L +LQ++QGLA YI   FP+NL+ VVGHDHRF+SK+FA VT   FL+ G
Sbjct: 65  RMEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAG 124

Query: 123 FKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182
           FKV+ L        D  VHTP+VPF + +L+AS G+MITASHNPKMDNGYKVYY N CQI
Sbjct: 125 FKVFYL-----TPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQI 179

Query: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242
           IPPHD+ I++ I  NLEPW  +WD  A   + +++  L+  K ++ ++Y+  ++R L+ +
Sbjct: 180 IPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHS 239

Query: 243 N---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSF 299
           +   +   K P+FVYTP+HGVG EIF K+ S    L +  DYL V EQ+ PDP+FPTVSF
Sbjct: 240 SHLSLKDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSF 299

Query: 300 PNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQ 357
           PNPEEKGAL  AI+LA+++ ++ V+ NDPDADRFS A   K  G+WRQLTGNEIGFL   
Sbjct: 300 PNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGY 359

Query: 358 YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELE 417
           Y+++ Y  +   F+ T+PLAMINSTVSSQMIK+MA++ GFHYEDTLTGFKW+GN+A +L 
Sbjct: 360 YEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLR 419

Query: 418 NAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQ-ALTPFDVLQRAYQKY 476
             GY+VPF +EEAIGYMF D+  DKDGISAA VFLQ    W  Q  ++PFD+++  + K+
Sbjct: 420 QEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKF 479

Query: 477 GVFKEYNGYYIVPDLSLTDKVFSGIRSGF----SLQPTHIGQEFRVESYTDLTTGYQSNT 532
           GVFKEYNGYYI+ DLS+T  VF  IR  +       P+ IG E  V  + DLT GYQSNT
Sbjct: 480 GVFKEYNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNT 539

Query: 533 PDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXX 592
            D+ P LPVDP+SQMIT    P+  +  +G   +VR T RGSGTEPKLKVYIEA      
Sbjct: 540 KDNIPNLPVDPTSQMITVEAKPSEFSNLEG---TVRLTMRGSGTEPKLKVYIEACSKSEE 596

Query: 593 XXXXXXXXXWDVLRREWFKPEQTGLATNF 621
                    WD+L+REWF+PE TGL T+F
Sbjct: 597 SATNLARSTWDILKREWFRPEVTGLTTSF 625

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/631 (54%), Positives = 443/631 (70%), Gaps = 20/631 (3%)

Query: 2   MSLTNAE-VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60
           MSL   E VP +LK  +  W + D+N +T +++  L +   W EL  R + RI FGTAGL
Sbjct: 1   MSLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGL 60

Query: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120
           RS+M+AGFNRMNTL ++QASQGLA Y    FP+NL  VVGHDHRF+SK+FA  T  AFL 
Sbjct: 61  RSQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLL 120

Query: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180
            GFKV+ L    +      VHTP+VPF +D L+AS G+M+TASHNPKMDNGYKVYYSNGC
Sbjct: 121 KGFKVHYLNPDHE-----FVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGC 175

Query: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV 240
           QIIPPHD  IS SI  NLEPW   W+   V  + ++   L+ +++ ++  Y+  V ++LV
Sbjct: 176 QIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLV 235

Query: 241 ITN---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTV 297
            T+         PWFVYTP+HGVGF+IF  I+     L +G+DYLCV EQ+ PDP+FPTV
Sbjct: 236 GTDPLKFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTV 295

Query: 298 SFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLF 355
           +FPNPEEKGALD  I LAE H I  ++ NDPDADRFSVA K   +G+WRQLTGNEIGFLF
Sbjct: 296 AFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLF 355

Query: 356 AQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARE 415
           A ++++ ++    +F+  +PLAM++STVSSQMIKKMAEVEGFHYE+TLTGFKW+GNRA  
Sbjct: 356 AIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAIL 415

Query: 416 LENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKA-QALTPFDVLQRAYQ 474
           LE  GY+VPF +EEAIGYMF  + HDKDG+SA++VFLQ    WK    L P  +L+  ++
Sbjct: 416 LEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFK 475

Query: 475 KYGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQS 530
           KYGVFKEYNGYYIV    +T+++F  IR+ ++ +    P+ IG+E  V +Y DLT GYQS
Sbjct: 476 KYGVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQS 535

Query: 531 NTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXX 590
           +T + +P LP+DPSSQMIT +  P  S G +G  E +RFT RGSGTEPK+KVYIEA    
Sbjct: 536 DTSNHKPTLPIDPSSQMITVSAKP--SDGNEG--EHIRFTIRGSGTEPKIKVYIEACADE 591

Query: 591 XXXXXXXXXXXWDVLRREWFKPEQTGLATNF 621
                      W+VL+REWF+PE+  + T+F
Sbjct: 592 EQRATFLAKLTWNVLKREWFRPEKMDIVTHF 622

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/627 (55%), Positives = 432/627 (68%), Gaps = 19/627 (3%)

Query: 4   LTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSR 63
           L NA  PE L+  +  WL+ DKNE+TR +++ L + + W+EL +R + RI FGTAGLRSR
Sbjct: 9   LQNA--PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66

Query: 64  MEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGF 123
           MEAG NR+N+L +LQA+QGLA+YIAS FP N   VVGHDHRF+SK+FA VT   FL+ GF
Sbjct: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126

Query: 124 KVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQII 183
           KV  L        D +VHTP+VPF +DHL AS G+MITASHNPKMDNGYKVY++NGCQII
Sbjct: 127 KVLYLN-----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181

Query: 184 PPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN 243
           PPHD  I++SI  NLEPW+ +WD   V   A + + ++  K  +   Y  T    L+   
Sbjct: 182 PPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR 241

Query: 244 V---NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300
               N    PWFVYTP+HGVG EIF +I      + +  DYLCV EQK+PDP+FPTVSFP
Sbjct: 242 KVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFP 301

Query: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQY 358
           NPEEKGALDKAIELA ++ I  V+ NDPDADRFS+A        WRQLTGNEIGFLFA  
Sbjct: 302 NPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQ 361

Query: 359 KWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELEN 418
           ++E Y+   D F+  +PL ++NSTVSSQMIKKMAEVEGFHYEDTLTGFKW+GNRAR+LE 
Sbjct: 362 QFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEK 421

Query: 419 AGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALT-PFDVLQRAYQKYG 477
            G+F PF YEEAIGYMF+ + HDKDGISA+++FL   + W   A   P D+L+  Y+KYG
Sbjct: 422 KGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYG 481

Query: 478 VFKEYNGYYIVPDLSLTDKVFSGIRSGF---SLQPTHIGQEFRVESYTDLTTGYQSNTPD 534
           VFKEYNGYYIV +  +  + F  IR+     +  P  IG EF+V S+ DLT G+QS+T D
Sbjct: 482 VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSD 541

Query: 535 SEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXX 594
             P LPVDP+SQMIT    PT     +   + VRFT RGSGTEPKLKVYIEA        
Sbjct: 542 HIPTLPVDPNSQMITVCAKPTHDNVER---DHVRFTIRGSGTEPKLKVYIEACSGSETGA 598

Query: 595 XXXXXXXWDVLRREWFKPEQTGLATNF 621
                  WD L+  WF+P+ TGL T+F
Sbjct: 599 QQLAKQMWDTLQEVWFRPQTTGLVTDF 625

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/625 (54%), Positives = 432/625 (69%), Gaps = 15/625 (2%)

Query: 4   LTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSR 63
           ++  ++P +L+  +E+WL+ DKNE+TR+++IKL  D++W EL  R + RI FGTAGLR+R
Sbjct: 1   MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRAR 60

Query: 64  MEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGF 123
           MEAG NR+N L +LQASQGLA YI   FP NL+ VVGHDHR++S++FA+VT   F++ GF
Sbjct: 61  MEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGF 120

Query: 124 KVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQII 183
           KVY L        D  VHTPMVP+ +DHL AS G+MITASHNPKMDNGYKVYY+NGCQII
Sbjct: 121 KVYYLN-----PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQII 175

Query: 184 PPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN 243
           PPHD  I+++I  NLEPW   W+   + + A     +   +K ++  Y+++V   L+  +
Sbjct: 176 PPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQRD 235

Query: 244 -VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNP 302
                + PWFVYTP+HGVG +IF  IL+ +  L    DY+ V EQK PDP+F TVSFPNP
Sbjct: 236 FAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNP 295

Query: 303 EEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNG--QWRQLTGNEIGFLFAQYKW 360
           EEKGAL+ AI LAE + I  VL NDP+ADRFSVA + +   +W+QLTGNEIG LFA Y++
Sbjct: 296 EEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEF 355

Query: 361 ETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAG 420
           + Y+  +DK     PLAM+NSTVS+Q+IK+MAE EGF Y+DTLTGFKW+GN A +LE  G
Sbjct: 356 KMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKG 415

Query: 421 YFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFK 480
           YFVPF YEEAIGYMF  + HDKDG+SAA+VFLQ   +W   +  P D++   Y KYGV  
Sbjct: 416 YFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSNPIDIIHECYDKYGVSA 475

Query: 481 EYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSE 536
           EYNGYYIV D S TDKVF  IRS ++      P  IG+ FRV  + DLT G+ S T D +
Sbjct: 476 EYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKK 535

Query: 537 PRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXX 596
           P LPVD +SQMIT T  P   +G     ESVRFT RGSGTEPKLKVYIE +         
Sbjct: 536 PLLPVDKNSQMITITAVP---SGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARI 592

Query: 597 XXXXXWDVLRREWFKPEQTGLATNF 621
                W+ L+ EWFKP   GL+T+F
Sbjct: 593 LAKSLWETLKHEWFKPSSNGLSTDF 617

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/623 (56%), Positives = 445/623 (71%), Gaps = 19/623 (3%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           +P DLK  +  W   D++ +T +++  L +   W EL  R + RI FGTAGLRS+M+AGF
Sbjct: 9   IPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQAGF 68

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMN L ++QASQGLA YI   FP+NL  VVGHDHRF+SK FA  T  AFL  GFKV+ L
Sbjct: 69  SRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKVHYL 128

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
              ++      VHTP+VPF +D L AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHDQ
Sbjct: 129 NPGQE-----FVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT---NVN 245
            IS +I  NLEPW  AW+   + ++ ++   L+ +++ ++  Y++ +  +LV T    + 
Sbjct: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243

Query: 246 HTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305
               PWFVYTP+HGVGF+IF  I+  +  L +G+DYLCV EQ+ PDP+FPTV FPNPEEK
Sbjct: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAK--HNGQWRQLTGNEIGFLFAQYKWETY 363
           GAL+  + LAEKHDI+ ++ NDPDADRFSVA K   +G W+QLTGNEIGFLFA +++E +
Sbjct: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKF 363

Query: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423
           +   ++F+ T+PLAM++STVSSQMIK+MAEVEGFHYEDTLTGFKW+GNRA  LE  GY+V
Sbjct: 364 KSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWK-AQALTPFDVLQRAYQKYGVFKEY 482
           PF +EEAIGYMF  + HDKDGISA+VVFLQ    WK A  L P +VL+  ++KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483

Query: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538
           NGYYIVP+  +T ++F  IR  ++ +    P +IG+E RV  Y DLTTGYQS+T D +P 
Sbjct: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543

Query: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXX 598
           LPVDP+SQMIT    P  S G    +E +RFT RGSGTEPKLKVYIE             
Sbjct: 544 LPVDPTSQMITVFARPNDSNG----NEHIRFTIRGSGTEPKLKVYIETRANEERRASFLA 599

Query: 599 XXXWDVLRREWFKPEQTGLATNF 621
              WDVLRREWF+PE+T + TNF
Sbjct: 600 KLTWDVLRREWFRPEKTNITTNF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/630 (54%), Positives = 448/630 (71%), Gaps = 20/630 (3%)

Query: 3   SLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRS 62
           S+   + P +L+  ++ WL+ DK E+TR+++I+L +D +W EL  R + RI FGTAGLRS
Sbjct: 6   SIICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRS 65

Query: 63  RMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLG 122
           RMEAGF+RMN L +LQASQGLAKYI + FP NL+ VVGHDHRF+SK FA +T   FL++G
Sbjct: 66  RMEAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVG 125

Query: 123 FKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182
           FKVY L       +D  VHTP+VPF ++HL AS G+MITASHNPKMDNGYKVYYSNGCQI
Sbjct: 126 FKVYYLN-----PEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQI 180

Query: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242
           IPPHD+ I+ +I  NLEPW   W+  +   + ++ + L+  ++ + ++Y+  ++  LV +
Sbjct: 181 IPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSS 240

Query: 243 NV----NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVS 298
           ++    N+ K PWFVYTP+HGVG+ IF KI  +     +  DY  V+EQ YPDP FPTVS
Sbjct: 241 SISRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVS 300

Query: 299 FPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKH--NGQWRQLTGNEIGFLFA 356
           FPNPEEKGAL  A +LAE+++I+ V+ NDPDADRFSVA+K+   GQW+QL+GNEIGFLFA
Sbjct: 301 FPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFA 360

Query: 357 QYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRAREL 416
            ++ E Y  +  +++ T+PLAMINSTVSSQMIKKMA+VE FHYEDTLTGFKW+GNRA +L
Sbjct: 361 SFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDL 420

Query: 417 ENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQK 475
           +  GY+VPF +EEAIGYMF  +V DKDG+SAAVVFL     W       PFD+L++ ++K
Sbjct: 421 QGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKK 480

Query: 476 YGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSN 531
           +G FKEYNGYYI  D   T ++F  +R  +       P +IG+EF++E + DLTTGYQSN
Sbjct: 481 FGFFKEYNGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSN 540

Query: 532 TPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXX 591
           T D+ P LPVDP S+MIT    P    G+      VRFT RGSGTEPKLK+YIEAV    
Sbjct: 541 TIDNLPNLPVDPHSEMITIEAVPKQDIGKS----KVRFTMRGSGTEPKLKLYIEAVADNE 596

Query: 592 XXXXXXXXXXWDVLRREWFKPEQTGLATNF 621
                     W+VL++EW +P+ TGL T F
Sbjct: 597 KCAIDLAYEMWNVLKKEWIRPDVTGLTTTF 626

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/623 (56%), Positives = 438/623 (70%), Gaps = 19/623 (3%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           VP DL   V +WL  D N+QTR +I+ L + K W EL  RL+ RI FGTAGLRSRMEAGF
Sbjct: 17  VPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSRMEAGF 76

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMNTL VLQA+QGLA++I   FPD L+ VVGHDHRFNS++FA  T+  FLQ GFKV   
Sbjct: 77  SRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGFKVI-- 134

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
            F  D   D  VHTP+VPF ++ + AS G+MITASHNPKMDNGYKVYYSNGCQIIPPHD 
Sbjct: 135 -FLNDG--DKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV-ITNVNHT 247
            I+QSI  NL  W +AW    +  E + ++ L+ A + ++++Y   + +SLV  T ++  
Sbjct: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251

Query: 248 K--APWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEK 305
           K   PWFVYTP+HGVG++IF +I      L  GRDYLCV+EQ+ PDP+FPTV FPNPEEK
Sbjct: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311

Query: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAKHN--GQWRQLTGNEIGFLFAQYKWETY 363
           GALD AI +A+K+ I+ VL NDPDADRFS A K N  G WRQLTGNEIG LFA Y+++ Y
Sbjct: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKY 371

Query: 364 RLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFV 423
           + +++++K  +PLAM+NSTVSSQ+I KMAE+E FHY DTLTGFKW+GNR  +LE   Y+V
Sbjct: 372 QKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQKYGVFKEY 482
           PF +EEAIGYMF  + HDKDGISAA VFLQM   W      T   VL+  ++KYGVFKEY
Sbjct: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491

Query: 483 NGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPR 538
           NGYY V D  +  +VF  IR+ +S      P+ IG+E +V  + DLT GYQS+T +  P 
Sbjct: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551

Query: 539 LPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXX 598
           LPVDP+SQMITA    T   G + + ESVRFT RGSGTEPKLKVYIEA            
Sbjct: 552 LPVDPNSQMITAW---TKVNGAKPY-ESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607

Query: 599 XXXWDVLRREWFKPEQTGLATNF 621
              W VL+REWF+P+ TGL T F
Sbjct: 608 QLTWRVLKREWFRPDVTGLTTTF 630

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/621 (55%), Positives = 435/621 (70%), Gaps = 17/621 (2%)

Query: 6   NAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRME 65
           ++ +PE+LK  +  WL  D+NE+T  +I +L + ++W+EL  RLN R+ FGTAGLR+RME
Sbjct: 2   SSNIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARME 61

Query: 66  AGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKV 125
           AGF+RMNTL V+QA+QGLA+YI   FPD+L  VVGHDHRFNS DFA+ T    L+ GF+V
Sbjct: 62  AGFSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEV 121

Query: 126 YDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPP 185
           + L        D  VHTPMVPF +D ++AS G+MITASHNPK+DNGYKVYY+NGCQIIPP
Sbjct: 122 HYLN-----QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPP 176

Query: 186 HDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVN 245
           HD  I++SI +NLEP +  WD      +A     LI  +  +++QY+  V+ S V    +
Sbjct: 177 HDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDS 236

Query: 246 HTKA-PWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEE 304
             K  PWFVYTP+HGVG+++F++I S   +L   RD+L V EQ  PDP FPTV FPNPEE
Sbjct: 237 LPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEE 296

Query: 305 KGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYR 364
           KGALD AI+LAE H I  V+ +DPDADRFSVA K    W+QL+GN+IGFLFA Y+ + YR
Sbjct: 297 KGALDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHGWQQLSGNDIGFLFAYYELQKYR 356

Query: 365 LESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFVP 424
               +++ ++PLAM+NSTVSSQMI  MA +EGFH+EDTLTGFKW+GNRA ELE  GY+VP
Sbjct: 357 GFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVP 416

Query: 425 FAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKEYNG 484
           F +EEAIGYMF    HDKDGISAAVVFLQ   SW +Q  +P D+L  A  KYGVF+EYNG
Sbjct: 417 FGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGKSPLDILDEASAKYGVFREYNG 476

Query: 485 YYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQSNTPDSEPRLP 540
           YY+V + SLT+K F+ IR  ++ +    P  IG + +V+++ DLTTGYQS+TP++ P L 
Sbjct: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLH 535

Query: 541 VDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXXXXX 600
           VDPSSQMIT    P       G  E VRFT RGSGTEPKLKVYIEA              
Sbjct: 536 VDPSSQMITIVAQPKGG----GSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQ 591

Query: 601 XWDVLRREWFKPEQTGLATNF 621
            WD+LR EWF   + GL T F
Sbjct: 592 TWDILREEWFN--RPGLTTKF 610

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/638 (53%), Positives = 433/638 (67%), Gaps = 31/638 (4%)

Query: 8   EVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAG 67
           + PEDL+  V  WL+ DK++ TR +II L +  +  EL  R + RITFGTAGLRS MEAG
Sbjct: 13  DYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAG 72

Query: 68  FNRMNTLTVLQASQGLAKYI---ASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFK 124
           F+RMNTLTVLQASQGLA Y+   A N    L  V+GHDHR++SK+FA++    FL  GFK
Sbjct: 73  FSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFK 132

Query: 125 VYDLG--FTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182
           VY L     ED   +  VHTPMVPF + +L+AS G+M+TASHNPKMDNGYKVYYSNGCQI
Sbjct: 133 VYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQI 192

Query: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242
           IPPHD  ISQ I ANLEPW+ +W+   + A A     LI  + V+++ Y+  +   L   
Sbjct: 193 IPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSK 252

Query: 243 NVNH-------TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFP 295
           ++ H          PWFVYTP+HGVG+EIF KI +    + +G D++ VEEQK+PDP FP
Sbjct: 253 DIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312

Query: 296 TVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQ---WRQLTGNEIG 352
           TVSFPNPEEKGA+D  I+LAE + I+ V+ NDPDADRFS+A K  G    W Q TGNEIG
Sbjct: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372

Query: 353 FLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNR 412
           +LFA ++++ Y++        + L M+NSTVSSQMIKKMAE+EGF+YE+TLTGFKW+GNR
Sbjct: 373 YLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429

Query: 413 ARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQR 471
           A +L N G  VPF YEEAIGYMF  +  DKDGI+A V+F+Q    W +   + P++++Q 
Sbjct: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489

Query: 472 AYQKYGVFKEYNGYYIVPDLSLTDKVF--------SGIRSGFSLQPTHIGQEFRVESYTD 523
            ++KYGVF EYNGYY   DL +T K+F         G+  G    P HIG+EF++  Y D
Sbjct: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRD 549

Query: 524 LTTGYQSNTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVY 583
           LTTGYQS+TPD++P LPVDPSSQMIT  + PT +        S+R T RGSGTEPKLKVY
Sbjct: 550 LTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNES----DGSIRLTIRGSGTEPKLKVY 605

Query: 584 IEAVXXXXXXXXXXXXXXWDVLRREWFKPEQTGLATNF 621
           IEA               W+VL+REW +PEQTG+ T F
Sbjct: 606 IEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/632 (55%), Positives = 438/632 (69%), Gaps = 25/632 (3%)

Query: 1   MMSLTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGL 60
           ++SL +  VPE LK+  + WL+YD+NE+TR +I+ ++  K W EL NRL  RI FGTAGL
Sbjct: 7   ILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGL 66

Query: 61  RSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQ 120
           R RMEAGF RMN+L +LQ SQGLA+YI   FP NLSVVVGHDHR++SK+FA++T+  FL 
Sbjct: 67  RGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLN 126

Query: 121 LGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGC 180
            GFKV+ L      +++  VHTP+VP+ +D LR++ G+MITASHNPK DNGYKVYYSNGC
Sbjct: 127 AGFKVFYLN-----TENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGC 181

Query: 181 QIIPPHDQRISQSILANLEPWDRAWDCAAV-KAEAVQSEMLIDAKKVLVDQYVDTVRRSL 239
           QIIPPHD+ I+ +I  NL PW + W+   +   E     +  +  K+ +  YV  + R  
Sbjct: 182 QIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFL-AYVQDITR-Y 239

Query: 240 VITN---VNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPT 296
           V TN   +  T  PWFVYTP+HGVG +IF +I      L +  DY  V EQ  PDP+FPT
Sbjct: 240 VFTNGSPMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPT 299

Query: 297 VSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFL 354
           VSFPNPEEKGALD AI+LAE+  +T ++ NDPDADRFS A   K + +WRQL+GNEIG L
Sbjct: 300 VSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSL 359

Query: 355 FAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRAR 414
           FA +K + ++   +K     PLAM+NSTVSSQM+KKMA+VEGFHYE+TLTGFKW+GNRA 
Sbjct: 360 FAIFKLQEHK---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRAL 416

Query: 415 ELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAY 473
           +LE  GY V F YEEAIGYMF  + HDKDGI A+VVFL M   W + + L P DVL   +
Sbjct: 417 QLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCF 476

Query: 474 QKYGVFKEYNGYYIVPDLSLTDKVFSGIRSGFSLQ----PTHIGQEFRVESYTDLTTGYQ 529
           +KYGVF EYNGYY V + +L + VFS IR  +  +    P  +G+EF + S+ DLT GYQ
Sbjct: 477 EKYGVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQ 536

Query: 530 SNTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXX 589
           S+T D +P LPVD SSQMITATL P  + G     E +RFT RGSGTEPKLKVYIE+   
Sbjct: 537 SDTIDFKPTLPVDASSQMITATLKPERTVGH----EEIRFTIRGSGTEPKLKVYIESHAA 592

Query: 590 XXXXXXXXXXXXWDVLRREWFKPEQTGLATNF 621
                       W+VLRREWF+PE TGL T+F
Sbjct: 593 NKEAAANLAHLTWNVLRREWFRPEITGLKTSF 624

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/624 (52%), Positives = 418/624 (66%), Gaps = 17/624 (2%)

Query: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68
           +P DL+  V  WL  DKN +T +++I+L +  S  EL  R + RI FGTAGLRS+MEAGF
Sbjct: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74

Query: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128
           +RMNTL VLQA+QGLA YI   FP NL  V+GHDHR++SK+FAE+    FL  GF VY+L
Sbjct: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134

Query: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188
                      VHTP+VPF +D + AS G+MITASHNPKMDNGYKVYYSNGCQIIPP D 
Sbjct: 135 N-----PPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDA 189

Query: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV----ITNV 244
            I++ I  NLEPW  +WD +      + ++ LI  +  ++  Y D V  +++    I   
Sbjct: 190 SIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF 249

Query: 245 NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEE 304
           +  + PWFVYTP+HGVG+EIF  ++     L + RDYL V+EQ  PDP FPT+SFPNPEE
Sbjct: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309

Query: 305 KGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQYKWET 362
           KGALD AI LA+++DI+ V+ NDPDADRFS A    H+G+W+QLTGNEIGFLF  Y +  
Sbjct: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369

Query: 363 YRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYF 422
           Y     +FK  +PLAM+NSTVSS+M+K MA+ E F + DTLTGFKW+GN+A +L+  GY 
Sbjct: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429

Query: 423 VPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQKYGVFKE 481
           V F YEEAIGYMF  + HDKDGI+A+VVFLQ  + W     +T  D+L++  +KYG FKE
Sbjct: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489

Query: 482 YNGYYIVPDLSLTDKVFSGIRSGF----SLQPTHIGQEFRVESYTDLTTGYQSNTPDSEP 537
           YNGYY+V +  +T+ +F  IR+ +    +  P  IG    V S+ DLTTG+QS+T D+ P
Sbjct: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549

Query: 538 RLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVXXXXXXXXXX 597
            LPVDPSSQMIT T         Q     VRFT RGSGTEPKLK+YIE            
Sbjct: 550 SLPVDPSSQMITIT-AKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKI 608

Query: 598 XXXXWDVLRREWFKPEQTGLATNF 621
               WDVL++EW +PE TG+ T++
Sbjct: 609 AKLTWDVLKKEWIRPEVTGVTTSY 632

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 108/430 (25%), Positives = 175/430 (40%), Gaps = 73/430 (16%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKDFA 111
           GT+GLR + +      N T   +QA       +    P+   + ++VVG D RF    + 
Sbjct: 19  GTSGLRKKTKVFMEEPNYTENFIQA-------VMDAIPEGSQDATLVVGGDGRF----YN 67

Query: 112 EVTIVAFLQLGFK--VYDLGFTEDASQDVVVHTPMVPFGID---HLRASGGIMITASHNP 166
           +V +     +G    V+ L       Q+ ++ TP     I    H + +GGI++TASHNP
Sbjct: 68  DVVVQKIAAIGAANGVHKLVI----GQNGILSTPAASHIIRTYPHAKITGGIILTASHNP 123

Query: 167 ---KMDNGYKVYYSNGC--------QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAV 215
              K D G K   SNG         +I     Q  S  I+AN        D +    +  
Sbjct: 124 GGAKNDFGIKYNLSNGGPAPESVTNKIFEKSKQLTSYKIVANFP----QLDLSKKGTDQR 179

Query: 216 QSEMLIDAKKVLVDQYVDTVRRSLVITNVNHTKAPWFVYTPLHGVGFE-IFEKILSSAWR 274
              +L+D    ++D     V+    I + +  K   F+ T    VGF+ +F+ +      
Sbjct: 180 YGPLLVD----IIDSTEAYVKLMKSIFDFDLIKK--FIKTQKETVGFKLLFDSLNGVTGP 233

Query: 275 LGQG----RDYLCVEE--QKY-PDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGND 327
            G+        L  EE  Q Y P P+F  +  P+P    A    +E  +K  I F   +D
Sbjct: 234 YGKALFVDELGLSAEESLQNYVPKPDFGGLH-PDPNLTYA-HTLVERVDKDKIAFGAASD 291

Query: 328 PDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQM 387
            D DR  +     G      G+ +  + A+Y  E          G     +  S  +S  
Sbjct: 292 GDGDRNMIYGY--GPAFVSPGDSVA-IIAEYASEIPYFAKQGIYG-----LARSFPTSAA 343

Query: 388 IKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGI 445
           I ++A+  G +  +  TG+K+      A++L   G       EE+ G   S+ V +KDG+
Sbjct: 344 IDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGV 395

Query: 446 SAAVVFLQML 455
            A + +L +L
Sbjct: 396 WAIMAWLNIL 405

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 96/392 (24%), Positives = 155/392 (39%), Gaps = 69/392 (17%)

Query: 93  DNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHL 152
           +N ++VVG D R+ + +  ++        G +   LG      Q+ ++ TP     I   
Sbjct: 53  ENATLVVGGDGRYYNNEVMQIIGAIAAANGVRKMILG------QNGILSTPAASHIIRSY 106

Query: 153 --RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDR---- 203
             + +GGI++TASHN   P+ D G K   SNG     P  + ++ +I    +        
Sbjct: 107 PEKCTGGIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNAIFEKSKQLTHYKIV 162

Query: 204 ----AWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSL-------VITNVNHTKAPWF 252
                 D + +  +     +L+D      D YV  ++           I N   TK    
Sbjct: 163 KNFPKIDFSKIGKDQKYGPLLVDVVDSTAD-YVALMKEIFDFDLIKKFIDNQRSTKGFKI 221

Query: 253 VYTPLHGV----GFEIFEKILSSAWRLGQGRDYLCVEE--QKY-PDPNFPTVSFPNPEEK 305
           ++  L+GV    G  IF K L            L  EE  Q Y P P+F  +  P+P   
Sbjct: 222 LFDSLNGVTGPYGEAIFVKELG-----------LPAEEVLQNYVPKPDFGGLH-PDPNLT 269

Query: 306 GALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRL 365
            A    +E  +K  I F   +D D DR  +     G      G+ +  +        Y  
Sbjct: 270 YA-HTLVERVDKEQIAFGAASDGDGDRNMIYG--CGPAFVSPGDSVAII------AEYAS 320

Query: 366 ESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFV 423
           E   FK      +  S  +S  I ++A+ +G    +  TG+K+      A++L   G   
Sbjct: 321 EIPYFKKQGIYGLARSFPTSAAIDRVAKEQGLACYEVPTGWKFFCALFDAKKLSICG--- 377

Query: 424 PFAYEEAIGYMFSDVVHDKDGISAAVVFLQML 455
               EE+ G   S+ V +KDG+ A V +L +L
Sbjct: 378 ----EESFG-TGSNHVREKDGVWAIVAWLNIL 404

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 103/430 (23%), Positives = 178/430 (41%), Gaps = 73/430 (16%)

Query: 56  GTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKDFAE 112
           GT+GLR + +   +  N       ++   + I ++ P+   N ++VVG D RF    + +
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRF----YND 68

Query: 113 VTIVAFLQL----GFKVYDLGFTEDASQDVVVHTPMVPFGIDHLRAS---GGIMITASHN 165
           + +   +Q+    G +   +G      Q+ ++ TP   + I + + S   GGI++TASHN
Sbjct: 69  IILDKIMQISAANGVRKLVIG------QNGILSTPAASYIIRNYKESCNGGGIILTASHN 122

Query: 166 ---PKMDNGYKVYYSNGC--------QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEA 214
              P+ D G K   SNG         +I           I+ NL   D       VK   
Sbjct: 123 PGGPENDIGIKYNLSNGGPAPESITDEIWEASKHLTHYKIIENLPQLDTTKVSENVKYGP 182

Query: 215 VQSEMLIDAKKVLVDQYVDTVRRSL---VITNVNHT---KAPW-FVYTPLHGVGFEIFEK 267
           +  + +ID+ K     YV+ ++      +I N  HT   K  W  ++  L+GV     + 
Sbjct: 183 LLVD-IIDSTK----SYVELMKEIFDFPLIRNFIHTQREKNNWKLLFDSLNGVTGPYGKT 237

Query: 268 ILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGND 327
           I      LG   D     +  +P P+F  +  P+P    A    +E  ++  I F   +D
Sbjct: 238 IFVD--ELGLLADETL--QNWHPLPDFGGLH-PDPNLTYA-HTLVERVDREMINFGAASD 291

Query: 328 PDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQM 387
            D DR  +     G      G+ +  +        Y  E   F       +  S  +S  
Sbjct: 292 GDGDRNMIYGY--GPSFVSPGDSLAII------SEYADEIPYFAKQGMFGVARSFPTSSA 343

Query: 388 IKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGI 445
           I ++A+ +G +  +  TG+K+      A++L   G       EE+ G   S+ + +KDG+
Sbjct: 344 IDRVAKAKGLNCYEVPTGWKFFCALFDAQKLSICG-------EESFG-TGSNHIREKDGL 395

Query: 446 SAAVVFLQML 455
            A V +L +L
Sbjct: 396 WAIVAWLNIL 405

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 104/426 (24%), Positives = 176/426 (41%), Gaps = 66/426 (15%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR + +   N  + T   +QA   + + I     D + VV G    +N++   ++ 
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA---IMEAIPEGSQDAVLVVGGDGRYYNNEVLQKIG 75

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHL--RASGGIMITASHN---PKMD 169
            +     G K   +G      Q+ ++ TP     I     +++GGI++TASHN   P+ D
Sbjct: 76  EIGAAN-GVKKLIVG------QNGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPEND 128

Query: 170 NGYKVYYSNGCQIIPPHDQRISQSIL---ANLEPWDRAWDCAAVKAEAVQ-----SEMLI 221
            G K   SNG     P  + ++ SI      L  +    +   +    +        +L+
Sbjct: 129 FGIKYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLV 184

Query: 222 DAKKVLVDQYVDTVRR----SLVITNVNH---TKAPWFVYTPLHGVGFEIFEKILSSAWR 274
           D   V   +YV  ++      L+   ++H   TK    ++  L+G+     + I   A  
Sbjct: 185 DVIDVTA-EYVKLMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKAIF--ADE 241

Query: 275 LGQGRDYLCVEE--QKY-PDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDAD 331
           LG     L  EE  Q Y P P+F  +  P+P    A    +E  +K  I F   +D D D
Sbjct: 242 LG-----LPAEEVLQNYEPKPDFGGLH-PDPNLTYA-HTLVERVDKEQIAFGAASDGDGD 294

Query: 332 RFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKM 391
           R  +     G      G+ +  +        Y  E   FK      +  S  +S  I ++
Sbjct: 295 RNMIYG--CGPAFVSPGDSVAII------AEYASEIPYFKKQGIYGLARSFPTSAAIDRV 346

Query: 392 AEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAV 449
           A+ +G +  +  TG+K+      A++L   G       EE+ G   S+ V +KDG+ A V
Sbjct: 347 AKAQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGVWAIV 398

Query: 450 VFLQML 455
            +L +L
Sbjct: 399 AWLNIL 404

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 102/426 (23%), Positives = 169/426 (39%), Gaps = 66/426 (15%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFP---DNLSVVVGHDHRFNSKDFA 111
           GT+GLR +     +  N T   +QA       I  + P   D  ++VVG D R+ +    
Sbjct: 19  GTSGLRKKTVIFKDEPNYTENFIQA-------IMESIPEGSDGATLVVGGDGRYYNDVIL 71

Query: 112 EVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGID--HLRASGGIMITASHN---P 166
           E         G K   +G      Q+ ++ TP     I   H + +GGI++TASHN   P
Sbjct: 72  EKIAKIGAANGVKKLVVG------QNGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGP 125

Query: 167 KMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDR--------AWDCAAVKAEAVQSE 218
           K D G K   +NG     P  + ++  I  N +              D + +        
Sbjct: 126 KNDMGIKYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGP 181

Query: 219 MLIDAKKVLVDQYVDTVRRSL---VITNVNHTKAP---W-FVYTPLHGVGFEIFEKILSS 271
           +LID   V    YV+ ++      +I    HT+     W  ++  L+G+     + I   
Sbjct: 182 ILIDVIDV-TKAYVEFLKEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVD 240

Query: 272 AWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDAD 331
            + L +      V +  +P P+F  +  P+P    A    ++  +K  I F   +D D D
Sbjct: 241 EFELPENE----VLQNYHPQPDFGGLH-PDPNLTYAR-SLVDRVDKEKIEFGAASDGDGD 294

Query: 332 RFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKM 391
           R  +     G      G+ +  + A+Y  E          G     +  S  +S  I ++
Sbjct: 295 RNMIYGY--GPAFVSPGDSVA-IIAEYASEIPYFAKQGIYG-----LARSFPTSAAIDRV 346

Query: 392 AEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAV 449
           A+  G    +  TG+K+      A++L   G       EE+ G   S+ V +KDG+ A V
Sbjct: 347 AKAHGLECYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGLWAIV 398

Query: 450 VFLQML 455
            +L +L
Sbjct: 399 AWLNVL 404

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 91/396 (22%), Positives = 167/396 (42%), Gaps = 50/396 (12%)

Query: 153 RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAA 209
           + +GGI++TASHN   PK D G K   SNG     P   +I + +   L+ +    D   
Sbjct: 109 KCTGGIILTASHNPGGPKNDMGIKYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPE 167

Query: 210 VK----AEAVQ-SEMLIDAKKVLVDQYVDTVRRSL---VITNVNH---TKAPW-FVYTPL 257
           +     AE VQ   +L+D      D YV+ ++      +I +  H   ++  W  ++  +
Sbjct: 168 LALDTLAENVQYGPLLVDVVDTTRD-YVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGM 226

Query: 258 HGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEK 317
           +GV     + I    + L        V +  +P P+F  +  P+P    A    ++  ++
Sbjct: 227 NGVTGPYGKAIFVDEFELPAEE----VLQNWHPQPDFGGIH-PDPNLTYA-RSLVDRVDR 280

Query: 318 HDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLA 377
            +I F   +D D DR  +     G      G+ +  +        Y  E   F       
Sbjct: 281 ENIEFGAASDGDGDRNMIYGA--GPAFVSPGDSVAII------AEYAAEIPYFAKQGIYG 332

Query: 378 MINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMF 435
           +  S  ++  I ++AE  G    +  TG+K+      A++L   G       EE+ G   
Sbjct: 333 LARSFPTASAIDRVAEKHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TG 384

Query: 436 SDVVHDKDGISAAVVFLQMLWSWKAQAL---TPFDVLQRAY-QKYG--VFKEYNGYYIVP 489
           S+ V +KDG+ A + +L +L  +  +         ++Q  + +KYG   F  Y+  ++  
Sbjct: 385 SNHVREKDGVWAIIAWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHV-- 442

Query: 490 DLSLTDKVFSGIRSGFSLQPTHIGQEFRVESYTDLT 525
           D +   KV   +RS ++ +P  +G +F  ++   +T
Sbjct: 443 DSNSAKKVIDNLRS-YTEKPGVVGSKFPTDTTLTVT 477

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 102/426 (23%), Positives = 173/426 (40%), Gaps = 66/426 (15%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR R +      N T   +QA   + + I     D++ +V G    +N     ++ 
Sbjct: 19  GTSGLRKRTKVFAEEPNYTENFIQA---ILEAIPEGVKDSVLLVGGDGRYYNDVVLQKIA 75

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGI---DHLRASGGIMITASHNPKMDN- 170
            +     G K   +G      Q+ ++ TP     I      + +GGI++TASHNP   N 
Sbjct: 76  AIGAAN-GVKRLVVG------QNGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNN 128

Query: 171 --GYKVYYSNGCQIIPPHDQRISQSI---LANLEPWDRAWDCAAVKAEAVQSEM------ 219
             G K   +NG     P  + ++ ++      L  +    D   V   A+  +       
Sbjct: 129 DFGIKYNLANGG----PAPENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTV 184

Query: 220 -LIDAKKVLVDQYVDTVRRSLVITNVNH---TKAPWFVYTPLHGV----GFEIFEKILSS 271
            +ID+ K  VD         L+ + VNH   TK    ++  L+GV    G  IF      
Sbjct: 185 DVIDSTKAYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIF------ 238

Query: 272 AWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDAD 331
           A  LG   D   V +  +P P+F  +  P+P    A    ++  ++ +I F   +D D D
Sbjct: 239 ADELGLPEDE--VLQNCHPKPDFGGLH-PDPNLTYA-RTLVDRVDRENIAFGAASDGDGD 294

Query: 332 RFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKM 391
           R  +     G      G+ +  + A+Y  E    + +   G     +  S  +SQ I  +
Sbjct: 295 RNMIYGA--GPAFVSPGDSVA-IIAEYASEIPYFQREGIYG-----LARSFPTSQAIDLV 346

Query: 392 AEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAV 449
           A+       +  TG+K+      A++L   G       EE+ G   S+ + +KDG+ A +
Sbjct: 347 AKHHNLSCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGLWAII 398

Query: 450 VFLQML 455
            +L +L
Sbjct: 399 AWLNIL 404

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 100/439 (22%), Positives = 167/439 (38%), Gaps = 89/439 (20%)

Query: 56  GTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTI 115
           GT+GLR +     N  N        Q +   I  +  D + +VVG D R+ +    ++  
Sbjct: 17  GTSGLRKKTAVFMN--NVHYTENFIQSILDAIPESSKDAI-LVVGGDGRYYNDKILQIIA 73

Query: 116 VAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGI------DHLRASGGIMITASHN---P 166
                 G +   +G      Q  ++ TP     I      D  + +GGI++TASHN   P
Sbjct: 74  AISAANGVRKLVIG------QHGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGP 127

Query: 167 KMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCA-------------AVKAE 213
           + D G K   SNG     P  + ++ +I      WD +                 +VK E
Sbjct: 128 ENDIGIKYNLSNGG----PAPESVTNAI------WDISKKLTHYKIVKGFPEINLSVKGE 177

Query: 214 AVQSEMLIDAKKV---------------LVDQYVDTVRRSLVITNVNHTKAPWFVYTPLH 258
                ++ID                   L+ ++VDT R          TK    ++  L+
Sbjct: 178 KSYGSLVIDVVDTTQEYVDFLKGIFDFDLIKKFVDTQRS---------TKNWKLLFDGLN 228

Query: 259 GVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKH 318
           GV       I      L +      V +  +P P+F  +  P+P    A    ++  +K 
Sbjct: 229 GVTGPYGRAIFVDELGLPENE----VLQNCHPKPDFGGIH-PDPNLTYAR-TLVDRVDKE 282

Query: 319 DITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAM 378
            I F   +D D DR  +     G      G+ +  + A+Y  E      +   G     +
Sbjct: 283 KIEFGAASDGDGDRNMIYGY--GPAFVSPGDSVA-IIAEYASEIPYFAQNGIYG-----L 334

Query: 379 INSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFS 436
             S  +S  I ++A+ +G +     TG+K+      A++L   G       EE+ G   S
Sbjct: 335 ARSFPTSTAIDRVAKAKGLNCYVVPTGWKFFCALFDAKKLSICG-------EESFG-TGS 386

Query: 437 DVVHDKDGISAAVVFLQML 455
           + V +KDG+ A + +L +L
Sbjct: 387 NHVREKDGVWAVIAWLNIL 405

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 105/455 (23%), Positives = 178/455 (39%), Gaps = 76/455 (16%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNL---SVVVGHDHRFNSKDFA 111
           GT+GLR + +      N T   +QA+           P+     ++VVG D R+ +    
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 112 EVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLR--ASGGIMITASHN---P 166
              +      G +   +G       + ++ TP     I   +   +GGI++TASHN   P
Sbjct: 72  NKIVSIAGANGVRKLIIG------HNGILSTPAASHVIRSYKEKCTGGIILTASHNPGGP 125

Query: 167 KMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKA-----EAVQSEMLI 221
           K D G K   +NG     P  + ++ +I      W+ +      K      E   S++ +
Sbjct: 126 KNDIGIKYNLANGG----PAPESVTNAI------WEASKKLTEYKVIEGLPELDTSKIAV 175

Query: 222 DAK--KVLVD------QYVDTVRRSL-------VITNVNHTKAPWFVYTPLHGVGFEIFE 266
           D K   +LVD       YVD ++           +T    TK    ++  L+GV     E
Sbjct: 176 DIKYGPLLVDIIDSTEAYVDYLKEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGE 235

Query: 267 KILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGN 326
            I      LG   D   V +  +P P+F  +  P+P    A    +E  +K +I F   +
Sbjct: 236 AIFVK--ELGLPADE--VLQNWHPLPDFGGLH-PDPNLTYA-HTLVERVDKENIQFGAAS 289

Query: 327 DPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQ 386
           D D DR  +     G      G+ +  +        Y  E   F       +  S  +S 
Sbjct: 290 DGDGDRNMIYGA--GPAFVSPGDSVAII------SEYADEIPYFAKQGIYGVARSFPTSS 341

Query: 387 MIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEEAIGYMFSDVVHDKDGIS 446
            + ++A+ +G +  +  TG+K+      + +     V    EE+ G   S+ + +KDG+ 
Sbjct: 342 ALDRVAKAKGLNCYEVPTGWKFFCALFDDQK-----VSICGEESFG-TGSNHIREKDGVW 395

Query: 447 AAVVFLQMLWSWKAQALT---PFDVLQRAY-QKYG 477
           A V +L +L  +     T       +Q  + QKYG
Sbjct: 396 AIVAWLNILAIYNKHNPTKDASIATIQHEFWQKYG 430

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 100/427 (23%), Positives = 166/427 (38%), Gaps = 68/427 (15%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR +     N  N T   +QA   +   I     D  ++VVG D RF +       
Sbjct: 19  GTSGLRKKTAIFMNEPNYTENFIQA---MLDAIPEGSQD-ATLVVGGDGRFYNDVIMNKI 74

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHL--RASGGIMITASHN---PKMD 169
                  G K   +G      Q+ ++ TP     I     + +GGI++TASHN   P+ D
Sbjct: 75  AAISAANGVKKLIIG------QNGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPEND 128

Query: 170 NGYKVYYSNGCQIIPPHDQRISQS------------ILANLEPWDRAWDCAAVKAEAVQS 217
            G K   +NG     P  + ++ +            I+ N  P     D + +  +    
Sbjct: 129 LGIKYNLANGG----PAPESVTNAIWEVSKKLTHYKIIKNFPP----LDLSKMGKDQKYG 180

Query: 218 EMLIDAKKVLVDQYVDTVRRSL-------VITNVNHTKAPWFVYTPLHGVGFEIFEKILS 270
            +L+D   V  D YVD ++           I     TK    ++  L+G+     + I  
Sbjct: 181 PLLVDIIDVTKD-YVDFLKEIFDFELIKKFIHKQRETKNWKLLFDSLNGITGPYGKAIFV 239

Query: 271 SAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDA 330
             + L        V +  +P P+F  +  P+P    A    +E  ++  I F   +D D 
Sbjct: 240 DEFDLPANE----VLQNWHPKPDFGGLH-PDPNLTYA-KTLVERVDREKIEFGAASDGDG 293

Query: 331 DRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKK 390
           DR  +     G      G+ +  + A+Y  E          G     +  S  +S  I +
Sbjct: 294 DRNMIYGA--GPAFVSPGDSVA-IIAEYASEIPYFVKQGIYG-----LARSFPTSAAIDR 345

Query: 391 MAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAA 448
           +A+  G    +  TG+K+      A++L   G       EE+ G   S+ + +KDG+ A 
Sbjct: 346 VAKAHGLSCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGLWAI 397

Query: 449 VVFLQML 455
           V +L +L
Sbjct: 398 VAWLNVL 404

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 125/331 (37%), Gaps = 63/331 (19%)

Query: 153 RASGGIMITASHNP---KMDNGYKVYYSNGCQIIPPHDQRI--------SQSILAN---- 197
           +  GGI++TASHNP   K D G K   SNG     P   +I        S  I+ +    
Sbjct: 109 KTQGGIILTASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWEISKKMTSFKIIKDFPEL 168

Query: 198 -LEPWDR----------AWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITNVNH 246
            LE   +            D      E V+     D  K  V +  DT    L+   +N 
Sbjct: 169 ELETLGKNKKYGPLLVDVIDTTKAYVEFVKQIFDFDLIKKFVHKQRDTKHWKLLFDGMNG 228

Query: 247 TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKG 306
              P+         G  IF         LG   D   V +Q +P P+F  V  P+P    
Sbjct: 229 VTGPY---------GKAIFVD------ELGLPADE--VLQQWHPSPDFGGVH-PDPNLTY 270

Query: 307 ALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLE 366
           A    ++  ++ +I F   +D D DR  +     G      G+ +  +        Y  E
Sbjct: 271 A-KALVDRVDRENIEFGAASDGDGDRNMIYGA--GPAFVSPGDSVAII------AEYAAE 321

Query: 367 SDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVP 424
              F       +  S  +S  I ++A+  G +  +  TG+K+      A++L   G    
Sbjct: 322 IPYFAKQGIYGLARSFPTSSAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG---- 377

Query: 425 FAYEEAIGYMFSDVVHDKDGISAAVVFLQML 455
              EE+ G   S+ V +KDGI A + +L +L
Sbjct: 378 ---EESFG-TGSNHVREKDGIWAILAWLNLL 404

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 111/443 (25%), Positives = 176/443 (39%), Gaps = 102/443 (23%)

Query: 56  GTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPDN---LSVVVGHDHRFNSKDFAE 112
           GT+GLR + +  F      T     +   + I    P+     ++V+G D R+    + +
Sbjct: 19  GTSGLRKKTKV-FEETPNYT-----ENFIQAIMEAIPEGSQGATLVIGGDGRY----YND 68

Query: 113 VTIVAFLQLGFKVYDLGFTEDASQDVVVH-----TPMVPFGID--HLRASGGIMITASHN 165
           V I        K+  +G      + V+ H     TP     I   H + +GGI++TASHN
Sbjct: 69  VVIQ-------KIAAIGSANGVRKIVIGHNGILSTPAASHIIRAYHEKCTGGIILTASHN 121

Query: 166 ---PKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLID 222
              P  D G K   +NG     P  + ++ SI      W ++ +    K   V+S   ID
Sbjct: 122 PGGPTNDFGIKYNLANGG----PAPESVTNSI------WHKSRELTHYK--IVESFPAID 169

Query: 223 AKKVLVDQ-YVDTVRRSLVITNVNHTKAPWFVYTPLHGVGFEIFE--------------- 266
             K+  DQ Y D     L++  V+ T A    Y  L     EIF+               
Sbjct: 170 LTKIGQDQKYGD-----LLVDIVDSTAA----YVELMK---EIFDFPLIKSFIDTQAKNG 217

Query: 267 -KILSSAWR--LGQGRDYLCVEE--------QKY-PDPNFPTVSFPNPEEKGALDKAIEL 314
            KIL  A     G   + L V+E        Q Y P P+F  +  P+P    A    +E 
Sbjct: 218 FKILFDAMNGVTGPYGEALFVKELGLPESSLQNYHPKPDFGGLH-PDPNLTYA-HTLVER 275

Query: 315 AEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTN 374
            +K+ I F   +D D DR  +     G      G+ +  +        Y      FK   
Sbjct: 276 VDKYGIQFGAASDGDGDRNMIYGA--GPAFVSPGDSVAII------AEYASAIPYFKKQG 327

Query: 375 PLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIG 432
              +  S  +S  I ++A+ +G +  +  TG+K+      A++L   G       EE+ G
Sbjct: 328 IYGLARSFPTSSAIDRVAKEQGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG 380

Query: 433 YMFSDVVHDKDGISAAVVFLQML 455
              S+ V +KDG+ A + +L +L
Sbjct: 381 -TGSNHVREKDGVWAIMAWLNIL 402

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 101/434 (23%), Positives = 174/434 (40%), Gaps = 82/434 (18%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKDFA 111
           GT+GLR + +   N  N T   +QA       I    P+   N ++VVG D RF +    
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA-------ILDAIPEGSENSTLVVGGDGRFYNDVIL 71

Query: 112 EVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGID--HLRASGGIMITASHN---P 166
           ++        G +   +G      Q  ++ TP     I   H   +GGI++TASHN   P
Sbjct: 72  QLIAEIGAANGVRKLIIG------QAGILSTPAASHIIRTYHEEVTGGIILTASHNPGGP 125

Query: 167 KMDNGYKVYYSNGCQIIPPHDQRISQSI---LANLEPWDRAWDCAAVKAEAVQSE----- 218
           + D G K   +NG     P  + ++ +I     NL  +    D   +    +        
Sbjct: 126 ENDIGIKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGP 181

Query: 219 MLIDA-----------KKV----LVDQYVDTVRRSLVITNVNHTKAPWFVYTPLHGVGFE 263
           +LID            K++    L+ ++++T R++      N+ K    ++  L+GV   
Sbjct: 182 LLIDIIDSTEDYVKFLKEIFDFPLIKKFIETQRKT------NNWK---LLFDSLNGVTGP 232

Query: 264 IFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFV 323
             + I    + L        V +  +P P+F  +  P+P    A    ++  +K  I F 
Sbjct: 233 YGKAIFVDEFGLPADE----VLQNWHPQPDFGGLH-PDPNLTYAR-TLVDRVDKEKIEFG 286

Query: 324 LGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTV 383
             +D D DR  +     G      G+ +  + A+Y  E          G     +  S  
Sbjct: 287 AASDGDGDRNMIYGY--GPAFVSPGDSVA-IIAEYANEIPYFAKQGIYG-----VARSFP 338

Query: 384 SSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHD 441
           +S  I  +A+ +G    +  TG+K+      A++L   G       EE+ G   S+ V +
Sbjct: 339 TSSAIDLVAKHKGLDCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVRE 390

Query: 442 KDGISAAVVFLQML 455
           KDG+ A + +L +L
Sbjct: 391 KDGVWAIIAWLNIL 404

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 128/331 (38%), Gaps = 64/331 (19%)

Query: 153 RASGGIMITASHN---PKMDNGYKVYYSNGC--------QIIPPHDQRISQSILANLEPW 201
           + +GGI++TASHN   P  D G K   SNG          I     +  S  I+ NL   
Sbjct: 113 KVTGGIILTASHNPGGPDNDIGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKNLPQL 172

Query: 202 DRAWDCAAVKAEAVQSEMLIDAKKV---------------LVDQYVDTVRRSLVITNVNH 246
           D      + K E     + ID   V               L+ ++VDT R          
Sbjct: 173 D-----LSTKGEKKLGNLEIDVVDVTQAYVEFLKEIFDFDLIKKFVDTQRS--------- 218

Query: 247 TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKG 306
           TK    ++  L+GV     + I      L +      V +  +P P+F  +  P+P    
Sbjct: 219 TKHWKLLFDGLNGVTGPYGKAIFVDELGLPENE----VLQNCHPKPDFGGI-HPDPNLTY 273

Query: 307 ALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLE 366
           A    +E  +K  I F   +D D DR  +     G      G+ +  + A+Y  E     
Sbjct: 274 A-RTLVERVDKEKIEFGAASDGDGDRNMIYGY--GPAFVSPGDSVA-IIAEYAKEIPYFA 329

Query: 367 SDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVP 424
                G     +  S  +S  I ++A  +G +  +  TG+K+      A++L   G    
Sbjct: 330 KQGIYG-----LARSFPTSSAIDRVAAEQGLNCYEVPTGWKFFCALFDAKKLSICG---- 380

Query: 425 FAYEEAIGYMFSDVVHDKDGISAAVVFLQML 455
              EE+ G   S+ V +KDG+ A + +L +L
Sbjct: 381 ---EESFG-TGSNHVREKDGVWAIIAWLNIL 407

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 97/445 (21%), Positives = 180/445 (40%), Gaps = 70/445 (15%)

Query: 34  IKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPD 93
           +KLV  K++ + +         GT+GLR + +       T   +QA   + + I     D
Sbjct: 5   VKLVPTKAFHDQKP--------GTSGLRKKTKVFQQEHYTENFIQA---ILEAIPEGCQD 53

Query: 94  NLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHL- 152
            + VV G    +N     ++  V     G K   +G      Q+ ++ TP     I    
Sbjct: 54  AILVVGGDGRYYNDVVMQKIAEVGSAN-GVKKLIIG------QNGLMSTPAASHLIRTYA 106

Query: 153 -RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQSI---------LANLE 199
            + +GGI++TASHN   P  D G K   +NG     P  ++++ ++            +E
Sbjct: 107 EKVTGGIILTASHNPGGPDNDLGIKYNLANGA----PAPEKVTSAMYEISKKLTHYKIVE 162

Query: 200 PWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRR----SLVITNVNHTKAPW---F 252
           P+ +  D + +  +    ++L+D        YV  V+      L+ + +   ++ +    
Sbjct: 163 PFPK-LDLSRIGTDQKYGDLLVDIIDTTA-AYVKLVKEIFDFDLIKSFLQKAQSEYDFKI 220

Query: 253 VYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAI 312
           ++  L+G+       I      LG    +L   +   P P+F  +  P+P    A D  +
Sbjct: 221 LFDALNGITGPYGRAIFVD--ELGLPEHFL---QHCTPLPDFGGLH-PDPNLTYAHD-LV 273

Query: 313 ELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKG 372
              ++  I F   +D D DR  +     G      G+ +  + A+Y  E      +   G
Sbjct: 274 SRVDEEQIAFGAASDGDGDRNMIYGA--GPAFVSPGDSVA-IIAEYAQEIPYFAKNGIHG 330

Query: 373 TNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEA 430
                +  S  +S  I  +A+  G +  +  TG+K+  N   +++L   G       EE+
Sbjct: 331 -----LARSFPTSGAIDLVAKEHGLNCYEVPTGWKFFCNLFDSKKLSICG-------EES 378

Query: 431 IGYMFSDVVHDKDGISAAVVFLQML 455
            G   SD + +KDG+ A + +L +L
Sbjct: 379 FG-TGSDHIREKDGLWAIIAWLNVL 402

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 125/319 (39%), Gaps = 39/319 (12%)

Query: 153 RASGGIMITASHNP---KMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAA 209
           + +GGI++TASHNP   + D G K   SNG     P   +I + I   +  +    D   
Sbjct: 109 KTTGGIILTASHNPGGLENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPE 167

Query: 210 VKAEAVQSEM--------LIDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYTPLH 258
           ++ E +            +ID  K  VD   +     L+   I N    K    ++  ++
Sbjct: 168 LELETLGKNKKYGPLLVDVIDITKAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMN 227

Query: 259 GVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKH 318
           GV     + I    + L        V +Q +P P+F  V  P+P    A    ++   + 
Sbjct: 228 GVTGPYGKAIFVDEFGLPADE----VLQQWHPQPDFGGVH-PDPNLTYA-KALVDRVNRE 281

Query: 319 DITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAM 378
            I F   +D D DR  +     G      G+ +  +        Y  E   FK      +
Sbjct: 282 KIEFGAASDGDGDRNMIYGA--GPAFVSPGDSVAII------AEYASEIPYFKKQGIYGL 333

Query: 379 INSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFS 436
             S  ++  I ++A+  G +     TG+K+      A +L   G       EE+ G   S
Sbjct: 334 ARSFPTASSIDRVAKAHGLNCYQVPTGWKFFCALFDANKLSICG-------EESFG-TGS 385

Query: 437 DVVHDKDGISAAVVFLQML 455
           + V +KDG+ A + +L +L
Sbjct: 386 NHVREKDGLWAIIAWLNVL 404

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 75/329 (22%), Positives = 128/329 (38%), Gaps = 59/329 (17%)

Query: 153 RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRA----- 204
           + +GGI++TASHN   P+ D G K   SNG     P  + ++  I      WD +     
Sbjct: 109 KCTGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNVI------WDISKKLTS 158

Query: 205 ---------WDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSL-------VITNVNHTK 248
                     D A +        +L+D   +  D YVD ++           I N   TK
Sbjct: 159 YKIIKDFPELDLATIGKNKKYGPLLVDIIDITKD-YVDFLKEIFDFKLIKKFIDNQRSTK 217

Query: 249 APWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGAL 308
               ++  ++GV     + I    + L        V +  +P P+F  +  P+P    A 
Sbjct: 218 NWKLLFDSMNGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYA- 271

Query: 309 DKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESD 368
              ++  ++  I F   +D D DR  +     G      G+ +  +        Y  E  
Sbjct: 272 STLVKRVDREKIEFGAASDGDGDRNMIYGY--GPSFVSPGDSVAII------AEYAAEIP 323

Query: 369 KFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFA 426
            F       +  S  +S  I ++A+  G +  +  TG+K+      A++L   G      
Sbjct: 324 YFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG------ 377

Query: 427 YEEAIGYMFSDVVHDKDGISAAVVFLQML 455
            EE+ G   S+ V +KDG+ A + +L +L
Sbjct: 378 -EESFG-TGSNHVREKDGVWAIMAWLNIL 404

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 108/492 (21%), Positives = 198/492 (40%), Gaps = 74/492 (15%)

Query: 56  GTAGLRSRMEAGFNRMNTLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKDFAE 112
           GT+GLR + +  F +    T     +   + I  + P+   N  +V+G D R+ +    +
Sbjct: 19  GTSGLRKKTKV-FEQTEHYT-----ENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 113 VTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGID--HLRASGGIMITASHNPKM-D 169
                    G +   +G      Q+ ++ TP     I   H + +GGI++TASHNP   D
Sbjct: 73  KIAEVGSANGVRKLIIG------QNGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPD 126

Query: 170 NGYKVYY--SNGCQIIPPHDQRISQSILA---NLEPWD-----RAWDCAAVKAEAVQSEM 219
           N + + Y  +NG     P  ++++ S+     NL  +         D   +        +
Sbjct: 127 NDFGIKYNLANGA----PAPEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNL 182

Query: 220 LIDAKKVLVDQYVDTVRR----SLVITNVNHTKAPW---FVYTPLHGVGFEIFEKILSSA 272
           L+D      + YV  ++      L+   + H +  +    ++  L+G+     + I    
Sbjct: 183 LVDVIDP-TEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVD- 240

Query: 273 WRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADR 332
             LG   D L   +   P P+F  +  P+P    A    +   ++ +I F   +D D DR
Sbjct: 241 -ELGLSEDSL---QNFVPKPDFGGLH-PDPNLTYA-HTLVSRVDRENIAFGAASDGDGDR 294

Query: 333 FSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMA 392
             +     G      G+ +  + A+Y  E      +   G     +  S  +S  I  +A
Sbjct: 295 NMIYGA--GPAFVSPGDSVA-IIAEYASEIPYFIKNGIHG-----LARSFPTSGAIDLVA 346

Query: 393 EVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVV 450
           + +     +  TG+K+  N   +++L   G       EE+ G   SD V +KDG+ A V 
Sbjct: 347 KEKNLDCYEVPTGWKFFCNLFDSKKLSICG-------EESFG-TGSDHVREKDGLWAIVA 398

Query: 451 FLQMLWSWKA----QALTPFDVLQRAYQKYG--VFKEYNGYYIVPDLSLTDKVFSGIRSG 504
           +L +L  +      +  +   + +  + KYG   F  Y+  +   D    +KV   +R+ 
Sbjct: 399 WLNVLAIYHRRHPDREPSIKTIQEEFWAKYGRTFFTRYD--FEECDTEDANKVIELLRT- 455

Query: 505 FSLQPTHIGQEF 516
           F+  P  +GQ F
Sbjct: 456 FAENPAVVGQPF 467

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 18/105 (17%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQ 216
           G+M+TASHNP  DNG K        ++ PH + ++         W++     A  A   Q
Sbjct: 59  GVMLTASHNPPEDNGVK--------LVDPHGEMLAAE-------WEKHATALANCASQGQ 103

Query: 217 SEMLIDAKKVLVDQY-VD-TVRRSLVITNVNHTKAPWFVYTPLHG 259
            E+L DA  +LVD+  +D  +R  +V+   +    P  +   L G
Sbjct: 104 QELL-DALHMLVDRLGLDLALRARVVVARDSRASGPQLLDALLDG 147

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 74/329 (22%), Positives = 127/329 (38%), Gaps = 59/329 (17%)

Query: 153 RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRA----- 204
             +GGI++TASHN   P+ D G K   SNG     P  + ++ +I      WD +     
Sbjct: 109 ECTGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAI------WDISKKLTN 158

Query: 205 ---------WDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSL-------VITNVNHTK 248
                     D   +        +LID   +    YVD +++          I N   TK
Sbjct: 159 YKIVKDFPELDLKTIGKNKKYGPLLIDVIDI-TKAYVDFLKKIFDFDLIKKFIDNQRSTK 217

Query: 249 APWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGAL 308
               ++  ++GV     + I    + L        V +  +P P+F  +  P+P    A 
Sbjct: 218 NWKLLFDSMNGVTGPYGKAIFVDEFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYA- 271

Query: 309 DKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESD 368
              ++  ++  I F   +D D DR  +     G      G+ +  +        Y  E  
Sbjct: 272 SSLVKRVDREKIEFGAASDGDGDRNMIYGY--GPSFVSPGDSVAII------AEYAAEIP 323

Query: 369 KFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFA 426
            F       +  S  +S  I ++A+  G +  +  TG+K+      A++L   G      
Sbjct: 324 YFAKQGIYGLARSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG------ 377

Query: 427 YEEAIGYMFSDVVHDKDGISAAVVFLQML 455
            EE+ G   S+ V +KDG+ A + +L +L
Sbjct: 378 -EESFG-TGSNHVREKDGVWAVMAWLNIL 404

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 21/131 (16%)

Query: 129 GFTEDASQ-DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIP 184
           GF  +AS  D V+ T  +   +  L   G   G+MITASHNP  DNG K+   +G  +I 
Sbjct: 28  GFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPSGAMLI- 86

Query: 185 PHDQRISQSILANLEPWDR-AWDCAAVKAEAVQSEMLIDAKKVLVDQYVD-TVRRSLVIT 242
                         E W++ A D A + +    +  ++   +V+    +D T    L++ 
Sbjct: 87  --------------ESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVG 132

Query: 243 NVNHTKAPWFV 253
           + +   +P+ +
Sbjct: 133 HDSRESSPYLM 143

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 129/322 (40%), Gaps = 45/322 (13%)

Query: 153 RASGGIMITASHN---PKMDNGYKVYYSNGCQIIPPHDQRISQS---ILANLEPWDRAWD 206
           + +GGI++TASHN   P+ D G K   SNG     P  + ++ +   I   L  +    D
Sbjct: 109 KCTGGIILTASHNPGGPENDMGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIVKD 164

Query: 207 CAAVKAEAVQSEM--------LIDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYT 255
              +  + +  +         +ID  K  V+   +    +L+   I N   TK    ++ 
Sbjct: 165 FPELDLQTIGKDRKYGPLLIDIIDVTKAYVELMEEIFDFNLIKKFIDNQRSTKNWKLLFD 224

Query: 256 PLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELA 315
            ++GV     + I    + L        V +  +P P+F  +  P+P    A    ++  
Sbjct: 225 SMNGVTGPYGKAIFVDKFGLPAEE----VLQNWHPSPDFGGMH-PDPNLTYA-SSLVKRV 278

Query: 316 EKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNP 375
           ++  I F   +D D DR  +     G      G+ +  +        Y  E   F     
Sbjct: 279 DREQIEFGAASDGDGDRNMIYGY--GPSFVSPGDSVAII------AEYAAEIPYFAKQGI 330

Query: 376 LAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGY 433
             +  S  +S  I ++A+  G +  +  TG+K+      A++L   G       EE+ G 
Sbjct: 331 YGLARSFPTSAAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG- 382

Query: 434 MFSDVVHDKDGISAAVVFLQML 455
             S+ V +KDG+ A + +L +L
Sbjct: 383 TGSNHVREKDGVWAIMAWLNIL 404

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQII---PPHDQRISQSI 194
           G+MITASHNP  DNG K+  S+G  ++    P   R++ S+
Sbjct: 55  GVMITASHNPPRDNGVKIVESDGSMLLQDWEPLATRLANSV 95

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 35/61 (57%), Gaps = 10/61 (16%)

Query: 129 GFTEDASQDVVVHTPMVPFGI-DHLRA------SGGIMITASHNPKMDNGYKVYYSNGCQ 181
           GF ++AS   +++T M   GI   LR+      + G+MITASHNP  DNG K+   NG  
Sbjct: 23  GFRDNAS---ILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPNGAM 79

Query: 182 I 182
           +
Sbjct: 80  L 80

>KAFR0A02890 Chr1 (600855..602441) [1587 bp, 528 aa] {ON} Anc_8.854
           YML120C
          Length = 528

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 72/174 (41%), Gaps = 31/174 (17%)

Query: 330 ADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWET--YRLESDKFKGTNPLAMINSTVS--- 384
           +D F    + N   R L  N+    F Q K     + +  + F G  P A + +  +   
Sbjct: 363 SDLFKKIPEQNSSTRALVTNQ----FCQVKGSNNIFAIGDNAFMGLPPTAQVANQQAEYL 418

Query: 385 SQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEE--AIGYM-----FSD 437
           S++  KM++V GFH  D L+  K    +   L     F PF+Y    A+ Y+      ++
Sbjct: 419 SKLFDKMSQVNGFH--DQLSARK---EKYDLLFEENKFKPFSYRHLGALAYLGSEKAIAN 473

Query: 438 VVHDKDGISAA----------VVFLQMLWSWKAQALTPFDVLQRAYQKYGVFKE 481
           + + K  +             +V+L ML S + +     D L+ A+ K   FKE
Sbjct: 474 ITYGKRSLYTGGGLMTFYIWRIVYLSMLLSARTRFKVCLDWLKLAFFKRDFFKE 527

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 5/53 (9%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQII---PPHDQRISQSILANLEPWDRAWD 206
           G+M+TASHNP +DNG KV    G  +I    P   +++ +I AN E +++ +D
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLA-NIAAN-ESFEKVYD 111

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 2/42 (4%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANL 198
           G+MITASHNP  DNG KV   +G  +I   +   ++  LANL
Sbjct: 58  GVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATE--LANL 97

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 162/418 (38%), Gaps = 50/418 (11%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR + +   N  N T   +QA   +   I     D+ ++VVG D RF +    ++ 
Sbjct: 19  GTSGLRKKTKIFMNEPNYTENFIQA---ILDAIPEGSEDS-TLVVGGDGRFYNDVILQLI 74

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGID--HLRASGGIMITASHN---PKMD 169
                  G +   +G      Q  ++ TP     I   H   +GGI++TASHN   P+ D
Sbjct: 75  AEIGAANGVRKLIIG------QAGILSTPATSHVIRTYHEEVTGGIILTASHNPGGPEND 128

Query: 170 NGYKVYYSNGC--------QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEML- 220
            G K   +NG          I     +  +  I+ N    D       VK   +  +++ 
Sbjct: 129 IGIKYNLANGAPAPESVTNAIWEESKKLTTYKIIKNFPKIDINTISENVKYGPLLVDIIE 188

Query: 221 -IDAKKVLVDQYVDTVRRSLVITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGR 279
             +A   L+    D       I     TK    ++  L+GV     + +    + L    
Sbjct: 189 PTEAHVELLKGIFDFPLIKKFIETQRKTKNWKLLFDSLNGVTGPYGKAVFVDEFGLPADE 248

Query: 280 DYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKH 339
               V +  +P P+F  +  P+P         ++  +K  I F   +D D DR  +    
Sbjct: 249 ----VLQNWHPQPDFGGLH-PDPNLTYG-RTLVDRVDKEKIEFGAASDGDGDRNMIYGY- 301

Query: 340 NGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHY 399
            G      G+ +  + A+Y  E          G     +  S  +S  I  +A+ +G   
Sbjct: 302 -GPAFVSPGDSVA-IIAEYANEIPYFAKQGIYG-----VARSFPTSSAIDLVAKHKGLDL 354

Query: 400 EDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQML 455
            +  TG+K+      AR+L   G       EE+ G   S+ + +KDG+ A V +L +L
Sbjct: 355 YEVPTGWKFFCALFDARKLSICG-------EESFG-TGSNHIREKDGLWAIVAWLNIL 404

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 149 IDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182
           + H   + G+M+TASHNP +DNG K+   NG  +
Sbjct: 55  LSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSML 88

>KNAG0K01750 Chr11 (366717..367961) [1245 bp, 414 aa] {ON} Anc_3.158
           YDL033C
          Length = 414

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 45/110 (40%), Gaps = 2/110 (1%)

Query: 292 PNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEI 351
           P+   + F N  ++G     +     ++   ++  DP     +V  +H+G W    G +I
Sbjct: 219 PDSQGICFVNNSQQGKFKNFLREYLPNEPGNIITLDPATGEKTVWGRHDGLWSYTVGQKI 278

Query: 352 GFLFAQYKWETYR--LESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHY 399
           G    Q K         S KFK TN + ++   V + + +    + GF +
Sbjct: 279 GIPMPQGKGHHKGAWFVSQKFKDTNEIVIVPGGVHTSLYRDSLSISGFRH 328

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQ--SILANLEPWDRAW 205
           G+M+TASHNP  DNG K+   NG  ++   + + +Q  +I AN E +D  +
Sbjct: 69  GVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAAN-ESFDEFY 118

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 92/419 (21%), Positives = 167/419 (39%), Gaps = 52/419 (12%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR + +      N T   +QA   +   I     D + +VVG D RF +    +  
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQA---IMDAIPEGAKDAV-LVVGGDGRFYNDVIMQKI 72

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHL--RASGGIMITASHN---PKMD 169
                  G +   +G      Q+ ++ TP     I     + +GGI++TASHN   P+ D
Sbjct: 73  AAIGAANGVRKLIIG------QNGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPEND 126

Query: 170 NGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSE-----MLIDAK 224
            G K   +NG     P   ++ + +   L  +    D   V    +  +     +L+D  
Sbjct: 127 LGIKYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDII 185

Query: 225 KVLVD--QYVDTVRRSLVITNVNHTKAP---W-FVYTPLHGVGFEIFEKILSSAWRLGQG 278
               D  +++  +    +I    H +     W  ++  L+G+     + I    + L   
Sbjct: 186 DTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPAD 245

Query: 279 RDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAK 338
                V +  +P P+F  +  P+P    A    +E  ++  I F   +D D DR  +   
Sbjct: 246 E----VLQNWHPQPDFGGLH-PDPNLTYA-HTLVERVDREKIEFGAASDGDGDRNMIYGA 299

Query: 339 HNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFH 398
             G      G+ +  + A+Y  E    +     G     +  S  +S  I ++A+ +G +
Sbjct: 300 --GPAFVSPGDSVA-IIAEYAKEIPYFQKQGIYG-----LARSFPTSGAIDRVAKAQGLN 351

Query: 399 YEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQML 455
             +  TG+K+      A++L   G       EE+ G   S+ + +KDG+ A   +L +L
Sbjct: 352 CYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGVWAICAWLNIL 402

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQII 183
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++
Sbjct: 38  DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 10/96 (10%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++   +    Q 
Sbjct: 38  DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQ- 96

Query: 194 ILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVD 229
            LAN   +   +D     AE V+   LI+ +K+ +D
Sbjct: 97  -LANAASFAATFD--EFYAELVK---LIEHEKIDLD 126

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQII 183
           D V+ T  +   +  L+  G   G+MITASHNP  DNG K+   +G  ++
Sbjct: 38  DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193
           D V+ T  V  G+  +   G   G+MITASHNP  DNG K        I+ P  + + QS
Sbjct: 36  DTVMFTTGVLAGLRSIYLEGRTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 11/60 (18%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQS 193
           D V+ T  V  G+  +   G   G+MITASHNP  DNG K        I+ P  + + QS
Sbjct: 36  DTVMFTTGVVAGLRSIFLEGKTVGVMITASHNPPEDNGVK--------IVDPKGEMLEQS 87

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 96/429 (22%), Positives = 163/429 (37%), Gaps = 71/429 (16%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR + +   N  + T   +QA   + + I  N PD  ++VVG D RF +       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA---MMESIP-NGPDGATLVVGGDGRFYNDVIMNKI 74

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGI---DHLRASGGIMITASHN---PKM 168
                  G +   +G      Q  ++ TP     I   +     GGI++TASHN   P+ 
Sbjct: 75  AAVGAANGIRKLIIG------QGGLLSTPAASHIIRTYEDRCNGGGIILTASHNPGGPEN 128

Query: 169 DNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEM--------- 219
           D G K    NG     P  + ++ +I      W+ +      K      E+         
Sbjct: 129 DLGIKYNLRNGG----PAPESVTNAI------WEASKKLTHYKIVTNFPELDMNKLGKNQ 178

Query: 220 --------LIDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYTPLHGVGFEIFEKI 268
                   +ID  +  V    +     L+   +T    TK    ++  L+G+     + I
Sbjct: 179 NYGPLLVDIIDPARAYVQFLKEIFDFDLIKSFLTEQRRTKGWKLLFDSLNGITGPYGKAI 238

Query: 269 LSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDP 328
               + L        V +  +P P+F  +  P+P    A    +   ++  I F   +D 
Sbjct: 239 FVDEFGLPAEE----VLQNWHPLPDFGGLH-PDPNLTYA-RTLVSRVDREKIAFGAASDG 292

Query: 329 DADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMI 388
           D DR  +     G      G+ +  + A+Y  E          G     +  S  +S  I
Sbjct: 293 DGDRNMIYGY--GPAFVSPGDSVA-IIAEYASEIPYFAKQGIYG-----LARSFPTSSAI 344

Query: 389 KKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGIS 446
            ++A  +G +  +  TG+K+      A +L   G       EE+ G   S+ + +KDGI 
Sbjct: 345 DRVAAKKGLNCYEVPTGWKFFCALFDANKLSICG-------EESFG-TGSNHIREKDGIW 396

Query: 447 AAVVFLQML 455
           A + +L +L
Sbjct: 397 AIIAWLNIL 405

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQ 216
           G+MITASHNP  DNG K+   +G              +LA  EP+      AA  A   +
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDG------------SMLLATWEPYAMQLANAASFATNFE 108

Query: 217 SEMLIDAKKVLVDQYVD---TVRRSLVITNVNHTKAPWFV 253
            E  ++  K++  + +D   TV   +V+   +   +P+ +
Sbjct: 109 -EFRVELAKLIEHEKIDLNTTVVPHIVVGRDSRESSPYLL 147

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 157 GIMITASHNPKMDNGYKVYYSNG 179
           G+M+TASHNP +DNG KV   +G
Sbjct: 60  GVMVTASHNPPVDNGVKVVEPDG 82

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 167/424 (39%), Gaps = 62/424 (14%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR +        + T   +QA   + + I     D  ++V+G D RF    + +V 
Sbjct: 20  GTSGLRKKTAVFMKEPHYTENFIQA---ILEAIPEGCKD-ATLVIGGDGRF----YNDVV 71

Query: 115 I--VAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLR--ASGGIMITASHN---PK 167
           I  +A +     V  L       Q+ ++ TP   + I   +  A+GGI++TASHN   P+
Sbjct: 72  INKIAAISAANGVRKLVI----GQNGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPE 127

Query: 168 MDNGYKVYYSNGCQIIPPHDQRISQS---ILANLEPWDRAWDCAAVKAEAVQSEM----- 219
            D G K   +NG     P  + ++ +   I   L  +    D   +    + ++      
Sbjct: 128 NDMGIKYNLANGG----PAPESVTNAMWEISKKLTSYKIIKDFPTLDLSKIGNDQKYGPL 183

Query: 220 ---LIDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAW 273
              +ID  K  V+         L+   IT    T     ++  L+G+     + I    +
Sbjct: 184 LVDIIDTTKEYVEFLKTIFDFPLIKAFITKQRETNNWKLLFDSLNGITGPYGKAIFVDEF 243

Query: 274 RLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRF 333
            L    + L   +  +P P+F  +  P+P    A    +E  ++  I F   +D D DR 
Sbjct: 244 GL-PAEEAL---QNWHPQPDFGGLH-PDPNLTYA-KTLVERVDREKIQFGAASDGDGDRN 297

Query: 334 SVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAE 393
            +     G      G+ +  +        Y  E   F       +  S  +S  I  +A+
Sbjct: 298 MIYGA--GPAFVSPGDSVAII------AEYAAEIPYFAKQGIYGLARSFPTSNAIDLVAQ 349

Query: 394 VEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVF 451
             G    +  TG+K+      A++L   G       EE+ G   S+ + +KDG+ A V +
Sbjct: 350 KHGLKCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHIREKDGLWAVVAW 401

Query: 452 LQML 455
           L +L
Sbjct: 402 LNVL 405

>Suva_4.217 Chr4 complement(383019..384308) [1290 bp, 429 aa] {ON}
           YDL033C (REAL)
          Length = 429

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/131 (19%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 283 CVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQ 342
           CV       P+   + F N  + G     ++         ++  DP++   +   KH+G 
Sbjct: 214 CVGLPTAAKPDSQGICFVNNSQHGKFKNFLKHYLPSSPGSIITIDPESGTKTPWGKHDGL 273

Query: 343 WRQLTGNEIGFLFAQ--YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHY- 399
           W    G ++G    Q    ++     S+K KGTN + ++    ++ + K    ++ F   
Sbjct: 274 WSYTIGQKVGLSMPQGDPNYQGSWFVSEKLKGTNEIVIVRGRDNAALYKNTIRIKSFASM 333

Query: 400 ---EDTLTGFK 407
              EDT+   +
Sbjct: 334 CPKEDTIKALQ 344

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 10/61 (16%)

Query: 129 GFTEDASQDVVVHTPMVPFGI-DHLRA------SGGIMITASHNPKMDNGYKVYYSNGCQ 181
           GF +DA+   V+ T MV  G+   LR+      + G+MITASHN   DNG K+   +G  
Sbjct: 27  GFRDDAT---VLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPDGSM 83

Query: 182 I 182
           +
Sbjct: 84  L 84

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKV 174
           D V+ T  +   I  +   G   G+MITASHNP  DNG K+
Sbjct: 36  DTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKI 76

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 95/422 (22%), Positives = 161/422 (38%), Gaps = 58/422 (13%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPD---NLSVVVGHDHRFNSKDFA 111
           GT+GLR + +   +  N T   +QA       I    P+   + ++VVG D RF +    
Sbjct: 19  GTSGLRKKTKVFMDEPNYTENFIQA-------IMDAIPEGSKDATLVVGGDGRFYNDVIM 71

Query: 112 EVTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGIDHLR--ASGGIMITASHN---P 166
                     G K   +G      Q+ ++ TP     I   +   +GGI++TASHN   P
Sbjct: 72  NKIAAIGAANGVKKLIIG------QNGILSTPAASHIIRTYKDKVTGGIILTASHNPGGP 125

Query: 167 KMDNGYKVYYSNGC-------QIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEM 219
             D G K    NG          I    ++++   + N  P     D A +        +
Sbjct: 126 TNDLGIKYNLGNGAPAPEAVTDAIWEASKKLTDYKIVNDFP---ELDLATIVENKKYGNL 182

Query: 220 L---IDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYTPLHGVGFEIFEKILSSAW 273
           L   ID+ +  V    +     L+   I +   TK    ++  L+GV     + I +  +
Sbjct: 183 LVDIIDSTEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEF 242

Query: 274 RLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRF 333
            L        V +   P P+F  +  P+P    A    +   +K  I F   +D D DR 
Sbjct: 243 GLPADE----VLQNYVPKPDFGGLH-PDPNLTYA-KTLVSRVDKEKIEFGAASDGDGDRN 296

Query: 334 SVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAE 393
            +     G      G+ +  + A+Y  E          G     +  S  +S  I ++A+
Sbjct: 297 MIYGY--GPTFVSPGDSVA-IIAEYASEIPYFAKQGIYG-----LARSFPTSSAIDRVAK 348

Query: 394 VEGFHYEDTLTGFKWLGNRARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQ 453
               +  +  TG+K+      E +     +    EE+ G   S+ V +KDG+ A + +L 
Sbjct: 349 EHNLNCYEVPTGWKFFCKLFDENK-----LSICGEESFG-TGSNHVREKDGVWAIMAWLN 402

Query: 454 ML 455
           +L
Sbjct: 403 IL 404

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 157 GIMITASHNPKMDNGYKV 174
           G+MITASHNP  DNG KV
Sbjct: 55  GVMITASHNPPEDNGVKV 72

>NDAI0A06680 Chr1 (1528516..1529757) [1242 bp, 413 aa] {ON}
           Anc_3.158 YDL033C
          Length = 413

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 11/120 (9%)

Query: 288 KYPDPNFPT---VSFPNPEEKGALDKAIE---LAEKHDITFVLGNDPDADRFSVAAKHNG 341
           K P  N P    + F N  + G+    ++      K DI  +L    D  +     +H G
Sbjct: 216 KLPTANKPDSQGICFVNNSQHGSFKNFLQNYIPENKGDIITIL---EDGKKKRKWGEHTG 272

Query: 342 QWRQLTGNEIGFLFAQ--YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHY 399
            W    G +IG    Q  +++      SDK K TN L ++    +  + K   +V  F Y
Sbjct: 273 LWSYTVGQKIGLSMPQGDHRFSGAWYVSDKLKSTNELVIVRGRDNPALYKNTVKVRDFCY 332

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 154 ASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEP---WDRAWD 206
           A  G+M+TASHNP  DNG KV    G  +  P       + LANL     +D+ W+
Sbjct: 56  AQVGVMVTASHNPPEDNGVKVVDPEGGML--PEQWEPLATRLANLAANGTFDQWWE 109

>Smik_4.203 Chr4 complement(372811..374055) [1245 bp, 414 aa] {ON}
           YDL033C (REAL)
          Length = 414

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 50/126 (39%), Gaps = 14/126 (11%)

Query: 292 PNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGN----DPDADRFSVAAKHNGQWRQLT 347
           P+   + F N  + G     +    KH +    GN    DP +   +   KH+G W    
Sbjct: 223 PDSQGICFVNNSQHGKFKNFL----KHYLPSSPGNIITFDPQSGAKTQWGKHDGMWSYTI 278

Query: 348 GNEIGFLFAQ--YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHY----ED 401
           G +IG    Q    ++     S+K K TN + ++    ++ + K    +E F      ED
Sbjct: 279 GQKIGISMPQGDPNYQGPWFVSEKLKDTNEIVIVRGRDNAALYKDTIRIENFASLSPKED 338

Query: 402 TLTGFK 407
           T+   +
Sbjct: 339 TINALR 344

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 58/133 (43%), Gaps = 21/133 (15%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIAS--NFPDNLSVVVGHDHRFNSKDFAE 112
           GT+GLR +     + ++ T   +QA+      I S  N P  +++VVG D RF +     
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT------IESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 113 VTIVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGI---DHLRASGGIMITASHN---P 166
                    G +   +G      Q  ++ TP     I   +   + GGI++TASHN   P
Sbjct: 73  KIAAVGAANGVRKLVIG------QGGLLSTPAASHVIRTYEDKCSGGGIILTASHNPGGP 126

Query: 167 KMDNGYKVYYSNG 179
           + D G K    NG
Sbjct: 127 ENDLGIKYNLPNG 139

>SAKL0C08756g Chr3 complement(802996..804237) [1242 bp, 413 aa] {ON}
           similar to uniprot|Q12093 Saccharomyces cerevisiae
           YDL033C SLM3 Mitochondrial protein with a potential role
           in protein synthesis the bacterial homolog is
           responsible for the 2-thiolation of mnm5s2U34 in tRNALys
           tRNAGlu and tRNAGln
          Length = 413

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 41/108 (37%), Gaps = 2/108 (1%)

Query: 292 PNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQWRQLTGNEI 351
           P+   + F N  + G     +E         V+  DPD  +  V  +H G W    G ++
Sbjct: 222 PDSQGICFVNNSQHGKFKHFLEHYLPSSRGNVVTVDPDTGKKHVWGQHLGLWSYTIGQKV 281

Query: 352 GFLFAQ--YKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGF 397
           G    Q   +++     SDK   TN + ++       + K    V+ F
Sbjct: 282 GISMPQGDSQYKGAWFVSDKLHHTNEIVIVRGRDHPALFKDALRVDEF 329

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 98/430 (22%), Positives = 163/430 (37%), Gaps = 73/430 (16%)

Query: 56  GTAGLRSRMEAGFNRMN-TLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVT 114
           GT+GLR + +   N  + T   +QA   + + I    P   ++VVG D RF +       
Sbjct: 19  GTSGLRKKTKVFMNEPHYTENFIQA---MMECIPEG-PSGATLVVGGDGRFYNDVIMNKI 74

Query: 115 IVAFLQLGFKVYDLGFTEDASQDVVVHTPMVPFGI----DHLRASGGIMITASHN---PK 167
                  G K   +G      Q  ++ TP     I    D+    GGI++TASHN   P+
Sbjct: 75  AAVGAANGIKKLVIG------QAGLLSTPAASHIIRTYEDNCNG-GGIILTASHNPGGPE 127

Query: 168 MDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEM-------- 219
            D G K    NG     P  + ++ +I      W+ +      K      E+        
Sbjct: 128 NDLGIKYNLPNGG----PAPESVTDAI------WEASKKLTHYKIIKSFPELDLNKIGKN 177

Query: 220 ---------LIDAKKVLVDQYVDTVRRSLV---ITNVNHTKAPWFVYTPLHGVGFEIFEK 267
                    +ID  K  V    +     L+   +T     K    ++  L+G+     + 
Sbjct: 178 QKYGPLLVDIIDPTKAYVKFLKEIFDFDLIKSFLTEQRKAKGWKLLFDSLNGITGPYGKA 237

Query: 268 ILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGND 327
           I    + L        V +  +P P+F  +  P+P    A    ++  ++  I F   +D
Sbjct: 238 IFVDEFGLPAEE----VLQNWHPLPDFGGLH-PDPNLTYA-RTLVDRVDREKIAFGAASD 291

Query: 328 PDADRFSVAAKHNGQWRQLTGNEIGFLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQM 387
            D DR  +     G      G+ +  + A+Y  E          G     +  S  +S  
Sbjct: 292 GDGDRNMIYGY--GPAFVSPGDSVA-IIAEYASEIPYFAKQGIYG-----LARSFPTSSA 343

Query: 388 IKKMAEVEGFHYEDTLTGFKWLGN--RARELENAGYFVPFAYEEAIGYMFSDVVHDKDGI 445
           I ++A  +G +  +  TG+K+      A++L   G       EE+ G   S+ V +KDGI
Sbjct: 344 IDRVAIKKGLNCYEVPTGWKFFCALFDAKKLSICG-------EESFG-TGSNHVREKDGI 395

Query: 446 SAAVVFLQML 455
            A V +L +L
Sbjct: 396 WAIVAWLNIL 405

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 137 DVVVHTPMVPFGIDHLRASG---GIMITASHNPKMDNGYKV 174
           D V+ T  V   +  +   G   G MITASHNP  DNG K+
Sbjct: 36  DTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76

>NCAS0A04790 Chr1 complement(956993..958660) [1668 bp, 555 aa] {ON}
           Anc_2.535
          Length = 555

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 328 PDADRFSVAAKHNGQWRQLTGNEIGFLFAQYK--WETYRLESDKFKGTNP 375
           PDA    ++   + +W++LT +E    + +++  WE YRL  D+++ T P
Sbjct: 366 PDAKVPELSKLASARWKELTDDEKKPFYEEFRTNWEKYRLLRDEYEKTLP 415

>ZYRO0D16588g Chr4 (1375905..1377329) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40034 Saccharomyces cerevisiae YER051W
           Hypothetical ORF
          Length = 474

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 285 EEQKYPDPNFPTVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQW 343
           E  K  DP    +  P P+E G  D+   L    DIT +LG +   D   V ++ N +W
Sbjct: 154 EPLKIVDPENTGMRLPRPQELGLADQERSLTVD-DITQILGGETPVDVMDVQSQQNERW 211

>Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {ON}
           YHR082C (REAL)
          Length = 1038

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 60/138 (43%), Gaps = 13/138 (9%)

Query: 430 AIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALTPFDVLQR-AYQKYGVFKEYNGYYIV 488
           A+G +F ++V  K+  S A    +    + A     FDV    AY  + V +    Y + 
Sbjct: 277 AMGIVFLNIVFHKNPFSIANQSDKSFCYFAANREALFDVFSTMAYDFFQVLR----YSLT 332

Query: 489 PDLSLTDKVFSGIRSGF-SLQPTHIGQEFRVESYTDLTTGYQSNTPDSEPRLPVDPSSQM 547
            D +  D   + +RS   +L    +  E+    Y +L  GY+    D  P  PV PSS  
Sbjct: 333 IDPANRD--LNMMRSELQNLSEYTLDDEY----YNNLDEGYEETMLDGLPPQPVPPSSAP 386

Query: 548 ITATLTPTSSTGRQGFSE 565
           ++   TP SS+ +Q   E
Sbjct: 387 VSLP-TPISSSNKQHMPE 403

>KLLA0E18481g Chr5 complement(1642554..1643948) [1395 bp, 464 aa]
           {ON} some similarities with uniprot|P33417 Saccharomyces
           cerevisiae YKL032C IXR1 Protein that binds DNA
           containing intrastrand cross-links formed by cisplatin
           contains two HMG (high mobility group box) domains which
           confer the ability to bend cisplatin-modified DNA
           mediates aerobic transcriptional repression of COX5b
          Length = 464

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)

Query: 323 VLGNDPDADRFSVAAKHNGQWRQLTGNEIGFLFAQYK--WETYRLESDKFKGTNP 375
           +L   PDA    ++   + +W+ +T  E    F Q+K  WE YR+   K++ T P
Sbjct: 335 LLKQYPDAKVPELSKLSSAKWKSMTDEEKKPFFDQFKTNWEKYRIARKKYEETLP 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,293,717
Number of extensions: 2792648
Number of successful extensions: 7200
Number of sequences better than 10.0: 83
Number of HSP's gapped: 7274
Number of HSP's successfully gapped: 83
Length of query: 621
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 505
Effective length of database: 40,180,143
Effective search space: 20290972215
Effective search space used: 20290972215
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)